BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10274_g2_i1 len=659 path=[1771:0-658]

Length=659
                                                                      Score     E

ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                424   8e-139   
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    423   2e-138   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                422   5e-138   
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         417   3e-136   
gb|KHG26452.1|  Plasma membrane ATPase 4                                407   2e-135   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                415   3e-135   
gb|KHG28536.1|  Plasma membrane ATPase 4                                406   4e-135   
emb|CAD29579.1|  proton-exporting ATPase                                394   6e-135   Zea mays [maize]
emb|CAD62443.1|  proton-exporting ATPase                                394   6e-135   Zea mays [maize]
emb|CAG28306.1|  proton-exporting ATPase                                391   4e-134   Cucumis sativus [cucumbers]
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                412   5e-134   
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    411   6e-134   
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             409   9e-134   
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           410   1e-133   Populus trichocarpa [western balsam poplar]
ref|XP_006382164.1|  H+-ATPase family protein                           410   1e-133   
gb|KHN35778.1|  Plasma membrane ATPase 4                                392   1e-133   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   410   2e-133   
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             407   4e-133   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             408   8e-133   
gb|AAB17186.1|  plasma membrane H+-ATPase                               408   8e-133   Solanum lycopersicum
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      408   9e-133   
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                408   9e-133   
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    407   2e-132   Ricinus communis
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           407   3e-132   
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    401   3e-132   Ricinus communis
gb|AAQ19039.1|  P-type H+-ATPase                                        389   3e-132   Vicia faba [broad bean]
gb|AAQ19041.1|  P-type H+-ATPase                                        389   4e-132   Phaseolus acutifolius
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 405   5e-132   
gb|AAO72564.1|  plasma membrane H+-ATPase-like protein                  393   6e-132   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           406   8e-132   
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                405   1e-131   
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                405   1e-131   
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         405   1e-131   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 405   1e-131   
gb|EPS65442.1|  hypothetical protein M569_09334                         405   1e-131   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              403   8e-131   Daucus carota [Queen Anne's lace]
dbj|BAD16685.1|  plasma membrane H+-ATPase                              402   1e-130   Daucus carota [Queen Anne's lace]
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           402   2e-130   
emb|CAG28305.1|  proton-exporting ATPase                                382   2e-130   Cucumis sativus [cucumbers]
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                402   2e-130   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                402   2e-130   
gb|EPS63245.1|  hypothetical protein M569_11541                         402   2e-130   
emb|CDP02997.1|  unnamed protein product                                402   2e-130   
gb|AAO22672.1|  putative plasma membrane proton ATPase                  382   2e-130   Arabidopsis thaliana [mouse-ear cress]
gb|KHN16462.1|  Plasma membrane ATPase 4                                402   3e-130   
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 402   3e-130   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           401   4e-130   
gb|AFM52333.1|  plasma membrane H+-ATPase                               401   4e-130   
ref|XP_002324397.1|  H+-ATPase family protein                           401   4e-130   Populus trichocarpa [western balsam poplar]
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           401   5e-130   
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                401   5e-130   
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      401   5e-130   
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    401   6e-130   
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                401   7e-130   
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     401   7e-130   
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    400   7e-130   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4-like           400   7e-130   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           400   9e-130   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              400   1e-129   Sesbania rostrata
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             400   2e-129   
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 399   3e-129   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                399   3e-129   
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                399   4e-129   Vitis vinifera
emb|CAN64375.1|  hypothetical protein VITISV_014422                     399   4e-129   Vitis vinifera
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                399   5e-129   
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          398   5e-129   
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           398   7e-129   
gb|KHN15309.1|  Plasma membrane ATPase 4                                398   9e-129   
emb|CAC10554.1|  plasma membrane proton ATPase                          379   9e-129   Hordeum vulgare [barley]
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    398   9e-129   
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  398   9e-129   
dbj|BAD16684.1|  plasma membrane H+-ATPase                              398   1e-128   Daucus carota [Queen Anne's lace]
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            390   1e-128   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     398   1e-128   
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                397   1e-128   
gb|AFW04239.1|  plasma membrane H+-ATPase                               397   1e-128   
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       397   1e-128   
gb|AAB84202.2|  plasma membrane proton ATPase                           397   1e-128   Kosteletzkya virginica [seashore mallow]
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     397   1e-128   
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     397   1e-128   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          397   2e-128   Sorghum bicolor [broomcorn]
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                397   2e-128   
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       393   2e-128   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           397   3e-128   
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             397   3e-128   
ref|XP_010094202.1|  Plasma membrane ATPase 4                           397   3e-128   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           396   3e-128   
gb|ACE77057.1|  plasma membrane proton pump                             397   3e-128   Cucumis sativus [cucumbers]
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    396   3e-128   
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           396   4e-128   
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             396   5e-128   
dbj|BAD16687.1|  plasma membrane H+-ATPase                              396   5e-128   Daucus carota [Queen Anne's lace]
gb|ACL54575.1|  unknown                                                 396   6e-128   Zea mays [maize]
dbj|BAG94605.1|  unnamed protein product                                394   6e-128   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC77530.1|  plasma membrane H+-ATPase                              395   1e-127   Sesbania rostrata
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          395   1e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             395   1e-127   
ref|NP_001054118.1|  Os04g0656100                                       395   1e-127   Oryza sativa Japonica Group [Japonica rice]
emb|CAD29313.1|  plasma membrane H+-ATPase                              394   2e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010111939.1|  Plasma membrane ATPase 4                           394   2e-127   
emb|CAC29436.1|  P-type H+-ATPase                                       394   3e-127   Vicia faba [broad bean]
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     394   3e-127   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             394   3e-127   
emb|CAA59799.1|  H(+)-transporting ATPase                               394   4e-127   Phaseolus vulgaris [French bean]
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like           394   4e-127   
emb|CDY03545.1|  BnaC03g68040D                                          385   4e-127   
dbj|BAG55917.1|  H+-ATPase                                              375   6e-127   Mimosa pudica [sensitive-plant]
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           393   7e-127   
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          393   7e-127   
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          393   7e-127   
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  393   8e-127   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     394   8e-127   
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          392   1e-126   
gb|KEH35952.1|  plasma membrane H+-ATPase                               392   1e-126   
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  392   1e-126   
gb|AHK23067.1|  plasma membrane ATPase 4                                392   2e-126   
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          391   3e-126   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    391   3e-126   
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           391   3e-126   
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          391   3e-126   
gb|KEH39753.1|  plasma membrane H+-ATPase                               391   3e-126   
emb|CAC50884.1|  plasma membrane H+-ATPase                              382   4e-126   Hordeum vulgare [barley]
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           391   4e-126   
gb|KEH19962.1|  plasma membrane H+-ATPase                               390   5e-126   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             391   5e-126   
emb|CBI20766.3|  unnamed protein product                                389   5e-126   
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     390   7e-126   
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                389   8e-126   
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             390   8e-126   
dbj|BAH56991.1|  AT4G30190                                              387   9e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                390   1e-125   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             390   1e-125   
dbj|BAA37150.1|  p-type H+-ATPase                                       389   1e-125   Vicia faba [broad bean]
ref|XP_007023381.1|  H(+)-ATPase 9                                      389   1e-125   
ref|XP_003594954.1|  Plasma membrane ATPase                             390   1e-125   
gb|KEH39758.1|  plasma membrane H+-ATPase                               389   2e-125   
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                389   2e-125   Vitis vinifera
gb|KHN22686.1|  Plasma membrane ATPase 4                                389   2e-125   
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   387   2e-125   
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    389   3e-125   
dbj|BAO45902.1|  plasma membrane H+-ATPase                              389   3e-125   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  389   3e-125   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             389   4e-125   
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   387   5e-125   
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             388   5e-125   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             388   5e-125   
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             388   6e-125   
dbj|BAL41366.1|  plasma membrane H+-ATPase                              388   6e-125   
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     387   7e-125   
gb|KHF98166.1|  Plasma membrane ATPase 4                                379   1e-124   
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    385   1e-124   
ref|XP_007023380.1|  H(+)-ATPase 9                                      386   1e-124   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             387   1e-124   
gb|ABW25091.1|  plasma membrane proton pump                             387   2e-124   Cucumis sativus [cucumbers]
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           387   2e-124   
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    387   2e-124   
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           387   2e-124   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  387   2e-124   
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             386   2e-124   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          386   2e-124   Zea mays [maize]
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    384   3e-124   
dbj|BAJ34124.1|  unnamed protein product                                386   3e-124   
emb|CAB69823.1|  plasma membrane H+ ATPase                              386   3e-124   Prunus persica
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             386   3e-124   
dbj|BAF03589.1|  P-type H+-ATPase                                       386   3e-124   Zostera marina
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             386   3e-124   
ref|NP_194748.1|  H(+)-ATPase 2                                         386   3e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     385   4e-124   
gb|AEO22063.1|  plasma membrane H+-ATPase                               386   4e-124   
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    380   4e-124   Ricinus communis
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           386   4e-124   
ref|NP_178762.1|  H(+)-ATPase 6                                         385   4e-124   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       384   4e-124   
gb|AAY42949.1|  plasma membrane H+ ATPase                               385   5e-124   Lupinus albus
gb|KHN17608.1|  Plasma membrane ATPase 4                                385   5e-124   
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    385   5e-124   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          385   6e-124   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     385   6e-124   
ref|NP_001190870.1|  H(+)-ATPase 2                                      386   6e-124   
emb|CDY14186.1|  BnaA08g13170D                                          385   7e-124   
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          385   7e-124   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    385   8e-124   
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           385   8e-124   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             385   8e-124   
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    384   8e-124   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    385   8e-124   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    384   9e-124   
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           385   1e-123   
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    384   1e-123   
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    384   1e-123   
gb|EMT26270.1|  Plasma membrane ATPase                                  384   2e-123   
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    384   2e-123   
gb|KFK29576.1|  h(+)-atpase 2                                           384   2e-123   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     384   2e-123   
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    378   2e-123   Ricinus communis
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    384   2e-123   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    384   2e-123   
dbj|BAF01699.1|  plasma membrane ATPase 3                               367   3e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             383   3e-123   
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type-like     383   4e-123   
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           383   4e-123   
gb|AAN15220.1|  plasma membrane P-type proton pump ATPase               383   5e-123   Hordeum vulgare subsp. vulgare [barley]
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg             382   7e-123   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  382   8e-123   
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         382   8e-123   
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   380   8e-123   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     382   1e-122   
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          382   1e-122   
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             382   1e-122   
emb|CDX93092.1|  BnaA03g38140D                                          381   3e-122   
gb|KGN60167.1|  hypothetical protein Csa_3G881800                       373   3e-122   
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       381   4e-122   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          380   4e-122   
gb|AAY42948.1|  plasma membrane H+ ATPase                               380   5e-122   Lupinus albus
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     380   6e-122   
gb|KFK27283.1|  h(+)-atpase 3                                           380   6e-122   
ref|XP_002307856.1|  ATPase 6 family protein                            380   6e-122   Populus trichocarpa [western balsam poplar]
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...    380   7e-122   
emb|CDY50939.1|  BnaC03g74390D                                          380   7e-122   
gb|ABA18090.1|  putative plasma membrane ATPase                         379   8e-122   Olimarabidopsis pumila
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    380   8e-122   
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    379   9e-122   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          379   1e-121   
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    379   1e-121   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     380   1e-121   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     379   1e-121   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          379   1e-121   
ref|NP_179486.1|  H(+)-ATPase 1                                         379   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             379   2e-121   
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     379   2e-121   
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     377   2e-121   
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          379   2e-121   
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          378   2e-121   
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    378   2e-121   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     378   3e-121   
gb|KEH39623.1|  plasma membrane H+-ATPase                               378   3e-121   
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             378   4e-121   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             378   4e-121   
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           378   4e-121   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             378   4e-121   
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    378   4e-121   
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    378   5e-121   
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             377   5e-121   
emb|CDX82608.1|  BnaC07g02580D                                          377   5e-121   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             378   5e-121   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             378   5e-121   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             378   5e-121   
gb|KHN01287.1|  Plasma membrane ATPase 4                                376   5e-121   
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             377   5e-121   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   378   5e-121   
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          377   6e-121   
gb|ABA18112.1|  putative plasma membrane ATPase                         377   6e-121   Arabidopsis arenosa
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    377   6e-121   
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     377   6e-121   
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          377   6e-121   Vitis vinifera
ref|NP_189850.1|  H(+)-ATPase 8                                         377   7e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    378   8e-121   
gb|KFK32649.1|  hypothetical protein AALP_AA6G270500                    374   8e-121   
emb|CDY64741.1|  BnaCnng44750D                                          377   9e-121   
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          377   1e-120   
dbj|BAJ33915.1|  unnamed protein product                                377   1e-120   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           377   1e-120   
gb|KCW89137.1|  hypothetical protein EUGRSUZ_A01453                     375   1e-120   
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             377   1e-120   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    376   1e-120   
emb|CBW30173.1|  Plasma membrane ATPase 4                               376   1e-120   
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     376   2e-120   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     376   2e-120   Vitis vinifera
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          376   2e-120   
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             376   2e-120   
ref|XP_010539792.1|  PREDICTED: ATPase 3, plasma membrane-type-like     375   2e-120   
gb|EPS59184.1|  hypothetical protein M569_15622                         364   2e-120   
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                376   2e-120   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    376   2e-120   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           377   3e-120   
gb|AAV71150.1|  plasma membrane H+-ATPase                               375   3e-120   Triticum aestivum [Canadian hard winter wheat]
gb|AAF27113.1|AC018849_1  aha9, 5' partial; 1-2403                      366   3e-120   
gb|AAY42950.1|  plasma membrane H+ ATPase                               375   3e-120   Lupinus albus
ref|XP_006848753.1|  hypothetical protein AMTR_s00026p00031590          360   4e-120   
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like           375   4e-120   
gb|EMS60594.1|  Plasma membrane ATPase                                  375   4e-120   
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    375   4e-120   
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                375   5e-120   
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             375   6e-120   
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   375   6e-120   
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg             374   7e-120   
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             375   7e-120   
emb|CBI35956.3|  unnamed protein product                                375   7e-120   
emb|CAN78639.1|  hypothetical protein VITISV_031738                     375   8e-120   
gb|KHN38020.1|  Plasma membrane ATPase                                  373   1e-119   
emb|CBW30211.1|  Plasma membrane ATPase                                 374   1e-119   
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like           374   1e-119   
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                374   1e-119   
gb|KHN22411.1|  ATPase 9, plasma membrane-type                          373   2e-119   
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     374   2e-119   
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           373   3e-119   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     373   3e-119   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          373   3e-119   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          373   3e-119   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          370   4e-119   
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             372   6e-119   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       372   7e-119   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             372   7e-119   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          373   8e-119   
ref|XP_002324564.1|  ATPase 6 family protein                            372   8e-119   
emb|CDO98206.1|  unnamed protein product                                372   9e-119   
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             372   9e-119   
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       372   9e-119   
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          372   1e-118   
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             371   1e-118   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       372   1e-118   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             371   1e-118   
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       372   1e-118   
ref|XP_007012006.1|  H(+)-ATPase 8                                      371   1e-118   
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          371   2e-118   
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          371   2e-118   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           371   2e-118   
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          370   2e-118   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     370   2e-118   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             370   2e-118   
gb|ABR18001.1|  unknown                                                 370   3e-118   
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           370   4e-118   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           370   4e-118   
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          370   4e-118   
gb|AEQ27822.1|  PM H+-ATPase R                                          370   5e-118   
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             370   5e-118   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     369   6e-118   
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   370   6e-118   
gb|AFK46374.1|  unknown                                                 349   6e-118   
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           369   8e-118   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          369   8e-118   
ref|XP_002309321.1|  ATPase 6 family protein                            369   8e-118   
ref|NP_200545.1|  H(+)-ATPase 3                                         369   8e-118   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    369   8e-118   
ref|XP_009150710.1|  PREDICTED: ATPase 1, plasma membrane-type-like     369   8e-118   
gb|AAL09726.1|  AT5g57350/MJB24_16                                      369   9e-118   
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    369   1e-117   
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    369   1e-117   
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     369   1e-117   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          369   1e-117   
gb|AAK31799.2|  plasma membrane H+ ATPase                               369   1e-117   
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    369   1e-117   
dbj|BAM20988.1|  plasma membrane H+-ATPase                              355   2e-117   
ref|XP_002304716.2|  H+-ATPase family protein                           369   2e-117   
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     368   3e-117   
ref|XP_006401213.1|  hypothetical protein EUTSA_v10015530mg             367   4e-117   
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    366   4e-117   
ref|XP_002297804.2|  H+-ATPase family protein                           367   4e-117   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     367   5e-117   
ref|NP_001185450.1|  H(+)-ATPase 9                                      367   7e-117   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    367   7e-117   
ref|NP_180028.1|  H(+)-ATPase 5                                         366   7e-117   
ref|NP_178181.1|  H(+)-ATPase 9                                         367   8e-117   
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          366   1e-116   
emb|CDY38294.1|  BnaA10g11420D                                          366   1e-116   
emb|CDY25913.1|  BnaC09g32850D                                          366   1e-116   
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like           366   1e-116   
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    364   1e-116   
gb|AAA98916.1|  Theoretical protein with similarity to Swiss-Prot...    363   2e-116   
emb|CDX67957.1|  BnaA07g19970D                                          364   2e-116   
ref|XP_009126895.1|  PREDICTED: ATPase 3, plasma membrane-type-like     359   2e-116   
dbj|BAM20992.1|  plasma membrane H+-ATPase                              352   2e-116   
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...    365   2e-116   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       365   2e-116   
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           365   3e-116   
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     365   3e-116   
gb|AAD46186.1|  plasma membrane proton ATPase                           365   3e-116   
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          364   5e-116   
emb|CDY39956.1|  BnaC06g40340D                                          362   7e-116   
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like           364   7e-116   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     363   9e-116   
ref|XP_010467151.1|  PREDICTED: ATPase 6, plasma membrane-type-like     343   2e-115   
emb|CDX87330.1|  BnaA07g35430D                                          361   2e-115   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    363   2e-115   
ref|XP_008650595.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    363   4e-115   
tpg|DAA43142.1|  TPA: hypothetical protein ZEAMMB73_734128              363   4e-115   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          362   7e-115   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             362   7e-115   
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    360   1e-114   
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        360   1e-114   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    360   2e-114   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             360   2e-114   
gb|EYU24620.1|  hypothetical protein MIMGU_mgv1a001404mg                357   2e-114   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             360   3e-114   
emb|CDX76810.1|  BnaC08g33960D                                          357   3e-114   
ref|XP_002465931.1|  hypothetical protein SORBIDRAFT_01g048440          359   6e-114   
emb|CDY47940.1|  BnaA02g08160D                                          359   6e-114   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    358   8e-114   
dbj|BAM20989.1|  plasma membrane H+-ATPase                              358   1e-113   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    358   1e-113   
ref|XP_010472895.1|  PREDICTED: ATPase 9, plasma membrane-type is...    358   2e-113   
gb|AAB41898.1|  H+-transporting ATPase                                  357   2e-113   
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...    358   2e-113   
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     357   2e-113   
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    357   2e-113   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                357   2e-113   
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     357   3e-113   
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    357   3e-113   
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             357   3e-113   
gb|KGN60742.1|  hypothetical protein Csa_2G009310                       353   4e-113   
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           357   4e-113   
gb|AAA34096.1|  plasma membrane H+ ATPase                               342   7e-113   
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          355   7e-113   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    356   7e-113   
ref|XP_002459147.1|  hypothetical protein SORBIDRAFT_03g046720          354   8e-113   
ref|XP_004159431.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 8, pl...    354   1e-112   
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     354   1e-112   
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     355   2e-112   
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like     354   2e-112   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     355   3e-112   
gb|ACR38028.1|  unknown                                                 338   4e-112   
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       350   4e-112   
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                354   4e-112   
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     353   4e-112   
dbj|BAM20990.1|  plasma membrane H+-ATPase                              354   5e-112   
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          354   5e-112   
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like     352   6e-112   
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    351   9e-112   
gb|KEH37844.1|  plasma membrane H+-ATPase                               352   1e-111   
ref|XP_009117122.1|  PREDICTED: ATPase 5, plasma membrane-type          353   1e-111   
emb|CDY34767.1|  BnaA09g41340D                                          353   1e-111   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     353   1e-111   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     353   1e-111   
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    353   1e-111   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     352   2e-111   
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                     352   2e-111   
ref|NP_001136587.1|  uncharacterized protein LOC100216710               337   2e-111   
tpg|DAA59899.1|  TPA: membrane H(+)-ATPase1                             338   2e-111   
gb|KHN22097.1|  ATPase 8, plasma membrane-type                          356   3e-111   
dbj|BAK05828.1|  predicted protein                                      352   3e-111   
tpg|DAA59901.1|  TPA: membrane H(+)-ATPase1                             338   4e-111   
gb|KEH32174.1|  plasma membrane H+-ATPase                               351   5e-111   
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     351   6e-111   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           351   6e-111   
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          351   6e-111   
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     351   7e-111   
dbj|BAO02511.1|  predicted H+ ATPase ortholog                           343   9e-111   
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like     350   9e-111   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     350   1e-110   
gb|KHG14131.1|  ATPase 4, plasma membrane-type -like protein            345   1e-110   
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    350   1e-110   
dbj|BAC77533.1|  plasma membrane H+-ATPase                              333   4e-110   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             348   1e-109   
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          348   1e-109   
ref|NP_001169998.1|  uncharacterized protein LOC100383904               332   1e-109   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     347   2e-109   
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    344   5e-109   
ref|XP_004985855.1|  PREDICTED: plasma membrane ATPase-like             346   5e-109   
dbj|BAM20991.1|  plasma membrane H+-ATPase                              346   6e-109   
emb|CDY30730.1|  BnaA02g33520D                                          342   6e-109   
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like           345   8e-109   
gb|ACN34067.1|  unknown                                                 339   1e-108   
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type-like    345   1e-108   
gb|ACN33231.1|  unknown                                                 334   1e-108   
gb|KHN18251.1|  ATPase 8, plasma membrane-type                          343   1e-108   
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                345   1e-108   
ref|NP_001183637.1|  uncharacterized protein LOC100502231               326   2e-108   
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-like     345   2e-108   
gb|KHG23806.1|  ATPase 10, plasma membrane-type -like protein           339   2e-108   
emb|CDP14275.1|  unnamed protein product                                337   2e-108   
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    345   2e-108   
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    345   2e-108   
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          344   2e-108   
gb|KGN52442.1|  hypothetical protein Csa_5G635370                       341   3e-108   
ref|NP_001169535.1|  uncharacterized protein LOC100383411               325   3e-108   
ref|XP_010029522.1|  PREDICTED: ATPase 10, plasma membrane-type         343   4e-108   
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             343   5e-108   
ref|XP_006426822.1|  hypothetical protein CICLE_v100248072mg            335   5e-108   
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     343   6e-108   
gb|AAA34052.1|  H+-translocating ATPase                                 343   7e-108   
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          343   7e-108   
emb|CAD29297.1|  plasma membrane H+ ATPase                              343   7e-108   
gb|AAR32129.2|  proton P-ATPase                                         343   7e-108   
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         343   7e-108   
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         343   9e-108   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             342   2e-107   
ref|XP_006654259.1|  PREDICTED: plasma membrane ATPase 4-like           342   2e-107   
gb|KGN63646.1|  hypothetical protein Csa_1G008520                       338   2e-107   
gb|EPS57651.1|  hypothetical protein M569_17165                         342   2e-107   
ref|XP_004955721.1|  PREDICTED: plasma membrane ATPase 1-like           342   2e-107   
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    342   2e-107   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    342   3e-107   
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           342   3e-107   
ref|NP_201073.1|  H(+)-ATPase 11                                        342   3e-107   
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    341   3e-107   
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             341   3e-107   
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         341   3e-107   
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                341   4e-107   
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    341   4e-107   
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    341   4e-107   
ref|NP_001061338.1|  Os08g0241800                                       323   4e-107   
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     339   4e-107   
ref|XP_002517457.1|  H(\+)-transporting atpase plant/fungi plasma...    337   5e-107   
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                341   5e-107   
emb|CDY45757.1|  BnaC02g42250D                                          341   6e-107   
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                340   7e-107   
ref|NP_001234477.1|  plasma membrane H+-ATPase                          340   7e-107   
sp|P23980.1|PMA2_SOLLC  RecName: Full=Plasma membrane ATPase 2; A...    335   7e-107   
gb|KGN64262.1|  hypothetical protein Csa_1G045600                       336   7e-107   
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           340   8e-107   



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   424 bits (1090),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 199/219 (91%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWKYDFSAFMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVFGFMFIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY ALMTV+FFW MHDTDFFSDKFGV+S+RNSDEEMM+ALYLQV
Sbjct  705  DSWKLKEIFATGVVLGGYQALMTVVFFWAMHDTDFFSDKFGVKSLRNSDEEMMSALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPGMLL++AF+IAQLVATLIAVYANW FAR++GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDIMKFA RYILSGKAWNNLL+NKTAF
Sbjct  825  VIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLDNKTAF  863



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   423 bits (1087),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 213/219 (97%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWKYDFSAFMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVFGFMFIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY ALMTV+FFW MHDTDFFSDKFGV+S+RNSDEEMM+ALYLQV
Sbjct  705  DSWKLKEIFATGVVLGGYQALMTVVFFWAMHDTDFFSDKFGVKSLRNSDEEMMSALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPGMLL++AF+IAQLVATLIAVYANW FAR++GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFLERPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLDIMKFA RYILSGKAWNNLL+NKTAF
Sbjct  825  VIWLYSIIFYLPLDIMKFAIRYILSGKAWNNLLDNKTAF  863



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   422 bits (1084),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWKYDFSAFMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVFGFMFIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY ALMTV+FFW MHDTDFFSDKFGV+S+RNSDEEMM+ALYLQV
Sbjct  705  DSWKLKEIFATGVVLGGYQALMTVVFFWAMHDTDFFSDKFGVKSLRNSDEEMMSALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPGMLL++AF+IAQLVATLIAVYANW FAR++GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFLERPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY PLDIMKFA RYILSGKAWNNLL+NKTAF
Sbjct  825  VIWLYSIIFYFPLDIMKFAIRYILSGKAWNNLLDNKTAF  863



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   417 bits (1072),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 198/219 (90%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  645  MKNYTIYAVSITIRIVFGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGYLALMTVIFFW MHDT+FFSDKFGVRS+RNS++EMM ALYLQV
Sbjct  705  DSWKLKEIFATGVVLGGYLALMTVIFFWAMHDTEFFSDKFGVRSLRNSEDEMMGALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LL+ AFLIAQLVATLIAVYA+WGFARI+G GWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSYVERPGLLLMSAFLIAQLVATLIAVYADWGFARIKGIGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY+PLD++KFA RYILSGKAWNNLLENKTAF
Sbjct  825  VIWIYSIVFYIPLDLLKFAIRYILSGKAWNNLLENKTAF  863



>gb|KHG26452.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   407 bits (1045),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  349  MKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  408

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTV+FFWIMHDTDFFS+KFGVRS+R  D++MM ALYLQV
Sbjct  409  DSWKLKEIFATGIVLGGYLALMTVVFFWIMHDTDFFSEKFGVRSLRKRDDQMMGALYLQV  468

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+ ERPG+LL+ AF+IAQLVAT+IAVYANWGFARIQG GWGWAG
Sbjct  469  SIVSQALIFVTRSRSWSYFERPGLLLVTAFIIAQLVATVIAVYANWGFARIQGIGWGWAG  528

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+VFY+PLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  529  VIWLYSVVFYIPLDLMKFAIRYILSGKAWLNLLENKTAF  567



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =   415 bits (1066),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 197/219 (90%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLGGYLALMTVIFFW+MH+TDFF DKFGVRSIR++++EMMAALYLQV
Sbjct  707  DSWKLNEIFATGVVLGGYLALMTVIFFWMMHETDFFPDKFGVRSIRDNEDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLLVAF IAQL+ATLIAVYANWGFARIQGCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLLVAFCIAQLIATLIAVYANWGFARIQGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLD+MKFA RYILSGKAW NL +NK AF
Sbjct  827  VIWLYSIVFYVPLDLMKFAIRYILSGKAWQNLYDNKIAF  865



>gb|KHG28536.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   406 bits (1043),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  349  MKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  408

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW MHDTDFFSDKFGVRS+R  + EMM ALYLQV
Sbjct  409  DSWKLKEIFATGIVLGGYLALMTVIFFWAMHDTDFFSDKFGVRSLREREHEMMGALYLQV  468

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+ ERPG+LL+ AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  469  SIVSQALIFVTRSRSWSYAERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGIGWGWAG  528

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLDIMKFA RYILSGKAW NLLENKTAF
Sbjct  529  VIWLYSIVFYVPLDIMKFAIRYILSGKAWLNLLENKTAF  567



>emb|CAD29579.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   394 bits (1011),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIW+YDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  3    MKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  62

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFFSDKFGVRSIR+S+ EMM+ALYLQV
Sbjct  63   DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQV  122

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL+AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  123  SIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAG  182

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYSIVFY PLD++KF  R++LSG+AW+NLLENKTAF
Sbjct  183  VVWLYSIVFYFPLDLLKFFIRFVLSGRAWDNLLENKTAF  221



>emb|CAD62443.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   394 bits (1011),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIW+YDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  3    MKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  62

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFFSDKFGVRSIR+S+ EMM+ALYLQV
Sbjct  63   DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQV  122

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL+AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  123  SIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAG  182

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYSIVFY PLD++KF  R++LSG+AW+NLLENKTAF
Sbjct  183  VVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKTAF  221



>emb|CAG28306.1| proton-exporting ATPase [Cucumis sativus]
Length=310

 Score =   391 bits (1005),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  3    MKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  62

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW+M  T+FFSDKFGVRSIR++++EMMAALYLQV
Sbjct  63   DSWKLKEIFATGIVLGGYLALMTVIFFWLMDGTNFFSDKFGVRSIRHNEDEMMAALYLQV  122

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR  S+ ERPG+LL+ AF IAQLVATLIAVYANWGFA+I+G GWGWAG
Sbjct  123  SIVSQALIFVTRSRGRSYAERPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAG  182

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  183  VIWLYSIVFYIPLDVMKFAIRYILSGKAWLNLLENKTAF  221



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   412 bits (1058),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW+MH TDFF+D FGVR+IR++++EMMAALYLQV
Sbjct  704  DSWKLKEIFATGIVLGGYLALMTVIFFWLMHKTDFFADNFGVRNIRDNEDEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF+IAQLVATLIAVYANWGFARI+GCGWGWAG
Sbjct  764  SIVSQALIFVTRSRSWSFVERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGCGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLD+MKFA RYILSGKAW NL +NKTAF
Sbjct  824  VIWLYSIVFYVPLDLMKFAIRYILSGKAWQNLYDNKTAF  862



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   411 bits (1057),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 210/219 (96%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  645  MKNYTIYAVSITIRIVFGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW +HDTDFFS+KFGVRS+R++DEEMM ALYLQV
Sbjct  705  DSWKLKEIFATGIVLGGYLALMTVIFFWAVHDTDFFSNKFGVRSLRDNDEEMMGALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF++AQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSFIERPGLLLVSAFMLAQLVATLIAVYANWGFARIKGIGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY PLDIMKFA RYILSGKAW NLLENKTAF
Sbjct  825  VIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLENKTAF  863



>ref|XP_006381782.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
 gb|ERP59579.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
Length=885

 Score =   409 bits (1051),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  578  MKNYTIYAVSITIRIVFGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  637

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW +HDTDFFS+KFGVRS+R +DEEMM ALYLQV
Sbjct  638  DSWKLKEIFATGIVLGGYLALMTVIFFWAVHDTDFFSEKFGVRSLRKNDEEMMGALYLQV  697

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQLVAT+IAVYANWGFARI+G GWGWAG
Sbjct  698  SIVSQALIFVTRSRSWSFIERPGLLLVSAFMIAQLVATVIAVYANWGFARIKGIGWGWAG  757

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY PLDIMKFA RYILSGKAW NLLENKTAF
Sbjct  758  VIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLENKTAF  796



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   410 bits (1055),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  645  MKNYTIYAVSITIRIVFGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW +HDTDFFS+KFGVRS+R+ DEEMM ALYLQV
Sbjct  705  DSWKLKEIFATGIVLGGYLALMTVIFFWAVHDTDFFSNKFGVRSLRHHDEEMMGALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LLL AF++AQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSFIERPGLLLLSAFMLAQLVATLIAVYANWGFARIKGIGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY PLDIMKFA RYILSGKAW NLL+NKTAF
Sbjct  825  VIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLDNKTAF  863



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =   410 bits (1055),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 194/219 (89%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIF+TG+VLGGY+ALMTV+FFWIM DTDFFSDKFGVRS+RN+DEEMMAALYLQV
Sbjct  707  DSWKLKEIFSTGIVLGGYMALMTVLFFWIMKDTDFFSDKFGVRSLRNNDEEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LLL AF+ AQLVATLIAVYANWGFARI+GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGFLLLGAFVAAQLVATLIAVYANWGFARIEGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+S+V YVPLDI+KFA RYILSGKAW+NLLENKTAF
Sbjct  827  VIWLFSVVTYVPLDILKFAIRYILSGKAWDNLLENKTAF  865



>gb|KHN35778.1| Plasma membrane ATPase 4 [Glycine soja]
Length=365

 Score =   392 bits (1007),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  58   MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  117

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLGGYLALMTVIFFW + +T FF DKFGVR I ++ +EM AALYLQV
Sbjct  118  DSWKLNEIFATGVVLGGYLALMTVIFFWAIKETTFFPDKFGVRPIHDNPDEMTAALYLQV  177

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQL+AT+IAVYANWGFARIQG GWGWAG
Sbjct  178  SIVSQALIFVTRSRSWSFIERPGLLLVTAFVIAQLIATVIAVYANWGFARIQGIGWGWAG  237

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDIMKFA RYILSGKAWNNLLENKTAF
Sbjct  238  VIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLENKTAF  276



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   410 bits (1054),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/219 (89%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  646  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  705

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGYLALMTVIFFW MH+TDFF DKFGVR+IR+S+ EMMAALYLQV
Sbjct  706  DSWKLKEIFATGVVLGGYLALMTVIFFWAMHETDFFPDKFGVRAIRDSEHEMMAALYLQV  765

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS++ERPG+LL+ AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  766  SIVSQALIFVTRSRSWSYLERPGLLLVTAFVIAQLVATLIAVYANWGFARIKGVGWGWAG  825

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  826  VIWLYSIVFYVPLDVMKFAIRYILSGKAWLNLLENKTAF  864



>ref|XP_006453323.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474211.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Citrus sinensis]
 gb|ESR66563.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=885

 Score =   407 bits (1047),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  578  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  637

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGYLALMTVIFFW MH+TDFF DKFGVR+IR+S+ EMMAALYLQV
Sbjct  638  DSWKLKEIFATGVVLGGYLALMTVIFFWAMHETDFFPDKFGVRAIRDSEHEMMAALYLQV  697

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS++ERPG+LL+ AF++AQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  698  SIVSQALIFVTRSRSWSYLERPGLLLVTAFVLAQLVATLIAVYANWGFARIKGVGWGWAG  757

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  758  VIWLYSIVFYVPLDLMKFAIRYILSGKAWLNLLENKTAF  796



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   408 bits (1049),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 209/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGYLALMTVIFFW MH+TDFF DKFGVR+IR+S+ EMMAALYLQV
Sbjct  707  DSWKLKEIFATGVVLGGYLALMTVIFFWAMHETDFFPDKFGVRAIRDSEHEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS++ERPG+LL+ AF++AQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYLERPGLLLVTAFVLAQLVATLIAVYANWGFARIKGVGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  827  VIWLYSIVFYVPLDLMKFAIRYILSGKAWLNLLENKTAF  865



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   408 bits (1049),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWKYDFSAFMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVFGFMLIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLGGY ALMTVIFFW MHDT FF+DKFGV+ IR SDEEMM+ALYLQV
Sbjct  705  DSWKLNEIFATGVVLGGYQALMTVIFFWAMHDTSFFTDKFGVKDIRESDEEMMSALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQLVATLIAVYA+W FAR++GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW++SIV Y PLDIMKFA RYILSGKAWNNLL+NKTAF
Sbjct  825  VIWIFSIVTYFPLDIMKFAIRYILSGKAWNNLLDNKTAF  863



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   408 bits (1049),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWKYDFSAFMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVFGFMLIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLGGY ALMTV+FFW MHDT FFSDKFGV+ IR SDEEMM+ALYLQV
Sbjct  705  DSWKLNEIFATGVVLGGYQALMTVLFFWAMHDTKFFSDKFGVKDIRESDEEMMSALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQLVATLIAVYA+W FAR++GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW++SIV Y PLDIMKFA RYILSGKAWNNLL+NKTAF
Sbjct  825  VIWIFSIVTYFPLDIMKFAIRYILSGKAWNNLLDNKTAF  863



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   408 bits (1049),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWKYDFSAFMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVFGFMLIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLGGY ALMTVIFFW MHDT FF+DKFGV+ IR SDEEMM+ALYLQV
Sbjct  705  DSWKLNEIFATGVVLGGYQALMTVIFFWAMHDTSFFTDKFGVKDIRESDEEMMSALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQLVATLIAVYA+W FAR++GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW++SIV Y PLDIMKFA RYILSGKAWNNLL+NKTAF
Sbjct  825  VIWIFSIVTYFPLDIMKFAIRYILSGKAWNNLLDNKTAF  863



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =   407 bits (1046),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW+YDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  645  MKNYTIYAVSITIRIVFGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW MHDTDFFSDKFGVRSIR SD E+M ALYLQV
Sbjct  705  DSWKLKEIFATGIVLGGYLALMTVIFFWAMHDTDFFSDKFGVRSIRRSDPELMGALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+ ERPG+LL+ AF+IAQLVATLIAVYANWGFA I+G GWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSYFERPGLLLVTAFIIAQLVATLIAVYANWGFAHIKGIGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD++KFA RYILSGKAW NLLENKTAF
Sbjct  825  VIWLYSIVFYIPLDLLKFAIRYILSGKAWLNLLENKTAF  863



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =   407 bits (1046),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIF+TG+VLGGY+ALMTV+FFWIM DTDFFSDKFGVRS+R +DEEMMAALYLQV
Sbjct  707  DSWKLKEIFSTGIVLGGYMALMTVLFFWIMKDTDFFSDKFGVRSLRKNDEEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LLL AF+ AQL+ATLIAVYANWGFARI+GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGFLLLGAFVAAQLIATLIAVYANWGFARIKGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+S+V YVPLDI+KFA RYILSGKAW+NLLENKTAF
Sbjct  827  VIWLFSVVTYVPLDILKFAIRYILSGKAWDNLLENKTAF  865



>ref|XP_002515334.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF46783.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=734

 Score =   401 bits (1030),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  427  MKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQP  486

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIF+TGVVLGGYLALMTVIFFW M +TDFFSDKFGVRS+ NS+ EMMAALYLQV
Sbjct  487  DSWKLKEIFSTGVVLGGYLALMTVIFFWAMEETDFFSDKFGVRSLHNSEGEMMAALYLQV  546

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF+ AQL+AT+IAVYANWGFARI+GCGWGWAG
Sbjct  547  SIVSQALIFVTRSRSWSFVERPGLLLIGAFIAAQLIATVIAVYANWGFARIEGCGWGWAG  606

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V YVPLD++KFA RYILSGKAW+NLLENKTAF
Sbjct  607  VIWLYSVVTYVPLDLLKFAIRYILSGKAWDNLLENKTAF  645



>gb|AAQ19039.1| P-type H+-ATPase [Vicia faba]
Length=370

 Score =   389 bits (998),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  77   MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  136

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVV G Y+ALMTV+FFW+M DTDFFSDKFGVRSIR + +EMMAALYLQV
Sbjct  137  DSWKLKEIFATGVVQGSYMALMTVVFFWLMKDTDFFSDKFGVRSIRKNPDEMMAALYLQV  196

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPG+LLL AF+IAQLVAT IAVYANWGFARI+G GWGWAG
Sbjct  197  SIISQALIFVTRSRSWSFLERPGLLLLGAFMIAQLVATFIAVYANWGFARIKGMGWGWAG  256

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS+V Y PLDI+KF  RY+LSGKAW+NLLENKTAF
Sbjct  257  VIWVYSLVTYFPLDILKFVIRYVLSGKAWDNLLENKTAF  295



>gb|AAQ19041.1| P-type H+-ATPase [Phaseolus acutifolius]
Length=370

 Score =   389 bits (998),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  77   MKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  136

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTVIFFW M DT+FFS+KFGVRS+R S EEMMAALYLQV
Sbjct  137  DSWKLREIFATGVVLGSYMALMTVIFFWAMKDTNFFSNKFGVRSLRFSPEEMMAALYLQV  196

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF ERPG+LLL AFLIAQLVAT IAVYANWGFARI+G GWGWAG
Sbjct  197  SIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVATFIAVYANWGFARIKGMGWGWAG  256

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLD +KFA RYILSGKAW+NLLENKTAF
Sbjct  257  VIWLYSVVTYIPLDFLKFAIRYILSGKAWDNLLENKTAF  295



>ref|XP_007014223.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
 gb|EOY31842.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
Length=886

 Score =   405 bits (1040),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  579  MKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  638

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG++LGGYLALMTVIFFW+MHDT FF DKFGVRS+R SD EMMAALYLQV
Sbjct  639  DSWKLKEIFATGIMLGGYLALMTVIFFWLMHDTKFFPDKFGVRSLRGSDHEMMAALYLQV  698

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LL+ AF IAQLVATLIAVYANWGFA+I+G GWGWAG
Sbjct  699  SIVSQALIFVTRSRSWSYVERPGLLLVTAFFIAQLVATLIAVYANWGFAKIKGIGWGWAG  758

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  759  VIWLYSIVFYIPLDLMKFAIRYILSGKAWLNLLENKTAF  797



>gb|AAO72564.1| plasma membrane H+-ATPase-like protein [Oryza sativa Japonica 
Group]
Length=503

 Score =   393 bits (1009),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  194  MKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  253

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFF+DKFGVRSIRNS+ EMM+ALYLQV
Sbjct  254  DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSALYLQV  313

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF++AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  314  SIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAG  373

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDI KF  R++LSG+AW+NLLENK AF
Sbjct  374  VIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAF  412



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   406 bits (1043),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  646  MKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  705

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGV LGGYLALMTVIFFW+MH TDFF +KFGV+ I++S+ EMMAALYLQV
Sbjct  706  DSWKLKEIFATGVFLGGYLALMTVIFFWLMHKTDFFPEKFGVKHIKHSEHEMMAALYLQV  765

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG LL+ AF+IAQLVATLIAVYANWGFARI+GCGWGWAG
Sbjct  766  SIVSQALIFVTRSRSWSYVERPGALLMTAFVIAQLVATLIAVYANWGFARIKGCGWGWAG  825

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS+VFYVPLD+MKFA RYILSGKAW NL ENK AF
Sbjct  826  VIWIYSVVFYVPLDLMKFAVRYILSGKAWQNLYENKIAF  864



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   405 bits (1042),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 195/219 (89%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW++ +TDFFSDKFGVRSIR S EE+MAALYLQV
Sbjct  708  DSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDKFGVRSIRESPEELMAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LLL AF+IAQLVATLIAVYANWGFARIQG GWGWAG
Sbjct  768  SIVSQALIFVTRSRSWSFLERPGLLLLSAFMIAQLVATLIAVYANWGFARIQGVGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY PLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  828  VIWIYSIVFYFPLDVMKFAIRYILSGKAWLNLLENKTAF  866



>gb|EYU20899.1| hypothetical protein MIMGU_mgv1a000880mg [Erythranthe guttata]
Length=952

 Score =   405 bits (1042),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  645  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGV LG YLALMTVIFFW+MH TDFF +KFGVR+IR+S+EEMMAALYLQV
Sbjct  705  DSWKLNEIFATGVALGSYLALMTVIFFWLMHKTDFFPEKFGVRNIRDSEEEMMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG LL++AF IAQL+ATLIAVYANWGFARI GCGWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSYVERPGALLMIAFCIAQLIATLIAVYANWGFARISGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+VFYVPLD+MKFATRYILSGKAW NL +NK AF
Sbjct  825  VIWLYSLVFYVPLDLMKFATRYILSGKAWQNLYDNKIAF  863



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   405 bits (1042),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWKYDF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKYDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIF+TG+VLGGYLALMTV+FFW M DTDFFSDKFGVRS+R  D EMMAALYLQV
Sbjct  707  DSWKLKEIFSTGIVLGGYLALMTVLFFWAMKDTDFFSDKFGVRSLRYKDREMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF++AQL+ATLIAVYANWGFARI+GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLVGAFIVAQLIATLIAVYANWGFARIEGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V YVPLD++KFA RYILSGKAW+NLLENKTAF
Sbjct  827  VIWLYSVVTYVPLDLLKFAIRYILSGKAWDNLLENKTAF  865



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG++LGGYLALMTVIFFW+MHDT FF DKFGVRS+R SD EMMAALYLQV
Sbjct  707  DSWKLKEIFATGIMLGGYLALMTVIFFWLMHDTKFFPDKFGVRSLRGSDHEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LL+ AF IAQLVATLIAVYANWGFA+I+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYVERPGLLLVTAFFIAQLVATLIAVYANWGFAKIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  827  VIWLYSIVFYIPLDLMKFAIRYILSGKAWLNLLENKTAF  865



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   405 bits (1041),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPSP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFF  MH+TDFF DKFGVR+IR S+EEMMAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVIFFLAMHETDFFHDKFGVRNIRKSEEEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AFL+AQLVATLIAVYANWGFAR++GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFLERPGLLLVSAFLLAQLVATLIAVYANWGFARVKGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLD MKFA RY+LSGKAWNNL +N+TAF
Sbjct  827  VIWLYSIVFYFPLDPMKFAIRYVLSGKAWNNLFDNRTAF  865



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   403 bits (1036),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  643  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  702

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGYLAL+TVIFFW++ DTDFF DKFGVRSIR++ EEMMA LYLQV
Sbjct  703  DSWKLKEIFATGVVLGGYLALLTVIFFWLIKDTDFFPDKFGVRSIRHNPEEMMAVLYLQV  762

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LLL AF+IAQL+AT+IAVYANWGFARI GCGWGWAG
Sbjct  763  SIVSQALIFVTRSRSWSFVERPGFLLLGAFMIAQLLATVIAVYANWGFARIHGCGWGWAG  822

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYSIVFY PLDIMKFATRY LSGKAW N+++N+TAF
Sbjct  823  VVWLYSIVFYFPLDIMKFATRYALSGKAWQNMIDNRTAF  861



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   402 bits (1034),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  643  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  702

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLAL+TVIFFW+M DTDFF +KFGVR IR+S +EMMAALYLQV
Sbjct  703  DSWKLKEIFATGIVLGGYLALLTVIFFWLMKDTDFFPNKFGVRPIRDSPDEMMAALYLQV  762

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LLL AFLIAQL+ATLIAVYANWGFARI+GCGWGWAG
Sbjct  763  SIVSQALIFVTRSRSWSFVERPGFLLLGAFLIAQLIATLIAVYANWGFARIEGCGWGWAG  822

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS+VFY PLDIMKF TRY LSGKAWNN++E + AF
Sbjct  823  VIWIYSVVFYFPLDIMKFGTRYALSGKAWNNMIEQRVAF  861



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   402 bits (1034),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  647  MKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPIP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGYLAL TV+FFW+M DT+FFSDKFGVRS+R+S  E+MAALYLQV
Sbjct  707  DSWKLKEIFATGVVLGGYLALGTVLFFWVMKDTNFFSDKFGVRSLRDSPREIMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+ ERPGM LL AFLIAQLVATLIAVYANWGFA+I+GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYAERPGMFLLSAFLIAQLVATLIAVYANWGFAKIKGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y+PLDI+KF  RY+LSGKAW+NLLENKTAF
Sbjct  827  VIWLYSIVTYIPLDILKFCIRYVLSGKAWDNLLENKTAF  865



>emb|CAG28305.1| proton-exporting ATPase [Cucumis sativus]
Length=311

 Score =   382 bits (981),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  3    MKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  62

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG++LGGYLALMTVIFFWIM +TDFF +KF VR I++S +EMMAALYLQV
Sbjct  63   DSWKLKEIFATGIMLGGYLALMTVIFFWIMRETDFFPEKFNVRPIKDSPKEMMAALYLQV  122

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+ ERPG+LL+ AF+IAQLVATLIAVYANW FA+I+G GWGWAG
Sbjct  123  SIVSQALIFVTRSRSWSYFERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAG  182

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+W+YS++FY+PLD +KFA RYILSGKAW NLLENKTAF
Sbjct  183  VVWIYSVIFYIPLDFIKFAIRYILSGKAWLNLLENKTAF  221



>ref|XP_008367709.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=956

 Score =   402 bits (1034),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  649  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  708

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLGGY+ALMTV+FFW+M DTDFFSDKF VRS+RN  E+MMAALYLQV
Sbjct  709  DSWKLREIFATGIVLGGYMALMTVVFFWLMRDTDFFSDKFHVRSLRNRPEQMMAALYLQV  768

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLL AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  769  SIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIEGAGWGWAG  828

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW YSIV YVPLD++KFA RYI SGKAWNNLLENKTAF
Sbjct  829  VIWXYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAF  867



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   402 bits (1034),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLGGY+ALMTV+FFW+M DTDFFSDKF VRS+RN  E+MMAALYLQV
Sbjct  707  DSWKLREIFATGIVLGGYMALMTVVFFWLMRDTDFFSDKFXVRSLRNRPEQMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLL AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIEGAGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW YSIV YVPLD++KFA RYI SGKAWNNLLENKTAF
Sbjct  827  VIWXYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAF  865



>gb|EPS63245.1| hypothetical protein M569_11541, partial [Genlisea aurea]
Length=935

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  628  MKNYTIYAVSITIRIVFGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  687

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLGGYL LMTVIFFW+MH T FF DKFGVR +R +D+E MAALYLQV
Sbjct  688  DSWKLREIFATGVVLGGYLGLMTVIFFWLMHKTTFFPDKFGVRDLRGNDKEKMAALYLQV  747

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL+AQLVAT+IAVYA+WGFARI+GCGWGWAG
Sbjct  748  SIVSQALIFVTRSRSWSFVERPGLLLMSAFLVAQLVATIIAVYADWGFARIKGCGWGWAG  807

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS+VFYVPLD +KFA RYILSGKAW NL ENKTAF
Sbjct  808  VIWIYSVVFYVPLDFIKFAIRYILSGKAWLNLYENKTAF  846



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   402 bits (1033),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGYLA+MTV+FFW MH TDFF DKFGV++IRNS++EMMAALYLQV
Sbjct  707  DSWKLKEIFATGVVLGGYLAVMTVVFFWAMHKTDFFHDKFGVKNIRNSEDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LLL AF+IAQLVATLIAVYANW FARI+GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYVERPGLLLLTAFVIAQLVATLIAVYANWSFARIKGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+VFYVPLD +KF  RY+LSGKAW NL++NK AF
Sbjct  827  VIWLYSVVFYVPLDFLKFFIRYVLSGKAWLNLIDNKIAF  865



>gb|AAO22672.1| putative plasma membrane proton ATPase [Arabidopsis thaliana]
Length=334

 Score =   382 bits (982),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  29   MKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  88

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL+TV+FFW+ HDT FFSDKFGVRS++  DEE++A LYLQV
Sbjct  89   DSWKLKEIFATGVVLGTYMALVTVVFFWLAHDTTFFSDKFGVRSLQGKDEELIAVLYLQV  148

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL+AF +AQL+ATLIA YA+W FARI+GCGWGW G
Sbjct  149  SIISQALIFVTRSRSWSFVERPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCGWGWCG  208

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y+PLDI+KF TRY LSGKAWNN++EN+TAF
Sbjct  209  VIWIYSIVTYIPLDILKFITRYTLSGKAWNNMIENRTAF  247



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   402 bits (1032),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTV+FFW+M DTDFFSDKFGVRSIRNS  EMMAALYLQV
Sbjct  704  DSWKLREIFATGVVLGAYMALMTVVFFWLMKDTDFFSDKFGVRSIRNSPGEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS+VERPG+LLL AF+IAQLVAT +AVYANWGFARIQG GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSYVERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLDI+KFA RY+LSGKAW+NLLENKTAF
Sbjct  824  VIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAF  862



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   402 bits (1032),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIF TG+VLGGYLALMTV+FFW MHDTDFF+DKF VRS+R SD+EMMAALYLQV
Sbjct  707  DSWKLKEIFCTGIVLGGYLALMTVLFFWAMHDTDFFTDKFSVRSLRGSDKEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LL+ AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYVERPGLLLVSAFVIAQLVATLIAVYANWGFARIKGMGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V +VPLD++KFATRY+LSGKAW+NLLENKTAF
Sbjct  827  VIWLYSVVTFVPLDLIKFATRYVLSGKAWDNLLENKTAF  865



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   401 bits (1031),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTV+FFW+M+DTDFFS+KF VRS+R+  E+MMAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLL AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIKGAGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV YVPLD +KFA RYI SGKAWNNLLENKTAF
Sbjct  827  VIWLYSIVTYVPLDFLKFAIRYIQSGKAWNNLLENKTAF  865



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   401 bits (1031),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTV+FFW+M+DTDFFS+KF VRS+R+  E+MMAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLL AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIKGAGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV YVPLD +KFA RYI SGKAWNNLLENKTAF
Sbjct  827  VIWLYSIVTYVPLDFLKFAIRYIQSGKAWNNLLENKTAF  865



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =   401 bits (1031),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIF+TGVVLGGYLALMTV+FFWIM DTDFFSDKFGVRS+R+S  EMMAALYLQV
Sbjct  707  DSWKLKEIFSTGVVLGGYLALMTVLFFWIMKDTDFFSDKFGVRSLRDSKYEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF++AQL+ATLIAVYANWGFA I+GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLVSAFVVAQLIATLIAVYANWGFAHIKGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+S+V Y+PLD++KFA RYILSGKAW+N LENKTAF
Sbjct  827  VIWLFSLVTYLPLDVLKFAIRYILSGKAWDNFLENKTAF  865



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   401 bits (1031),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW++ +TDFFSD+FGVRS+R + EE+MAALYLQV
Sbjct  708  DSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDQFGVRSLRETPEELMAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRS+SF+ERPGMLLL AFLIAQL+ATLIAVYANW FARI GCGWGWAG
Sbjct  768  SIVSQALIFVTRSRSFSFMERPGMLLLGAFLIAQLIATLIAVYANWSFARIHGCGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY PLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  828  VIWIYSIVFYFPLDLMKFAIRYILSGKAWLNLLENKTAF  866



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   401 bits (1030),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW M DTDFFSDKFGVRSIR+S EEMMAALYLQV
Sbjct  705  DSWKLKEIFATGIVLGSYLALMTVIFFWAMKDTDFFSDKFGVRSIRDSREEMMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPGMLL+VAFLIAQLVATLIAVY NW FA I+GCGWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSFVERPGMLLMVAFLIAQLVATLIAVYPNWAFAEIKGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLY+IVFY PLD++KFA RYILSGKAW NL E+KTAF
Sbjct  825  VVWLYNIVFYFPLDVIKFAIRYILSGKAWLNLFESKTAF  863



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   401 bits (1030),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPMP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTV+FFW+M DTDFFSDKFGVRSIRNS  EMMAALYLQV
Sbjct  704  DSWKLREIFATGVVLGAYMALMTVVFFWLMKDTDFFSDKFGVRSIRNSPGEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS+VERPG+LLL AF+IAQLVAT +AVYANWGFARIQG GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSYVERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLDI+KFA RY+LSGKAW+NLLENKTAF
Sbjct  824  VIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAF  862



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   401 bits (1030),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPMP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLG Y+ALMTV+FFWIM DTDFFSDKFGVRSIRNS  EMMAALYLQV
Sbjct  704  DSWKLREIFATGIVLGSYMALMTVVFFWIMKDTDFFSDKFGVRSIRNSPGEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS+VERPG+LLL AF+IAQLVAT +AVYANWGFARIQG GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSYVERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLDI+KFA RY+LSGKAW+NLLENKTAF
Sbjct  824  VIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAF  862



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =   401 bits (1030),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  647  MKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLGGYLALMTVIFFW M +TDFF DKFGVR IR+S EEMMAALYLQV
Sbjct  707  DSWKLREIFATGVVLGGYLALMTVIFFWAMKETDFFPDKFGVRPIRDSPEEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LLL AF+IAQLVATLIAVYANWGFA I+GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYVERPGLLLLSAFIIAQLVATLIAVYANWGFAEIKGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
             IW+YSIV YVPLDI+KFA RYILSGKAW NLLENKTAF
Sbjct  827  AIWVYSIVSYVPLDIIKFAIRYILSGKAWLNLLENKTAF  865



>ref|XP_011045011.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Populus euphratica]
Length=954

 Score =   401 bits (1030),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIF+TGVVLGGYLALMTV+FFWIM DTDFFSDKFGVRS+R+S  EMMAALYLQV
Sbjct  707  DSWKLKEIFSTGVVLGGYLALMTVLFFWIMKDTDFFSDKFGVRSLRDSKYEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF++AQL+ATLIAVYANWGFA I+GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLVSAFVVAQLIATLIAVYANWGFAHIKGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+S+V Y+PLD++KFA RYILSGKAW+N LENKTAF
Sbjct  827  VIWLFSLVTYLPLDLLKFAIRYILSGKAWDNFLENKTAF  865



>gb|KCW81010.1| hypothetical protein EUGRSUZ_C023861, partial [Eucalyptus grandis]
Length=935

 Score =   400 bits (1028),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  628  MKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVP  687

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLGGYLALMTVIFFW M +TDFF DKFGVR IR+S EEMMAALYLQV
Sbjct  688  DSWKLREIFATGVVLGGYLALMTVIFFWAMKETDFFPDKFGVRPIRDSPEEMMAALYLQV  747

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LLL AF+IAQLVATLIAVYANWGFA I+GCGWGWAG
Sbjct  748  SIVSQALIFVTRSRSWSYVERPGLLLLSAFIIAQLVATLIAVYANWGFAEIKGCGWGWAG  807

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
             IW+YSIV YVPLDI+KFA RYILSGKAW NLLENKTAF
Sbjct  808  AIWVYSIVSYVPLDIIKFAIRYILSGKAWLNLLENKTAF  846



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   400 bits (1029),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRVVPSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVVPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW++ +TDFFSDKFGVRSIR S E++MAALYLQV
Sbjct  708  DSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDKFGVRSIRESPEDLMAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LLL AF IAQL+ATL+AVYANWGFARI G GWGWAG
Sbjct  768  SIVSQALIFVTRSRSWSFMERPGLLLLGAFAIAQLIATLVAVYANWGFARIHGVGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDIMKFA RYILSGKAW N+L+N+TAF
Sbjct  828  VIWLYSIVFYFPLDIMKFAIRYILSGKAWLNMLDNRTAF  866



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =   400 bits (1029),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW+M  T+FFSDKFGVRSIR++++EMMAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVIFFWLMDGTNFFSDKFGVRSIRHNEDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR WS+ ERPG+LL+ AF IAQLVATLIAVYANWGFA+I+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRGWSYAERPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  827  VIWLYSIVFYIPLDVMKFAIRYILSGKAWLNLLENKTAF  865



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   400 bits (1029),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGYLALMTVIFFW M +T FFSDKFGVRS+ +S +EM+AALYLQV
Sbjct  707  DSWKLKEIFATGVVLGGYLALMTVIFFWAMKETTFFSDKFGVRSLHDSPDEMIAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LL+ AF+IAQL+ATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYVERPGLLLMSAFVIAQLIATLIAVYANWGFARIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLDIMKFA RYILSGKAW NLLENKTAF
Sbjct  827  VIWLYSIVFYVPLDIMKFAIRYILSGKAWLNLLENKTAF  865



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   400 bits (1027),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW++ +TDFFSDKFGVRSIR S  E+MAALYLQV
Sbjct  708  DSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDKFGVRSIRESPGELMAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LLL AF+IAQL+ATL+AVYANWGFARI G GWGWAG
Sbjct  768  SIVSQALIFVTRSRSWSFLERPGLLLLGAFMIAQLIATLVAVYANWGFARIHGVGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY PLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  828  VIWVYSIVFYFPLDVMKFAIRYILSGKAWLNLLENKTAF  866



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score =   399 bits (1024),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 204/216 (94%), Gaps = 0/216 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG++LGGYLALMTVIFFW+MHDT FF DKFGVRS+R SD EMMAALYLQV
Sbjct  707  DSWKLKEIFATGIMLGGYLALMTVIFFWLMHDTKFFPDKFGVRSLRGSDHEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LL+ AF IAQLVATLIAVYANWGFA+I+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYVERPGLLLVTAFFIAQLVATLIAVYANWGFAKIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENK  649
            VIWLYSIVFY+PLD+MKFA RYILSGKAW NLLENK
Sbjct  827  VIWLYSIVFYIPLDLMKFAIRYILSGKAWLNLLENK  862



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   399 bits (1025),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 193/219 (88%), Positives = 208/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW+M  T+FFSDKFGVRSIR++ +EMMAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVIFFWLMDGTNFFSDKFGVRSIRHNVDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR WS+ ERPG+LL+ AFLIAQLVATLIAVYANWGFA+I+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRGWSYAERPGLLLVGAFLIAQLVATLIAVYANWGFAKIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLDIMKFA RYILSGKAW NLLENKTAF
Sbjct  827  VIWLYSIVFYIPLDIMKFAIRYILSGKAWLNLLENKTAF  865



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   399 bits (1024),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLGGYLALMTVIFFW+M DTDFF DKFGV+SIR+S  EMMAALYLQV
Sbjct  707  DSWKLREIFATGVVLGGYLALMTVIFFWVMKDTDFFPDKFGVKSIRDSPHEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            S+VSQALIFVTRSRSWSFVERPG+LL+ AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SVVSQALIFVTRSRSWSFVERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGMGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+W+YS+VFYVPLD +KF  RYILSGKAW NLLENKTAF
Sbjct  827  VVWIYSVVFYVPLDFIKFFIRYILSGKAWLNLLENKTAF  865



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   399 bits (1024),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLGGYLALMTVIFFW+M DTDFF DKFGV+SIR+S  EMMAALYLQV
Sbjct  707  DSWKLREIFATGVVLGGYLALMTVIFFWVMKDTDFFPDKFGVKSIRDSPHEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            S+VSQALIFVTRSRSWSFVERPG+LL+ AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SVVSQALIFVTRSRSWSFVERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGMGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+W+YS+VFYVPLD +KF  RYILSGKAW NLLENKTAF
Sbjct  827  VVWIYSVVFYVPLDFIKFFIRYILSGKAWLNLLENKTAF  865



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   399 bits (1024),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTV+FFW MHDTDFFSDKF VRS+RNS  E MAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVVFFWAMHDTDFFSDKFNVRSLRNSPHEQMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF ERPG+LL+ AF+IAQLVATLIAVYANWGF+RI+G GWGWAG
Sbjct  767  SIISQALIFVTRSRSWSFAERPGLLLVSAFIIAQLVATLIAVYANWGFSRIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLY+IV YVPLDI+KF  RY+LSGKAW+NLLENKTAF
Sbjct  827  VIWLYTIVSYVPLDIIKFFIRYVLSGKAWDNLLENKTAF  865



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score =   398 bits (1023),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWKFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGYLA+MTVIFFW+M+ TDFFSDKFGVRSIRNS +E+MAALYLQV
Sbjct  702  DSWKLKEIFATGVVLGGYLAIMTVIFFWVMYKTDFFSDKFGVRSIRNSPDEVMAALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPG+LL+ AFLIAQL+AT IAVYA+WGFA+I+G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFLERPGLLLVTAFLIAQLIATFIAVYADWGFAKIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y PLD+MKFA RYILSGKAW NL ENKTAF
Sbjct  822  VIWLYSLVTYFPLDVMKFAIRYILSGKAWTNLFENKTAF  860



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   398 bits (1023),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+ALMTV+FFW+M DTDFFSDKFGVRS+R S EEMMAALYLQV
Sbjct  704  DSWKLKEIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGVRSLRKSPEEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL AF+IAQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATFLAVYANWGFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS+V Y+PLDI+KF  RY+LSGKAW+NLLENKTAF
Sbjct  824  VIWVYSLVTYIPLDILKFTIRYVLSGKAWDNLLENKTAF  862



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   398 bits (1022),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLGGYLALMTVIFFW M +T FF DKFGVR I ++ +EM AALYLQV
Sbjct  708  DSWKLNEIFATGVVLGGYLALMTVIFFWAMKETTFFPDKFGVRPIHDNPDEMTAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQL+AT+IAVYANWGFARIQG GWGWAG
Sbjct  768  SIVSQALIFVTRSRSWSFIERPGLLLMTAFIIAQLIATVIAVYANWGFARIQGIGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLD+MKFA RYILSGKAWNNLLENKTAF
Sbjct  828  VIWLYSIVFYFPLDLMKFAIRYILSGKAWNNLLENKTAF  866



>emb|CAC10554.1| plasma membrane proton ATPase [Hordeum vulgare]
Length=349

 Score =   379 bits (974),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  62   MKNYTIYAVSITIRIVLGFLLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  121

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG YLALMTV+FFWI+H TDFF++KFGVRSIR ++ E M+ALYLQV
Sbjct  122  DSWKLNEIFATGVVLGTYLALMTVVFFWIIHRTDFFTNKFGVRSIRENETEKMSALYLQV  181

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LL++AFL+AQLVATLIAVYANWGFARI G GWGWAG
Sbjct  182  SIVSQALIFVTRSRSWSFVERPGFLLVIAFLLAQLVATLIAVYANWGFARISGIGWGWAG  241

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+SIVFY PLDI KF  R++LSG+AW+NLL+NKTAF
Sbjct  242  VIWLFSIVFYFPLDIFKFFIRFVLSGRAWDNLLQNKTAF  280



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   398 bits (1022),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLGGYLALMTVIFFW M +T FF DKFGVR I ++ +EM AALYLQV
Sbjct  708  DSWKLNEIFATGVVLGGYLALMTVIFFWAMKETTFFPDKFGVRPIHDNPDEMTAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQL+AT+IAVYANWGFARIQG GWGWAG
Sbjct  768  SIVSQALIFVTRSRSWSFIERPGLLLMTAFIIAQLIATVIAVYANWGFARIQGIGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLD+MKFA RYILSGKAWNNLLENKTAF
Sbjct  828  VIWLYSIVFYFPLDLMKFAIRYILSGKAWNNLLENKTAF  866



>ref|XP_008668762.1| PREDICTED: plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score =   398 bits (1022),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIW+YDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFFSDKFGVRSIR+S+ EMM+ALYLQV
Sbjct  702  DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL+AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYSIVFY PLD++KF  R++LSG+AW+NLLENKTAF
Sbjct  822  VVWLYSIVFYFPLDLLKFFIRFVLSGRAWDNLLENKTAF  860



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   398 bits (1022),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  643  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  702

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLAL+TVIFFW+M DTD+  + FGVRSIRN  +EMMAALYLQV
Sbjct  703  DSWKLKEIFATGIVLGGYLALLTVIFFWLMKDTDWLPNTFGVRSIRNKPDEMMAALYLQV  762

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LLL AFLIAQL+ATLIAVYANWGFARIQGCGWGWAG
Sbjct  763  SIVSQALIFVTRSRSWSFVERPGFLLLGAFLIAQLIATLIAVYANWGFARIQGCGWGWAG  822

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDIMKFATRY LS KAW ++++N+TAF
Sbjct  823  VIWLYSIVFYFPLDIMKFATRYALSNKAWQSMIDNRTAF  861



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   390 bits (1001),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  352  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  411

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIF+TG+VLGGYLALMTV+FFW+M DTDFF + F VRS+ +S EEMMAALYLQV
Sbjct  412  DSWKLKEIFSTGIVLGGYLALMTVVFFWVMKDTDFFPNMFNVRSLADSPEEMMAALYLQV  471

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LLL AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  472  SIVSQALIFVTRSRSWSYVERPGLLLLTAFVIAQLVATLIAVYANWGFARIKGMGWGWAG  531

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLD++KFA RY+LSGKAW+NLLENKTAF
Sbjct  532  VIWLYSVVTYIPLDLIKFAIRYVLSGKAWDNLLENKTAF  570



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   398 bits (1022),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIW+YDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  652  MKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  711

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFFSDKFGVRSIR+S+ EMM+ALYLQV
Sbjct  712  DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQV  771

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL+AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  772  SIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAG  831

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYSIVFY PLD++KF  R++LSG+AW+NLLENKTAF
Sbjct  832  VVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKTAF  870



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLGGYLAL TV+FFW+M DTDFFS+KFGVRS+R+S EE+MAALYLQV
Sbjct  707  DSWKLNEIFATGVVLGGYLALGTVLFFWVMKDTDFFSEKFGVRSLRDSPEEIMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF ERPGM LL AFLIAQLVATLIAVYA+W FA+I+GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFAERPGMFLLGAFLIAQLVATLIAVYADWSFAKIKGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y PLDI+KF  RY+LSGKAW+NLLEN+TAF
Sbjct  827  VIWLYSIVTYFPLDILKFCIRYVLSGKAWDNLLENRTAF  865



>gb|AFW04239.1| plasma membrane H+-ATPase [Sesuvium portulacastrum]
Length=953

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  645  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYL +MTVIFFW MH TDFFSDKFGVRS+R S  E MAALYLQV
Sbjct  705  DSWKLKEIFATGIVLGGYLGIMTVIFFWAMHKTDFFSDKFGVRSLRGSPNEEMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG LL  AFLIAQLVATLIAVYANWGFA I+GCGWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSYVERPGALLFTAFLIAQLVATLIAVYANWGFADIKGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLY+IVFYVPLDI+KFA RYILSGKAW NL E+KTAF
Sbjct  825  VVWLYNIVFYVPLDILKFAIRYILSGKAWLNLFESKTAF  863



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIW+YDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFFSDKFGVRSIR+S+ EMM+ALYLQV
Sbjct  702  DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL+AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYSIVFY PLD++KF  R++LSG+AW+NLLENKTAF
Sbjct  822  VVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKTAF  860



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW MHDTDFFS+KF VRS+R S+ EMM ALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVIFFWAMHDTDFFSEKFSVRSLRGSENEMMGALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+ ERPG+LLL AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYAERPGLLLLSAFIIAQLVATLIAVYANWGFARIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLD +KFA RYILSGKAW  L ENKTAF
Sbjct  827  VIWLYSIVFYVPLDFIKFAIRYILSGKAWLTLFENKTAF  865



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLGGYLALMTV+FFW+M+DTDFFS+KF VRS+R+  E+MMAALYLQV
Sbjct  707  DSWKLREIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLL AF++AQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVATLIAVYANWGFARIKGAGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y PLD +KFA RYI SGKAWNNLLENKTAF
Sbjct  827  VIWLYSIVTYFPLDFLKFAIRYIQSGKAWNNLLENKTAF  865



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLGGYLALMTV+FFW+M+DTDFFS+KF VRS+R+  E+MMAALYLQV
Sbjct  707  DSWKLREIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLL AF++AQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVATLIAVYANWGFARIKGAGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y PLD +KFA RYI SGKAWNNLLENKTAF
Sbjct  827  VIWLYSIVTYFPLDFLKFAIRYIQSGKAWNNLLENKTAF  865



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLA+MTVIFFW MH TDFFSDKFGVRSIR+S+ EMM+ALYLQV
Sbjct  702  DSWKLKEIFATGIVLGSYLAIMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL+AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYSIVFY PLD++KF  R++LSG+AW+NLLENKTAF
Sbjct  822  VVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKTAF  860



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   397 bits (1020),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY ALMTVIFFW M DTDFFSDKFGV+ IRNS  EMMAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYQALMTVIFFWAMRDTDFFSDKFGVKPIRNSSNEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF+ AQLVATLIAVYA WGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLVSAFVAAQLVATLIAVYAEWGFARIKGTGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V YVPLDI+KFA RYILSG+AWN+LLENKTAF
Sbjct  827  VIWLYSLVTYVPLDILKFAIRYILSGRAWNSLLENKTAF  865



>gb|KGN65469.1| hypothetical protein Csa_1G423270 [Cucumis sativus]
Length=807

 Score =   393 bits (1010),  Expect = 2e-128, Method: Composition-based stats.
 Identities = 183/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  499  MKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  558

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG++LGGYLALMTVIFFWIM +TDFF +KF VR I++S +EMMAALYLQV
Sbjct  559  DSWKLKEIFATGIMLGGYLALMTVIFFWIMRETDFFPEKFNVRPIKDSPKEMMAALYLQV  618

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+ ERPG+LL+ AF+IAQLVATLIAVYANW FA+I+G GWGWAG
Sbjct  619  SIVSQALIFVTRSRSWSYFERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAG  678

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+W+YS++FY+PLD +KFA RYILSGKAW NLLENKTAF
Sbjct  679  VVWIYSVIFYIPLDFIKFAIRYILSGKAWLNLLENKTAF  717



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   397 bits (1019),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY+ALMTV+FFW+M DTDFFS+KF VR + +  E+MMAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYMALMTVVFFWLMRDTDFFSNKFHVRPLSDRPEQMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLL AF+IAQLVATLIAVYANWGFARIQG GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIQGAGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV YVPLD++KFA RYI SGKAWNNLLENKTAF
Sbjct  827  VIWLYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAF  865



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   397 bits (1019),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTV+FFWIM DTDFFSDKFGVRSIRNS  EMMAALYLQV
Sbjct  704  DSWKLREIFATGVVLGTYMALMTVVFFWIMKDTDFFSDKFGVRSIRNSPGEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS+VERPG+LLL AF+IAQLVAT +AVYANW FARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSYVERPGLLLLGAFMIAQLVATFLAVYANWEFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLDI+KFA RY+LSGKAW+NLLENKTAF
Sbjct  824  VIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAF  862



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   397 bits (1019),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 193/222 (87%), Positives = 208/222 (94%), Gaps = 3/222 (1%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIR---NSDEEMMAALY  352
            DSWKLKEIFATG+VLGGYLALMTVIFFW+M +TDFFSDKFGV+++R   N++ EMMAALY
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVIFFWLMKETDFFSDKFGVKNLRLSPNAEHEMMAALY  766

Query  353  LQVSIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWG  532
            LQVSIVSQALIFVTRSRSWSF ERPGMLL+ AF+IAQLVATLIAVYA+W FARI+G  WG
Sbjct  767  LQVSIVSQALIFVTRSRSWSFFERPGMLLVSAFIIAQLVATLIAVYADWSFARIKGIDWG  826

Query  533  WAGVIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            WAGVIW+YSIVFYVPLDIMKFATRYILSGKAW NLLENKTAF
Sbjct  827  WAGVIWIYSIVFYVPLDIMKFATRYILSGKAWLNLLENKTAF  868



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =   396 bits (1018),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  641  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  700

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY+ALMTV+FFW+M DTDFFS+KF VR + +  E+MMAALYLQV
Sbjct  701  DSWKLKEIFATGIVLGGYMALMTVVFFWLMRDTDFFSNKFHVRPLSDRPEQMMAALYLQV  760

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLL AF+IAQLVATLIAVYANWGFARIQG GWGWAG
Sbjct  761  SIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIQGAGWGWAG  820

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV YVPLD++KFA RYI SGKAWNNLLENKTAF
Sbjct  821  VIWLYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAF  859



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   397 bits (1019),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW+M  T+FFSDKFGVRSIR++++EMMAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVIFFWLMDGTNFFSDKFGVRSIRHNEDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR  S+ ERPG+LL+ AF IAQLVATLIAVYANWGFA+I+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRGRSYAERPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  827  VIWLYSIVFYIPLDVMKFAIRYILSGKAWLNLLENKTAF  865



>ref|XP_011010708.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=951

 Score =   396 bits (1018),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 191/219 (87%), Positives = 207/219 (95%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFS FMVLIIAILNDGTIMTISK+ V PSPLP
Sbjct  645  MKNYTIYAVSITIRIVFGFMLIALIWKHDFSPFMVLIIAILNDGTIMTISKE-VKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW +HDTDFFS+KFG+RS+R +DEEMM ALYLQV
Sbjct  704  DSWKLKEIFATGIVLGGYLALMTVIFFWAVHDTDFFSEKFGLRSLRKNDEEMMGALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQLVAT+IAVY NWGFARI+G GWGWAG
Sbjct  764  SIVSQALIFVTRSRSWSFIERPGLLLVSAFMIAQLVATVIAVYVNWGFARIKGIGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY PLDIMKFA RYILSGKAW NLLENKTAF
Sbjct  824  VIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLENKTAF  862



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   396 bits (1018),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 190/219 (87%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLGGYLALMTVIFFW + +T FF DKFGVR I ++ +EM AALYLQV
Sbjct  708  DSWKLNEIFATGVVLGGYLALMTVIFFWAIKETTFFPDKFGVRPIHDNPDEMTAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQL+AT+IAVYANWGFARIQG GWGWAG
Sbjct  768  SIVSQALIFVTRSRSWSFIERPGLLLVTAFVIAQLIATVIAVYANWGFARIQGIGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDIMKFA RYILSGKAWNNLLENKTAF
Sbjct  828  VIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLENKTAF  866



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   396 bits (1017),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 192/219 (88%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW M +T FF DKFGVR I +S +EM AALYLQV
Sbjct  708  DSWKLKEIFATGIVLGGYLALMTVIFFWAMKETKFFPDKFGVRHIGDSPDEMTAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LLL AF+IAQL+ATLIAVYANW FARI+G GWGWAG
Sbjct  768  SIVSQALIFVTRSRSWSFIERPGLLLLGAFVIAQLIATLIAVYANWSFARIKGVGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDIMKFATRYILSGKAW NLLENKTAF
Sbjct  828  VIWLYSIVFYFPLDIMKFATRYILSGKAWLNLLENKTAF  866



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   396 bits (1017),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  642  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLAL+TVIFFW++ DTDFF +KFGVR IRN  +EMMA LYLQV
Sbjct  702  DSWKLKEIFATGIVLGGYLALLTVIFFWLIKDTDFFPEKFGVRPIRNKPDEMMAVLYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AFL+AQL+AT +AVYANW FARI GCGWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFMERPGLLLVAAFLVAQLIATFVAVYANWDFARIHGCGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY+PLDI+KF TRY LSGKAW NLLENKTAF
Sbjct  822  VIWIYSIVFYIPLDILKFGTRYALSGKAWLNLLENKTAF  860



>gb|ACL54575.1| unknown [Zea mays]
Length=951

 Score =   396 bits (1017),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIW+YDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSW LKEIFATG+VLG YLALMTVIFFW MH TDFFSDKFGVRSIR+S+ EMM+ALYLQV
Sbjct  702  DSWNLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL+AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYSIVFY PLD++KF  R++LSG+AW+NLLENKTAF
Sbjct  822  VVWLYSIVFYFPLDLLKFFIRFVLSGRAWDNLLENKTAF  860



>dbj|BAG94605.1| unnamed protein product [Oryza sativa Japonica Group]
Length=908

 Score =   394 bits (1013),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  599  MKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  658

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFF+DKFGVRSIRNS+ EMM+ALYLQV
Sbjct  659  DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSALYLQV  718

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF++AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  719  SIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAG  778

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDI KF  R++LSG+AW+NLLENK AF
Sbjct  779  VIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAF  817



>dbj|BAC77530.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=951

 Score =   395 bits (1015),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTV+FFW+M DTDFFSDKFGVRS+RNS EEMMAALYLQV
Sbjct  704  DSWKLREIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGVRSLRNSPEEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS+VERPG+LLL AF IAQLVAT +AVYANWGFARI+G GWGWA 
Sbjct  764  SIISQALIFVTRSRSWSYVERPGLLLLGAFFIAQLVATFLAVYANWGFARIKGMGWGWAA  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V YVPLDI+KF  RY+LSGKAW+NLLENKTAF
Sbjct  824  VIWLYSLVTYVPLDILKFTIRYVLSGKAWDNLLENKTAF  862



>gb|EAZ32257.1| hypothetical protein OsJ_16461 [Oryza sativa Japonica Group]
Length=951

 Score =   395 bits (1015),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFF+DKFGVRSIRNS+ EMM+ALYLQV
Sbjct  702  DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF++AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDI KF  R++LSG+AW+NLLENK AF
Sbjct  822  VIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAF  860



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score =   395 bits (1014),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFFSDKFGVRSIRNS+ EMM+ALYLQV
Sbjct  702  DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRNSEHEMMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF++AQLVAT IAVYANW FARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFVERPGLLLVTAFMLAQLVATFIAVYANWSFARIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDI KF  R++LSG+AW+NLLENK AF
Sbjct  822  VIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAF  860



>ref|NP_001054118.1| Os04g0656100 [Oryza sativa Japonica Group]
 sp|Q7XPY2.1|PMA1_ORYSJ RecName: Full=Plasma membrane ATPase; AltName: Full=Proton pump 
[Oryza sativa Japonica Group]
 emb|CAE03410.3| OSJNBa0071I13.11 [Oryza sativa Japonica Group]
 dbj|BAF16032.1| Os04g0656100 [Oryza sativa Japonica Group]
 emb|CAH66693.1| OSIGBa0158D24.1 [Oryza sativa Indica Group]
 gb|EAY95868.1| hypothetical protein OsI_17734 [Oryza sativa Indica Group]
Length=951

 Score =   395 bits (1014),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFF+DKFGVRSIRNS+ EMM+ALYLQV
Sbjct  702  DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF++AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDI KF  R++LSG+AW+NLLENK AF
Sbjct  822  VIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAF  860



>emb|CAD29313.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=948

 Score =   394 bits (1013),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  639  MKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  698

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFF+DKFGVRSIRNS+ EMM+ALYLQV
Sbjct  699  DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSALYLQV  758

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF++AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  759  SIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAG  818

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDI KF  R++LSG+AW+NLLENK AF
Sbjct  819  VIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAF  857



>ref|XP_010111939.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXC32057.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=928

 Score =   394 bits (1011),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLGGYLALMTVIFFW+M DT+FFSDKFGVRS+R++ +EMMAALYLQV
Sbjct  707  DSWKLREIFATGIVLGGYLALMTVIFFWVMKDTNFFSDKFGVRSLRDNPKEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VE PG+LLL AF+IAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYVELPGLLLLGAFVIAQLVATLIAVYANWGFARIKGAGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V YVPLD +KFA RYILSGKAW+NLLENKTAF
Sbjct  827  VIWLYSLVTYVPLDFLKFAIRYILSGKAWDNLLENKTAF  865



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   394 bits (1012),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+ALMTV+FFW+M DTDFFSDKFGVRSIR + +EMMAALYLQV
Sbjct  704  DSWKLKEIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGVRSIRKNPDEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPG+LLL AF+IAQLVAT IAVYANWGFARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSFLERPGLLLLGAFMIAQLVATFIAVYANWGFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS+V Y PLDI+KF  RY+LSGKAW+NLLENKTAF
Sbjct  824  VIWVYSLVTYFPLDILKFVIRYVLSGKAWDNLLENKTAF  862



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =   394 bits (1012),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW MH T FFSDKFGVRS+++  +E MAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVIFFWAMHKTTFFSDKFGVRSLKDRPDEEMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF +AQL+AT++AVYANWGFA I+GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLMSAFCVAQLIATVLAVYANWGFAEIKGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y+PLDI+KFA RYILSGKAW ++LENKTAF
Sbjct  827  VIWLYSIVTYLPLDILKFAIRYILSGKAWVSMLENKTAF  865



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   394 bits (1011),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTVIFFW M DT+FFS+KFGVRS+R S EEMMAALYLQV
Sbjct  704  DSWKLREIFATGVVLGSYMALMTVIFFWAMKDTNFFSNKFGVRSLRLSPEEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF ERPG+LLL AFLIAQLVAT IAVYANWGFARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVATFIAVYANWGFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLDI+KFA RYILSGKAW+NLLENKTAF
Sbjct  824  VIWLYSVVTYIPLDILKFAIRYILSGKAWDNLLENKTAF  862



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   394 bits (1011),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTVIFFW M DT+FFS+KFGVRS+R S EEMMAALYLQV
Sbjct  704  DSWKLREIFATGVVLGSYMALMTVIFFWAMKDTNFFSNKFGVRSLRLSPEEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF ERPG+LLL AFLIAQLVAT IAVYANWGFARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVATFIAVYANWGFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLDI+KFA RYILSGKAW+NLLENKTAF
Sbjct  824  VIWLYSVVTYIPLDILKFAIRYILSGKAWDNLLENKTAF  862



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   394 bits (1011),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY+ALMTV+FFW+M DTDFFS+KF VRS+RN+  EMMAALYLQV
Sbjct  708  DSWKLKEIFATGIVLGGYMALMTVVFFWLMQDTDFFSEKFQVRSLRNNPSEMMAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRS+SF+ERPG+LLL AF++AQLVATLIAVYANW FARI GCGWGWAG
Sbjct  768  SIISQALIFVTRSRSFSFLERPGLLLLGAFIVAQLVATLIAVYANWEFARIHGCGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WL+S+V Y PLD++KFA RYILSGKAW+NLLENKTAF
Sbjct  828  VVWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAF  866



>emb|CDY03545.1| BnaC03g68040D [Brassica napus]
Length=660

 Score =   385 bits (990),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  354  MKNYTIYAVSITIRIVFGFMLIALIWKFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  413

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY A+MTVIFF   H TDFFSD FGVRSIRN++ E+M A+YLQV
Sbjct  414  DSWKLKEIFATGVVLGGYQAMMTVIFFLAAHKTDFFSDTFGVRSIRNNNNELMGAVYLQV  473

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL+VAFLIAQLVATLIAVYANW FA+++G GWGWAG
Sbjct  474  SIISQALIFVTRSRSWSFVERPGALLMVAFLIAQLVATLIAVYANWEFAKVRGIGWGWAG  533

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y P DI KFA RYILSGKAW NL ENKTAF
Sbjct  534  VIWLYSIVTYFPQDIFKFAIRYILSGKAWLNLFENKTAF  572



>dbj|BAG55917.1| H+-ATPase [Mimosa pudica]
Length=349

 Score =   375 bits (962),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  117  MKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  176

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKE+FATGVVLGGYLALMTV+FFW+++DT+FFSDKFGV S+R+   E MAALYLQV
Sbjct  177  DSWKLKELFATGVVLGGYLALMTVVFFWVIYDTNFFSDKFGVMSLRHRPNETMAALYLQV  236

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+S+ALIFVTRSRSWS+VERPG+LLL AF+IAQLVATLIAVYA+W FARI+G GWGWAG
Sbjct  237  SIISKALIFVTRSRSWSYVERPGLLLLGAFMIAQLVATLIAVYAHWEFARIKGMGWGWAG  296

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y+PLD++KFA RY LSGKAW+N+LENKTAF
Sbjct  297  VIWLYSIVTYIPLDLLKFAIRYGLSGKAWDNILENKTAF  335



>ref|XP_008453588.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=953

 Score =   393 bits (1009),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 207/219 (95%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  645  MKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG++LGGYLALMTVIFFWIM +TDFF +KFGVR I++S +EMMAALYLQV
Sbjct  705  DSWKLKEIFATGIMLGGYLALMTVIFFWIMRETDFFPEKFGVRPIKDSPKEMMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPGMLL+ AF+IAQLVATL+AVYANW FA+I+G GWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSYVERPGMLLMGAFVIAQLVATLLAVYANWEFAKIKGAGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+W+YS+VFY+PLD +KFA RYILSGKAW NLLENKTAF
Sbjct  825  VVWIYSVVFYIPLDFIKFAIRYILSGKAWLNLLENKTAF  863



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   393 bits (1009),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 204/219 (93%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRVVPSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVVPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW M + DFF DKFGVR + +  +EMM+ALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVIFFWAMKENDFFPDKFGVRKLNH--DEMMSALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR WSF+ERPG LL++AF IAQL+AT+IAVYANWGFA++QG GWGWAG
Sbjct  765  SIVSQALIFVTRSRGWSFLERPGALLVIAFFIAQLIATIIAVYANWGFAKVQGIGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD+MKFA RYILSGKAWNNLL+NKTAF
Sbjct  825  VIWLYSIVFYIPLDVMKFAIRYILSGKAWNNLLDNKTAF  863



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   393 bits (1009),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 204/219 (93%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRVVPSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVVPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW M + DFF DKFGVR + +  +EMM+ALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVIFFWAMKENDFFPDKFGVRKLNH--DEMMSALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR WSF+ERPG LL++AF IAQL+AT+IAVYANWGFA++QG GWGWAG
Sbjct  765  SIVSQALIFVTRSRGWSFLERPGALLVIAFFIAQLIATIIAVYANWGFAKVQGIGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD+MKFA RYILSGKAWNNLL+NKTAF
Sbjct  825  VIWLYSIVFYIPLDVMKFAIRYILSGKAWNNLLDNKTAF  863



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   393 bits (1009),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVV G YLALMTVIFFW M DTDFFSDKF VRS+R+S++EMMAALYLQV
Sbjct  707  DSWKLKEIFATGVVFGSYLALMTVIFFWAMKDTDFFSDKFKVRSLRHSEDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSW FVERPG+LL+ AF+IAQLVAT+IAVYANW FARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWCFVERPGLLLVTAFVIAQLVATVIAVYANWSFARIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVF+ PLD  KFA RYILSGKAW+NLLEN+TAF
Sbjct  827  VIWLYSIVFFFPLDCFKFAIRYILSGKAWDNLLENRTAF  865



>ref|XP_010046966.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Eucalyptus grandis]
Length=990

 Score =   394 bits (1011),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  683  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  742

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW MH T FFSDKFGVRS+++  +E MAALYLQV
Sbjct  743  DSWKLKEIFATGIVLGGYLALMTVIFFWAMHKTTFFSDKFGVRSLKDRPDEEMAALYLQV  802

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF +AQL+AT++AVYANWGFA I+GCGWGWAG
Sbjct  803  SIVSQALIFVTRSRSWSFVERPGLLLMSAFCVAQLIATVLAVYANWGFAEIKGCGWGWAG  862

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y+PLDI+KFA RYILSGKAW ++LENKTAF
Sbjct  863  VIWLYSIVTYLPLDILKFAIRYILSGKAWVSMLENKTAF  901



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   392 bits (1008),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPMP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTV+FFW+M DTDFFSDKFGVRSIRN+ +EMMAALYLQV
Sbjct  704  DSWKLREIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGVRSIRNNPDEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS VERPG+LLL AF+IAQL+AT IAVYANW FARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSVVERPGLLLLGAFMIAQLLATFIAVYANWSFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y+PLDI+KF  RY+LSGKAW+NLLENKTAF
Sbjct  824  VIWMYSIVTYIPLDILKFVIRYVLSGKAWDNLLENKTAF  862



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   392 bits (1007),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  643  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPMP  702

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTV+FFW+M DTDFFSDKFGVRSIRN+ +EMMAALYLQV
Sbjct  703  DSWKLREIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGVRSIRNNPDEMMAALYLQV  762

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS VERPG+LLL AF+IAQL+AT IAVYANW FARI+G GWGWAG
Sbjct  763  SIISQALIFVTRSRSWSVVERPGLLLLGAFMIAQLLATFIAVYANWSFARIKGMGWGWAG  822

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y+PLDI+KF  RY+LSGKAW+NLLENKTAF
Sbjct  823  VIWMYSIVTYIPLDILKFVIRYVLSGKAWDNLLENKTAF  861



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   392 bits (1007),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVV G YLALMTVIFFW MH TDFFSD+F VRS+R+ +E+ M+ALYLQV
Sbjct  707  DSWKLKEIFATGVVFGTYLALMTVIFFWAMHKTDFFSDEFKVRSLRDKEEQQMSALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSW FVERPG+LL+ AF+IAQLVATLIAVYANWGFARIQG GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWCFVERPGLLLVTAFVIAQLVATLIAVYANWGFARIQGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVF+ PLD+ KFA RYILSGKAW+NLLE KTAF
Sbjct  827  VIWLYSIVFFFPLDLFKFAIRYILSGKAWDNLLEKKTAF  865



>gb|AHK23067.1| plasma membrane ATPase 4 [Fagopyrum tataricum]
Length=965

 Score =   392 bits (1007),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  646  MKNYTIYAVSITIRIVFGFMFIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  705

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGYLALMTVIFFW M +TDFF + FGVR IR+S++EMMAALYLQV
Sbjct  706  DSWKLKEIFATGVVLGGYLALMTVIFFWAMKETDFFPNTFGVRPIRHSEDEMMAALYLQV  765

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            S+VSQALIFVTRSRSWSFVERPG+LL+ AF IAQLVATLIAVYANWGFARIQG GWGWAG
Sbjct  766  SVVSQALIFVTRSRSWSFVERPGLLLVTAFFIAQLVATLIAVYANWGFARIQGMGWGWAG  825

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V WLYS+VFY PLD++KFA RYILSGKAW +L +NKTAF
Sbjct  826  VAWLYSLVFYFPLDLLKFAIRYILSGKAWLSLFDNKTAF  864



>gb|KHM99449.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=940

 Score =   391 bits (1004),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  633  MKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  692

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTV+FFW M DT+FFS+KFGVR +R+S +EMMAALYLQV
Sbjct  693  DSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGVRPLRDSPDEMMAALYLQV  752

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL AF IAQLVAT IAVYANWGFARI+G GWGWAG
Sbjct  753  SIISQALIFVTRSRSWSFVERPGLLLLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAG  812

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLD++KFA RYILSGKAW+NLLENKTAF
Sbjct  813  VIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAF  851



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   391 bits (1005),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTV+FFW M DT+FFS+KFGVR +R+S +EMMAALYLQV
Sbjct  704  DSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGVRPLRDSPDEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL AF IAQLVAT IAVYANWGFARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSFVERPGLLLLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLD++KFA RYILSGKAW+NLLENKTAF
Sbjct  824  VIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAF  862



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   391 bits (1005),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTV+FFW M DT+FFS+KFGVRS+R++ EEMMAALYLQV
Sbjct  704  DSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGVRSLRHNSEEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF ERPG+LLL AF IAQLVAT IAVYANWGFARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSFAERPGLLLLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLD++KFA RY+LSGKAW+NLLENKTAF
Sbjct  824  VIWLYSLVTYIPLDLLKFAIRYVLSGKAWDNLLENKTAF  862



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   391 bits (1004),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV  SPLP
Sbjct  643  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKASPLP  702

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLALMTV+FFW +HDTDFFS+KF VR IR+S+ EMMAALYLQV
Sbjct  703  DSWKLKEIFATGVVLGSYLALMTVVFFWAVHDTDFFSEKFHVRRIRDSEHEMMAALYLQV  762

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF +AQLVATL+AVYANWGFAR++G GWGWAG
Sbjct  763  SIVSQALIFVTRSRSWSFVERPGLLLVSAFFVAQLVATLLAVYANWGFARVKGIGWGWAG  822

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFYVPLD++KFA +YILSGKAW+ LLE KTAF
Sbjct  823  VIWIYSIVFYVPLDLIKFAVKYILSGKAWDTLLEKKTAF  861



>gb|KEH39753.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   391 bits (1004),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG Y+ALMTVIFFW MHD+DFFSDKFGVRS+RN+  EMMAALYLQV
Sbjct  704  DSWKLKEIFATGIVLGSYMALMTVIFFWAMHDSDFFSDKFGVRSLRNNPAEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSR+WSF +RPG+LLL AF++AQLVAT+IAVYA+W FARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRNWSFADRPGLLLLGAFVLAQLVATVIAVYADWEFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLD++K A RYILSGKAWNN+LENKTAF
Sbjct  824  VIWLYSLVTYIPLDLLKIAIRYILSGKAWNNILENKTAF  862



>emb|CAC50884.1| plasma membrane H+-ATPase [Hordeum vulgare subsp. vulgare]
Length=635

 Score =   382 bits (981),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  326  MKNYTIYAVSITIRIVLGFLLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  385

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG YLALMTV+FFWI+H TDFF++KFGVRSIR ++ E M+ALYLQV
Sbjct  386  DSWKLNEIFATGVVLGTYLALMTVVFFWIIHRTDFFTNKFGVRSIRENETEKMSALYLQV  445

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LL++AFL+AQLVATLIAVYANWGFARI G GWGWAG
Sbjct  446  SIVSQALIFVTRSRSWSFVERPGFLLVIAFLLAQLVATLIAVYANWGFARISGIGWGWAG  505

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+SIVFY PLDI KF  R++LSG+AW+NLL+NKTAF
Sbjct  506  VIWLFSIVFYFPLDIFKFFIRFVLSGRAWDNLLQNKTAF  544



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =   391 bits (1004),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW++ +TDFFSD FGVRSIR   EE+MAALYLQV
Sbjct  708  DSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDSFGVRSIREKPEELMAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR +SF+ERPGMLL+ AF+IAQLVATL+AVYA WGFARI G GWGWAG
Sbjct  768  SIVSQALIFVTRSRGFSFMERPGMLLMSAFMIAQLVATLLAVYAKWGFARIHGVGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY PLD MKF  RYILSGKAW NLLENKTAF
Sbjct  828  VIWIYSIVFYFPLDFMKFTIRYILSGKAWLNLLENKTAF  866



>gb|KEH19962.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =   390 bits (1003),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG Y+ALMTVIFFW M+DTDFFSD FGVRS+R+S +EMMAALYLQV
Sbjct  704  DSWKLKEIFATGIVLGSYMALMTVIFFWAMNDTDFFSDTFGVRSLRDSPDEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSR+WS  +RPG+LLL AFL+AQLVAT+IAVYANW FARIQG GWGWAG
Sbjct  764  SIISQALIFVTRSRNWSVTDRPGLLLLGAFLVAQLVATVIAVYANWEFARIQGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLDI+K A RYI SGKAWNN+LENKTAF
Sbjct  824  VIWLYSLVTYIPLDILKIAIRYIQSGKAWNNILENKTAF  862



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   391 bits (1004),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 189/219 (86%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  646  MKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  705

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLALMTVIFFW M +TDFFSDKF VRS+R+++ EMMAALYLQV
Sbjct  706  DSWKLKEIFATGIVLGTYLALMTVIFFWAMKETDFFSDKFKVRSLRHNEHEMMAALYLQV  765

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSW FVERPG+LL+ AFLIAQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  766  SIVSQALIFVTRSRSWCFVERPGLLLVSAFLIAQLVATLIAVYANWGFARIKGIGWGWAG  825

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVF+VPLD  KFA RYILSGKAW+NLLE+KTAF
Sbjct  826  VIWLYSIVFFVPLDWFKFAIRYILSGKAWDNLLESKTAF  864



>emb|CBI20766.3| unnamed protein product [Vitis vinifera]
Length=862

 Score =   389 bits (998),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  555  MKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  614

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTV+FFW+M DTDFF +KFGV+SIR S+ EMMAALYLQV
Sbjct  615  DSWKLKEIFATGIVLGGYLALMTVVFFWVMKDTDFFPEKFGVKSIRYSEHEMMAALYLQV  674

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LL+ AF+ AQLVAT+I+VYANWGFARI+G GWGWAG
Sbjct  675  SIVSQALIFVTRSRSWSYVERPGLLLVGAFIAAQLVATVISVYANWGFARIKGTGWGWAG  734

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V YVPLD +KFA RYI SGKAW+NLLENKTAF
Sbjct  735  VIWLYSVVTYVPLDFLKFAIRYIQSGKAWDNLLENKTAF  773



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   390 bits (1002),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG YLA+MTVIFFW+M  TDFFSDKFGVRSIRNS +E+M+ALYLQV
Sbjct  702  DSWKLREIFATGVVLGSYLAIMTVIFFWVMFKTDFFSDKFGVRSIRNSQDELMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LL+ AF+IAQL+AT IAVYA+WGFA+I+G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGLLLMTAFVIAQLIATFIAVYADWGFAKIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y PLD+MKFA RYILSGKAW NL ENKTAF
Sbjct  822  VIWLYSLVTYFPLDVMKFAIRYILSGKAWLNLFENKTAF  860



>ref|XP_008360343.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=885

 Score =   389 bits (998),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  578  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  637

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW++ +TDFFSD FGVRSIR   EE+MAALYLQV
Sbjct  638  DSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDSFGVRSIREKPEELMAALYLQV  697

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR +SF+ERPGMLL+ AF+IAQL ATL+AVYA WGFA+I G GWGWAG
Sbjct  698  SIVSQALIFVTRSRGFSFMERPGMLLMSAFMIAQLXATLLAVYAKWGFAKIHGVGWGWAG  757

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY PLD MKFA RYILSGKAW NLLENKTAF
Sbjct  758  VIWIYSIVFYFPLDFMKFAIRYILSGKAWLNLLENKTAF  796



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   390 bits (1002),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLG YLALMTVIFFW + +TDFFSDKF VRS+RNS++EMMAALYLQV
Sbjct  707  DSWKLREIFATGIVLGTYLALMTVIFFWAVKETDFFSDKFHVRSLRNSEDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSW FVERPG+LL++AF++AQLVATLIAVYA+WGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWCFVERPGLLLVIAFVVAQLVATLIAVYADWGFARIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVF+ PLD+ KFA RYILSGKAW+NLLE KTAF
Sbjct  827  VIWLYSIVFFFPLDLFKFAIRYILSGKAWDNLLEKKTAF  865



>dbj|BAH56991.1| AT4G30190 [Arabidopsis thaliana]
Length=816

 Score =   387 bits (993),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  518  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  577

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY A+MTVIFFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  578  DSWKLKEIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQV  637

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQL+ATLIAVYANW FA+I+G GWGWAG
Sbjct  638  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAG  697

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y PLD+ KFA RYILSGKAW NL ENKTAF
Sbjct  698  VIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAF  736



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   390 bits (1001),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FM+LIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMILIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLALMTVIFFW MH TDFFSD F VRS+R  DEEMMAALYLQV
Sbjct  707  DSWKLKEIFATGVVLGTYLALMTVIFFWAMHKTDFFSDTFRVRSLRGHDEEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSW FVERPG+LL+ AF+IAQLVATLIAVYANWGFARI+G GWGWA 
Sbjct  767  SIVSQALIFVTRSRSWCFVERPGLLLVTAFVIAQLVATLIAVYANWGFARIKGIGWGWAA  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVF+ PLD+ KF+ RYILSGKAW+NLLE KTAF
Sbjct  827  VIWLYSIVFFFPLDLFKFSIRYILSGKAWDNLLEKKTAF  865



>ref|XP_004960134.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=951

 Score =   390 bits (1001),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWKYDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLALMTVIFFW MH TDFF +KFGV+ IR+S+ +MM+ALYLQV
Sbjct  702  DSWKLKEIFATGVVLGSYLALMTVIFFWAMHKTDFFPEKFGVKPIRDSEGKMMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL+AQLVAT +AVYANWGFARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIEGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYSIVFY PLD+ KF  R++LSG+AW+NLLENKTAF
Sbjct  822  VVWLYSIVFYFPLDLFKFFIRFVLSGRAWDNLLENKTAF  860



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =   389 bits (1000),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 186/219 (85%), Positives = 204/219 (93%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRVVPSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVVPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATG+VLGGYLALMTVIFFW + +T FF DKFGVR + +  +EMM+ALYLQV
Sbjct  707  DSWKLNEIFATGIVLGGYLALMTVIFFWAIKETHFFPDKFGVRHLIH--DEMMSALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR WSF+ERPG LL++AFLIAQL+ATLIAVYANWGFA++QG GWGWAG
Sbjct  765  SIVSQALIFVTRSRGWSFLERPGALLVIAFLIAQLIATLIAVYANWGFAKVQGIGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD+MKFA RYILSGKAWNNLL+NKTAF
Sbjct  825  VIWLYSIVFYIPLDVMKFAIRYILSGKAWNNLLDNKTAF  863



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =   389 bits (1000),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFML++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  646  MKNYTIYAVSITIRIVFGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  705

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLA MTV+FFW   ++DFFSDKFGVRSIRNS EE+ AA+YLQV
Sbjct  706  DSWKLKEIFATGIVLGAYLACMTVVFFWAAQESDFFSDKFGVRSIRNSHEELTAAVYLQV  765

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQLVAT++AVYANWGFAR++G GWGWAG
Sbjct  766  SIVSQALIFVTRSRSWSFIERPGLLLVTAFIIAQLVATILAVYANWGFARMKGIGWGWAG  825

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVFY+PLDI+KF  RY LSGKAW+NLL+NKTAF
Sbjct  826  VIWIYSIVFYIPLDILKFFIRYSLSGKAWDNLLQNKTAF  864



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   390 bits (1001),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  650  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  709

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGV+LGGYLA+MTVIFFW++ DT FF ++FGVR I +S +E+ AALYLQV
Sbjct  710  DSWKLREIFATGVMLGGYLAMMTVIFFWVVKDTKFFPERFGVRHIHDSPDELTAALYLQV  769

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPGMLL+ AF+IAQL+ATLIAVYANWGFARIQG GWGWAG
Sbjct  770  SIVSQALIFVTRSRSWSYVERPGMLLMGAFVIAQLIATLIAVYANWGFARIQGIGWGWAG  829

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLDI+KFA RY LSGKAW NLLENKTAF
Sbjct  830  VIWLYSIIFYIPLDIIKFAIRYGLSGKAWTNLLENKTAF  868



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   389 bits (1000),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTV+FFW M DT+FFS+KFGVR IR++ +EMMAALYLQV
Sbjct  704  DSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGVRPIRHNPDEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF ERPG+LLL AFLIAQL+AT IAVYANWGFARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLIATFIAVYANWGFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLD++KFA RY LSGKAW+NLLENKTAF
Sbjct  824  VIWLYSLVTYIPLDLLKFAIRYFLSGKAWDNLLENKTAF  862



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   389 bits (1000),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTV+FFW+M DTDFF +KFGV+SIR S+ EMMAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVVFFWVMKDTDFFPEKFGVKSIRYSEHEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LL+ AF+ AQLVAT+I+VYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYVERPGLLLVGAFIAAQLVATVISVYANWGFARIKGTGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V YVPLD +KFA RYI SGKAW+NLLENKTAF
Sbjct  827  VIWLYSVVTYVPLDFLKFAIRYIQSGKAWDNLLENKTAF  865



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   389 bits (999),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 205/219 (94%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLG YLALMTVIFFW M +TDFF DKFGVR +  S +EMM+ALYLQV
Sbjct  708  DSWKLQEIFATGIVLGSYLALMTVIFFWAMKETDFFPDKFGVRHL--SHDEMMSALYLQV  765

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPGMLL+ AF+IAQL+AT+IAVYA+WGFA+++G GWGWAG
Sbjct  766  SIVSQALIFVTRSRSWSFIERPGMLLVCAFVIAQLIATIIAVYADWGFAKVKGIGWGWAG  825

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD+MKFATRY+LSGKAW N+LENKTAF
Sbjct  826  VIWLYSIVFYIPLDVMKFATRYVLSGKAWVNMLENKTAF  864



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   387 bits (995),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  578  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQP  637

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLA+MTV+FFW+M  TDFFSD FGVRS+R   +EMMAALYLQV
Sbjct  638  DSWKLKEIFATGVVLGSYLAIMTVVFFWLMRKTDFFSDAFGVRSLRTRPDEMMAALYLQV  697

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPG+LL  AF+IAQLVAT IAVYANW FARI+GCGWGWAG
Sbjct  698  SIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVATFIAVYANWSFARIEGCGWGWAG  757

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y PLDI+KF  RYILSGKAW+ LLENKTAF
Sbjct  758  VIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAF  796



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   389 bits (998),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  628  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  687

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLGGY+ALMTV+FFW+M +T FFS+ FGVR + N  E+MMAALYLQV
Sbjct  688  DSWKLREIFATGIVLGGYMALMTVVFFWLMRETKFFSNAFGVRHLGNRPEQMMAALYLQV  747

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLL AF+IAQLVATLIAVYANW FARI+GCGWGWAG
Sbjct  748  SIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWAFARIEGCGWGWAG  807

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+S+V Y PLD++KFA RYILSGKAW+NLLENKTAF
Sbjct  808  VIWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAF  846



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =   389 bits (999),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW M DTDFF +KF VR + +S +EMM+ALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVIFFWAMKDTDFFHEKFKVRPLNDSPKEMMSALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LL+ AF+IAQL+AT +AVYA+WGFA+I+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSYVERPGLLLMSAFIIAQLIATFLAVYADWGFAKIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYSIVFY+PLD +KF  RY+LSGKAWNNLLENKTAF
Sbjct  827  VVWLYSIVFYIPLDFLKFTIRYVLSGKAWNNLLENKTAF  865



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   389 bits (998),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  647  MKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLA+MTV+FFW M +T+FFSDKF VRS+R+S+ EMMAALYLQV
Sbjct  707  DSWKLKEIFATGVVLGTYLAIMTVVFFWAMKETNFFSDKFKVRSLRHSEHEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSW FVERPG+LL+ AFLIAQLVATLI+VYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWCFVERPGLLLVSAFLIAQLVATLISVYANWGFARIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVF++PLD  KFATRYILSGKAW+NLLE KTAF
Sbjct  827  VIWLYSIVFFLPLDWFKFATRYILSGKAWDNLLERKTAF  865



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   389 bits (998),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG YLALMTV+FFW M +TDFFSDKF VRS+R++D EMMAALYLQV
Sbjct  707  DSWKLREIFATGVVLGTYLALMTVVFFWAMKETDFFSDKFKVRSLRHNDHEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSW FVERPG+LL+ AF+IAQLVATLIAVYA+W FARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWCFVERPGLLLVSAFMIAQLVATLIAVYADWSFARIKGVGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVF+VPLD  KFA RYILSGKAW+NLLE KTAF
Sbjct  827  VIWLYSIVFFVPLDWFKFAIRYILSGKAWDNLLERKTAF  865



>gb|KDO67282.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=923

 Score =   387 bits (995),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLA+MTV+FFW+M  TDFFSD FGVRS+R   +EMMAALYLQV
Sbjct  707  DSWKLKEIFATGVVLGSYLAIMTVVFFWLMRKTDFFSDAFGVRSLRTRPDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPG+LL  AF+IAQLVAT IAVYANW FARI+GCGWGWAG
Sbjct  767  SIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVATFIAVYANWSFARIEGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y PLDI+KF  RYILSGKAW+ LLENKTAF
Sbjct  827  VIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAF  865



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   388 bits (997),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLA+MTV+FFW+M  TDFFSD FGVRS+R   +EMMAALYLQV
Sbjct  707  DSWKLKEIFATGVVLGSYLAIMTVVFFWLMRKTDFFSDAFGVRSLRTRPDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPG+LL  AF+IAQLVAT IAVYANW FARI+GCGWGWAG
Sbjct  767  SIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVATFIAVYANWSFARIEGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y PLDI+KF  RYILSGKAW+ LLENKTAF
Sbjct  827  VIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAF  865



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   388 bits (997),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 199/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLA+MTV+FFW+M  TDFFSD FGVRS+R   +EMMAALYLQV
Sbjct  707  DSWKLKEIFATGVVLGSYLAIMTVVFFWLMRKTDFFSDAFGVRSLRTRPDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPG+LL  AF+IAQLVAT IAVYANW FARI+GCGWGWAG
Sbjct  767  SIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVATFIAVYANWSFARIEGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y PLDI+KF  RYILSGKAW+ LLENKTAF
Sbjct  827  VIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAF  865



>ref|XP_004498580.1| PREDICTED: plasma membrane ATPase-like [Cicer arietinum]
Length=952

 Score =   388 bits (996),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIA+LNDGTIMTISKDRV  SPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAVLNDGTIMTISKDRVKASPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG Y+ALMTVIFFW M DTDFFSDKFGVRS+R+S +EMMAALYLQV
Sbjct  704  DSWKLKEIFATGIVLGSYMALMTVIFFWAMKDTDFFSDKFGVRSLRHSPDEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL AF+IAQL+AT IAVYA+W FARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSFVERPGLLLLGAFMIAQLIATFIAVYAHWEFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLY++V Y+PLD++KFA RYILSGKAW+NLLENKTAF
Sbjct  824  VIWLYTLVTYIPLDLLKFAIRYILSGKAWDNLLENKTAF  862



>dbj|BAL41366.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   388 bits (996),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 181/219 (83%), Positives = 206/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+D + FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFLLIALIWKFDLAPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLA+MTV+FFW +H TDFF++KFGVRSIR+S++EMMAALYLQV
Sbjct  702  DSWKLKEIFATGIVLGTYLAIMTVVFFWAIHKTDFFTEKFGVRSIRDSEDEMMAALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL+AQLVATLIAVYA+WGFARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFVERPGVLLVTAFLLAQLVATLIAVYADWGFARIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYS+VFY+PLD+ KF  R+ LSG+AW+NLLENKTAF
Sbjct  822  VVWLYSVVFYLPLDVFKFLIRFALSGRAWDNLLENKTAF  860



>ref|XP_010525721.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   387 bits (995),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWRFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY+A+ TV+FFW M+ TDFFS+KFGVRSIRNS +E+M+ALYLQV
Sbjct  702  DSWKLKEIFATGVVLGGYMAITTVVFFWAMYKTDFFSEKFGVRSIRNSQDELMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL AFLIAQL+AT IAVYA+W FA+I+G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGLLLLTAFLIAQLIATFIAVYADWTFAKIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y PLD+MKFATRY L+GKAW N+ ENKTAF
Sbjct  822  VIWLYSLVTYFPLDVMKFATRYFLTGKAWTNMYENKTAF  860



>gb|KHF98166.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=663

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/223 (82%), Positives = 206/223 (92%), Gaps = 4/223 (2%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  352  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  411

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNS----DEEMMAAL  349
            DSWKLKEIF+TG+VLGGYLALMTVIFFW M DT+FFS+ F VRS+R++    ++EMMAAL
Sbjct  412  DSWKLKEIFSTGIVLGGYLALMTVIFFWAMKDTNFFSNTFNVRSLRHNNIDGEKEMMAAL  471

Query  350  YLQVSIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGW  529
            YLQVSIVSQALIFVTRSRSWS+ ERPG+LL+ AFL+AQLVATLIAVYA+WGFARI+G GW
Sbjct  472  YLQVSIVSQALIFVTRSRSWSYFERPGLLLVSAFLVAQLVATLIAVYADWGFARIKGMGW  531

Query  530  GWAGVIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            GWAGVIWLYS+V Y+PLD++KFA RY+LSGKAW+NLLENKTAF
Sbjct  532  GWAGVIWLYSVVTYIPLDLIKFAIRYVLSGKAWDNLLENKTAF  574



>pdb|3B8C|A Chain A, Crystal Structure Of A Plasma Membrane Proton Pump
 pdb|3B8C|B Chain B, Crystal Structure Of A Plasma Membrane Proton Pump
Length=885

 Score =   385 bits (990),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY A+MTVIFFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  702  DSWKLKEIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQL+ATLIAVYANW FA+I+G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y PLD+ KFA RYILSGKAW NL ENKTAF
Sbjct  822  VIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAF  860



>ref|XP_007023380.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26002.1| H(+)-ATPase 9 [Theobroma cacao]
Length=926

 Score =   386 bits (992),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  619  MKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  678

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLA MTV+FFW   ++DFFSDKFGVRSIRNS EE+ AA+YLQV
Sbjct  679  DSWKLKEIFATGIVLGAYLACMTVVFFWAAQESDFFSDKFGVRSIRNSHEELTAAVYLQV  738

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQLVAT++AVYANWGFARI+G GWGWAG
Sbjct  739  SIVSQALIFVTRSRSWSFIERPGLLLVTAFIIAQLVATILAVYANWGFARIKGIGWGWAG  798

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS+VFY PLD++KF  RY LSGKAW+NLL+NKTAF
Sbjct  799  VIWIYSVVFYFPLDVLKFLIRYSLSGKAWDNLLQNKTAF  837



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   387 bits (994),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+V G YLALMTVIFFW M +TDFFSDKF VRS+R+S++EMM+ALYLQV
Sbjct  707  DSWKLKEIFATGIVFGSYLALMTVIFFWAMKETDFFSDKFKVRSLRHSEDEMMSALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR W F+ERPG+LL+ AF+IAQLVATL+AVYANWGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRGWCFIERPGLLLVTAFIIAQLVATLLAVYANWGFARIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVF+ PLD  KFA RY+LSGKAW+NLLENKTAF
Sbjct  827  VIWLYSIVFFFPLDWFKFAIRYVLSGKAWDNLLENKTAF  865



>gb|ABW25091.1| plasma membrane proton pump [Cucumis sativus]
Length=953

 Score =   387 bits (993),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  645  MKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG++LGGYLALMTVIFFWIM +TDFF +KF VR I++S +EMMAALYLQV
Sbjct  705  DSWKLKEIFATGIMLGGYLALMTVIFFWIMRETDFFPEKFNVRPIKDSPKEMMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+ ERPG+LL+ AF+IAQLVATLIAVYANW FA+I+G GWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSYFERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+W+YS++FY+PLD +KFA RYILSGKAW NLLENKTAF
Sbjct  825  VVWIYSVIFYIPLDFIKFAIRYILSGKAWLNLLENKTAF  863



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   387 bits (993),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG++LG YLA+MTVIFFW  HDTDFFSD+FGVRSIR +DEE+ AALYLQV
Sbjct  707  DSWKLKEIFATGIILGTYLAVMTVIFFWAAHDTDFFSDRFGVRSIRKNDEELTAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG++L+ AFLIAQLVATLIAVYA W FARI G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLMLVFAFLIAQLVATLIAVYAKWHFARISGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW++S+VFY PLDI+KF  RY LSGKAW+NLL+NKTAF
Sbjct  827  VIWIFSVVFYFPLDILKFLIRYGLSGKAWDNLLQNKTAF  865



>ref|XP_004161788.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=953

 Score =   387 bits (993),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  645  MKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG++LGGYLALMTVIFFWIM +TDFF +KF VR I++S +EMMAALYLQV
Sbjct  705  DSWKLKEIFATGIMLGGYLALMTVIFFWIMRETDFFPEKFNVRPIKDSPKEMMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+ ERPG+LL+ AF+IAQLVATLIAVYANW FA+I+G GWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSYFERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+W+YS++FY+PLD +KFA RYILSGKAW NLLENKTAF
Sbjct  825  VVWIYSVIFYIPLDFIKFAIRYILSGKAWLNLLENKTAF  863



>ref|XP_004146327.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=953

 Score =   387 bits (993),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  645  MKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG++LGGYLALMTVIFFWIM +TDFF +KF VR I++S +EMMAALYLQV
Sbjct  705  DSWKLKEIFATGIMLGGYLALMTVIFFWIMRETDFFPEKFNVRPIKDSPKEMMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+ ERPG+LL+ AF+IAQLVATLIAVYANW FA+I+G GWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSYFERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+W+YS++FY+PLD +KFA RYILSGKAW NLLENKTAF
Sbjct  825  VVWIYSVIFYIPLDFIKFAIRYILSGKAWLNLLENKTAF  863



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   387 bits (993),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG YLA+MTVIFF+I HDTDFFSD FGVRSIRN+++E+ AA+YLQV
Sbjct  707  DSWKLQEIFATGVVLGTYLAMMTVIFFYIAHDTDFFSDHFGVRSIRNNEDELTAAVYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL AQL+ATLIAVYA WGFARIQG GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLVSAFLAAQLLATLIAVYAKWGFARIQGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSI+FY PLD +KF  R+ LSGKAW+NLLENKTAF
Sbjct  827  VIWVYSIIFYFPLDPLKFIIRFALSGKAWDNLLENKTAF  865



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   386 bits (992),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  636  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  695

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY+ALMTV+FFW+M DT FFS+ F VR + +  E+MMAALYLQV
Sbjct  696  DSWKLKEIFATGIVLGGYMALMTVVFFWLMKDTKFFSNTFNVRHLGDRPEQMMAALYLQV  755

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLL AF++AQLVATLIAVYANW FARI+GCGWGWAG
Sbjct  756  SIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVATLIAVYANWAFARIEGCGWGWAG  815

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+S+V Y PLD++KFA RYILSGKAW+NLLENKTAF
Sbjct  816  VIWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAF  854



>ref|NP_001105470.1| plasma-membrane H+ATPase2 [Zea mays]
 emb|CAA59800.1| H(+)-transporting ATPase [Zea mays]
Length=948

 Score =   386 bits (992),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 204/219 (93%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIW+YDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW MH TDFFSDKFGVRSIR+S+ EMM+ALYLQV
Sbjct  702  DSWKLKEIFATGIVLGGYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF +AQLVATLIAVYANW FARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFVERPGLLLVTAF-VAQLVATLIAVYANWRFARIKGIGWGWAG  820

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYSIVFY PLD++KF  R++LSG+AW+NLL+ + AF
Sbjct  821  VVWLYSIVFYFPLDLLKFFIRFVLSGRAWDNLLDTRIAF  859



>ref|XP_010535850.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=881

 Score =   384 bits (987),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/219 (83%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  578  MKNYTIYAVSITIRIVLGFMLVALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVP  637

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL TV+FFW+ HDTDFFS  FGVRSIR ++EE+MAALYLQV
Sbjct  638  DSWKLKEIFATGVVLGTYMALATVLFFWLAHDTDFFSATFGVRSIRGNEEELMAALYLQV  697

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LL++AF++AQL+ATLIAVYA W FARI GCGWGWAG
Sbjct  698  SIISQALIFVTRSRSWSFVERPGLLLVIAFILAQLLATLIAVYAQWEFARIAGCGWGWAG  757

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV YVPLDI+KF  RY LSGKAW+N++ENKTAF
Sbjct  758  VIWLYSIVTYVPLDILKFIIRYSLSGKAWDNMIENKTAF  796



>dbj|BAJ34124.1| unnamed protein product [Thellungiella halophila]
Length=948

 Score =   386 bits (991),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLGGY A+MTVIFFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  702  DSWKLREIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQL+ATLIAVYANWGFA+++G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWGFAKVRGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y P DI KFA RYILSGKAW NL ENKTAF
Sbjct  822  VIWLYSIVTYFPQDIFKFAIRYILSGKAWLNLFENKTAF  860



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   386 bits (992),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY+ALMTV+FFW+M DT FFS+ F VR + +  E+MMAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYMALMTVVFFWLMKDTKFFSNTFNVRHLGDRPEQMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LLL AF++AQLVATLIAVYANW FARI+GCGWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVATLIAVYANWAFARIEGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+S+V Y PLD++KFA RYILSGKAW+NLLENKTAF
Sbjct  827  VIWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAF  865



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   386 bits (991),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVV G YLALMTVIFFW M +TDFFSDKF VRS+R S++EMM+ALYLQV
Sbjct  707  DSWKLKEIFATGVVFGSYLALMTVIFFWAMKETDFFSDKFKVRSLRQSEDEMMSALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR W F+ERPG+LL+ AF+IAQLVATLIAVYA+WGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRGWCFIERPGLLLVSAFIIAQLVATLIAVYADWGFARIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+VF+ PLD  KFA RYILSGKAW+NLLENKTAF
Sbjct  827  VIWLYSVVFFFPLDWFKFAIRYILSGKAWDNLLENKTAF  865



>dbj|BAF03589.1| P-type H+-ATPase [Zostera marina]
Length=964

 Score =   386 bits (992),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 187/230 (81%), Positives = 206/230 (90%), Gaps = 11/230 (5%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  646  MKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  705

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIR-----------NSD  328
            DSWKLKEIFATGVVLG Y+A+MTVIFFWIM +TDFFSDKFGVRS+R           +  
Sbjct  706  DSWKLKEIFATGVVLGSYMAIMTVIFFWIMRETDFFSDKFGVRSLRPPTNKNDPDYNDKR  765

Query  329  EEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFA  508
            +EMMAALYLQVSI+SQALIFVTRSRSWSFVERPG LLL+AF IAQLVATLIA YANWGFA
Sbjct  766  DEMMAALYLQVSIISQALIFVTRSRSWSFVERPGFLLLIAFCIAQLVATLIATYANWGFA  825

Query  509  RIQGCGWGWAGVIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            +I+G GWGWAGVIWLYSIV ++PLD++KFA RYILSGKAWNNL++NKTAF
Sbjct  826  KIKGIGWGWAGVIWLYSIVTFLPLDVLKFAIRYILSGKAWNNLIDNKTAF  875



>ref|XP_006412736.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
 gb|ESQ54189.1| hypothetical protein EUTSA_v10024335mg [Eutrema salsugineum]
Length=948

 Score =   386 bits (991),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLGGY A+MTVIFFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  702  DSWKLREIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQL+ATLIAVYANWGFA+++G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWGFAKVRGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y P DI KFA RYILSGKAW NL ENKTAF
Sbjct  822  VIWLYSIVTYFPQDIFKFAIRYILSGKAWLNLFENKTAF  860



>ref|NP_194748.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 sp|P19456.2|PMA2_ARATH RecName: Full=ATPase 2, plasma membrane-type; AltName: Full=Proton 
pump 2 [Arabidopsis thaliana]
 gb|AAA32751.1| H+-ATPase [Arabidopsis thaliana]
 emb|CAB52463.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 emb|CAB81012.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 gb|AAK59580.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AAN31920.1| putative H+-transporting ATPase type 2 [Arabidopsis thaliana]
 gb|AAN71968.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE85731.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=948

 Score =   386 bits (991),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY A+MTVIFFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  702  DSWKLKEIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQL+ATLIAVYANW FA+I+G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y PLD+ KFA RYILSGKAW NL ENKTAF
Sbjct  822  VIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAF  860



>ref|XP_010451109.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=918

 Score =   385 bits (989),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLGGY A+MTVIFFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  702  DSWKLREIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQL+ATLIAVYANW FA+I+G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWQFAKIRGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y PLD+ KFA RYILSGKAW NL ENKTAF
Sbjct  822  VIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAF  860



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   386 bits (991),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/219 (83%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFLLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATG+VLG YLA+MTV+FFW +H TDFF++KFGVRSIR+S+ EMMAALYLQV
Sbjct  702  DSWKLNEIFATGIVLGTYLAIMTVVFFWAIHKTDFFTEKFGVRSIRDSEHEMMAALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFL+AQLVATLIAVYANWGFARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFVERPGVLLVTAFLLAQLVATLIAVYANWGFARIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYS+V Y PLD+ KF  R+ LSG+AW+NLLENKTAF
Sbjct  822  VVWLYSVVLYFPLDVFKFLIRFALSGRAWDNLLENKTAF  860



>ref|XP_002523524.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF38863.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=747

 Score =   380 bits (977),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  442  MKNYTIYAVSITIRIVMGFMLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  501

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+A+MTVIFFW+ HDTDFF +KFGVR+IR+   E+ AALYLQV
Sbjct  502  DSWKLKEIFATGVVLGTYMAIMTVIFFWLAHDTDFFPEKFGVRTIRDEHAELTAALYLQV  561

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPG+LL+ AF+ AQL+AT+IAVYANWGFA+IQG GWGWAG
Sbjct  562  SIISQALIFVTRSRSWSFLERPGLLLVGAFIAAQLLATVIAVYANWGFAKIQGIGWGWAG  621

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSI+ Y+PLDI+KF  RY LSGKAW+NLL+NKTAF
Sbjct  622  VIWVYSIITYIPLDILKFMIRYALSGKAWDNLLQNKTAF  660



>ref|XP_009607951.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana tomentosiformis]
Length=954

 Score =   386 bits (991),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/219 (83%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKD+V PSP+P
Sbjct  648  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLG YLA+MTVIFFW  H ++FFSDKFGVRSIR++  E+ AALYLQV
Sbjct  708  DSWKLREIFATGIVLGTYLAVMTVIFFWAAHQSNFFSDKFGVRSIRDNVHELNAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LLL AF+IAQLVAT+IAVYANWGFARI G GWGWAG
Sbjct  768  SIVSQALIFVTRSRSWSYVERPGLLLLAAFVIAQLVATIIAVYANWGFARIHGIGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLDI+KFA RY LSG+AWNN++ENK AF
Sbjct  828  VIWLYSIIFYIPLDILKFAIRYTLSGRAWNNMMENKVAF  866



>ref|NP_178762.1| H(+)-ATPase 6 [Arabidopsis thaliana]
 sp|Q9SH76.1|PMA6_ARATH RecName: Full=ATPase 6, plasma membrane-type; AltName: Full=Proton 
pump 6 [Arabidopsis thaliana]
 gb|AAD32758.1| putative plasma membrane proton ATPase [Arabidopsis thaliana]
 gb|AEC06056.1| H(+)-ATPase 6 [Arabidopsis thaliana]
Length=949

 Score =   385 bits (990),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL+TV+FFW+ HDT FFSDKFGVRS++  DEE++A LYLQV
Sbjct  704  DSWKLKEIFATGVVLGTYMALVTVVFFWLAHDTTFFSDKFGVRSLQGKDEELIAVLYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL+AF +AQL+ATLIA YA+W FARI+GCGWGW G
Sbjct  764  SIISQALIFVTRSRSWSFVERPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCGWGWCG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y+PLDI+KF TRY LSGKAWNN++EN+TAF
Sbjct  824  VIWIYSIVTYIPLDILKFITRYTLSGKAWNNMIENRTAF  862



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   384 bits (986),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  583  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  642

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG YLA+MTV+FFWI + TDFFSDKFGV SIR +D E+ AA+YLQV
Sbjct  643  DSWKLREIFATGVVLGSYLAVMTVVFFWIANATDFFSDKFGVHSIRGNDGELTAAVYLQV  702

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            S VSQALIFVTRSRSWSFVERPG+LL+ AF +AQLVATLIAVYANWGFA ++G GWGWAG
Sbjct  703  STVSQALIFVTRSRSWSFVERPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAG  762

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS++FY+PLD++KFATRY LSGKAWNN+++N+TAF
Sbjct  763  VIWIYSVIFYIPLDVLKFATRYALSGKAWNNMIQNRTAF  801



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   385 bits (990),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+L+W++DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVFGFMFIALLWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPMP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+ALMTVIFFW++ DTDFFSDKFGVRS+RN+  EMMAALYLQV
Sbjct  704  DSWKLKEIFATGVVLGSYMALMTVIFFWLIKDTDFFSDKFGVRSLRNNPAEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS+VERPG LL+ AFLIAQLVAT +AVYANW FARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSYVERPGFLLMGAFLIAQLVATFLAVYANWSFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V YVPLDI+KFA  Y LSGKAWN LLENKTAF
Sbjct  824  VIWLYSLVTYVPLDILKFAIAYALSGKAWNTLLENKTAF  862



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   385 bits (990),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 205/219 (94%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLG YLALMTVIFFW M +TDFF DKFGVR +  + +EMM+ALYLQV
Sbjct  708  DSWKLQEIFATGIVLGSYLALMTVIFFWAMKETDFFPDKFGVRHL--THDEMMSALYLQV  765

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQL+AT+IAVYA+WGFA+++G GWGWAG
Sbjct  766  SIVSQALIFVTRSRSWSFIERPGLLLVFAFVIAQLIATIIAVYADWGFAKVKGIGWGWAG  825

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+VFY+PLD+MKFATRYILSGKAW N+LENKTAF
Sbjct  826  VIWLYSVVFYIPLDVMKFATRYILSGKAWVNMLENKTAF  864



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   385 bits (990),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 205/219 (94%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLG YLALMTVIFFW M +TDFF DKFGVR +  + +EMM+ALYLQV
Sbjct  708  DSWKLQEIFATGIVLGSYLALMTVIFFWAMKETDFFPDKFGVRHL--THDEMMSALYLQV  765

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQL+AT+IAVYA+WGFA+++G GWGWAG
Sbjct  766  SIVSQALIFVTRSRSWSFIERPGLLLVFAFVIAQLIATIIAVYADWGFAKVKGIGWGWAG  825

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+VFY+PLD+MKFATRYILSGKAW N+LENKTAF
Sbjct  826  VIWLYSVVFYIPLDVMKFATRYILSGKAWVNMLENKTAF  864



>ref|XP_010433017.1| PREDICTED: ATPase 2, plasma membrane-type [Camelina sativa]
Length=948

 Score =   385 bits (989),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLGGY A+MTVIFFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  702  DSWKLREIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQL+ATLIAVYANW FA+I+G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y PLD+ KFA RYILSGKAW NL ENKTAF
Sbjct  822  VIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAF  860



>ref|XP_010438207.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   385 bits (989),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLGGY A+MTVIFFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  702  DSWKLREIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQL+ATLIAVYANW FA+I+G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWQFAKIRGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y PLD+ KFA RYILSGKAW NL ENKTAF
Sbjct  822  VIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAF  860



>ref|NP_001190870.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 gb|AEE85732.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=981

 Score =   386 bits (991),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  675  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  734

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY A+MTVIFFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  735  DSWKLKEIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQV  794

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQL+ATLIAVYANW FA+I+G GWGWAG
Sbjct  795  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAG  854

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y PLD+ KFA RYILSGKAW NL ENKTAF
Sbjct  855  VIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAF  893



>emb|CDY14186.1| BnaA08g13170D [Brassica napus]
Length=939

 Score =   385 bits (988),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  633  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  692

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY A+MTV+FFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  693  DSWKLKEIFATGVVLGGYQAMMTVVFFWAAHKTDFFSDTFGVRSIRDNNNELMGAVYLQV  752

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL+VAFLIAQLVATLIAVYANW FA+++G GWGWAG
Sbjct  753  SIISQALIFVTRSRSWSFVERPGALLMVAFLIAQLVATLIAVYANWEFAKVRGIGWGWAG  812

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y P DI KFA RYILSGKAW NL ENKTAF
Sbjct  813  VIWLYSIVTYFPQDIFKFAIRYILSGKAWLNLFENKTAF  851



>ref|XP_009109000.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
Length=947

 Score =   385 bits (988),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 185/219 (84%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  641  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  700

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY A+MTV+FFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  701  DSWKLKEIFATGVVLGGYQAMMTVVFFWAAHKTDFFSDTFGVRSIRDNNNELMGAVYLQV  760

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL+VAFLIAQLVATLIAVYANW FA+++G GWGWAG
Sbjct  761  SIISQALIFVTRSRSWSFVERPGALLMVAFLIAQLVATLIAVYANWEFAKVRGIGWGWAG  820

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y P DI KFA RYILSGKAW NL ENKTAF
Sbjct  821  VIWLYSIVTYFPQDIFKFAIRYILSGKAWLNLFENKTAF  859



>ref|XP_010535849.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=948

 Score =   385 bits (988),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 181/219 (83%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVLGFMLVALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL TV+FFW+ HDTDFFS  FGVRSIR ++EE+MAALYLQV
Sbjct  705  DSWKLKEIFATGVVLGTYMALATVLFFWLAHDTDFFSATFGVRSIRGNEEELMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LL++AF++AQL+ATLIAVYA W FARI GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGLLLVIAFILAQLLATLIAVYAQWEFARIAGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV YVPLDI+KF  RY LSGKAW+N++ENKTAF
Sbjct  825  VIWLYSIVTYVPLDILKFIIRYSLSGKAWDNMIENKTAF  863



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   385 bits (988),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 187/219 (85%), Positives = 201/219 (92%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGYLALMTVIFFW + +  FF D FGVR + N DE+M +ALYLQV
Sbjct  707  DSWKLKEIFATGIVLGGYLALMTVIFFWAIEENKFFPDTFGVRKL-NHDEKM-SALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPGMLLL+AF IAQL+ATLIAVYANW FA++QG GWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSFVERPGMLLLIAFFIAQLIATLIAVYANWTFAKVQGIGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLD+MKFA RYILSGKAWNNLL+NKTAF
Sbjct  825  VIWLYSIVFYFPLDVMKFAIRYILSGKAWNNLLDNKTAF  863



>ref|XP_006282542.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
 gb|EOA15440.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
Length=948

 Score =   385 bits (988),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLGGY A+MTVIFFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  702  DSWKLREIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQL+ATLIAVYANW FA+I+G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y PLD+ KFA RYILSGKAW NL ENKTAF
Sbjct  822  VIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAF  860



>ref|XP_010526269.1| PREDICTED: ATPase 5, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=931

 Score =   384 bits (987),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  624  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  683

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIF+TG+VLGGYLALMTV+FFW M DTDFFS+KFGVR ++   E+M AALYLQV
Sbjct  684  DSWKLREIFSTGIVLGGYLALMTVVFFWAMKDTDFFSEKFGVRPLKEHPEQMNAALYLQV  743

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS+VERPG+LLL AF++AQL+AT IAVYANW FARIQG GWGWAG
Sbjct  744  SIISQALIFVTRSRSWSYVERPGLLLLGAFVVAQLIATFIAVYANWSFARIQGTGWGWAG  803

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS+V Y+PLD++KFA RY+LSG+AWNNLLENKTAF
Sbjct  804  VIWVYSVVTYIPLDLLKFAIRYVLSGRAWNNLLENKTAF  842



>ref|XP_010526268.1| PREDICTED: ATPase 5, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=956

 Score =   385 bits (988),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  649  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  708

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIF+TG+VLGGYLALMTV+FFW M DTDFFS+KFGVR ++   E+M AALYLQV
Sbjct  709  DSWKLREIFSTGIVLGGYLALMTVVFFWAMKDTDFFSEKFGVRPLKEHPEQMNAALYLQV  768

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS+VERPG+LLL AF++AQL+AT IAVYANW FARIQG GWGWAG
Sbjct  769  SIISQALIFVTRSRSWSYVERPGLLLLGAFVVAQLIATFIAVYANWSFARIQGTGWGWAG  828

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS+V Y+PLD++KFA RY+LSG+AWNNLLENKTAF
Sbjct  829  VIWVYSVVTYIPLDLLKFAIRYVLSGRAWNNLLENKTAF  867



>ref|XP_010033996.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Eucalyptus 
grandis]
Length=920

 Score =   384 bits (986),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+L++LIWKYDFS FMVLIIAILNDGTIM ISKDRV PSP+P
Sbjct  635  MKNYTIYAVSITIRIVLGFLLLALIWKYDFSPFMVLIIAILNDGTIMPISKDRVKPSPVP  694

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLA+MTV+FFW  H TDFFSDKFGVRSIRN+ +E+ AA+YLQV
Sbjct  695  DSWKLKEIFATGVVLGTYLAVMTVVFFWAAHKTDFFSDKFGVRSIRNNPDELTAAVYLQV  754

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS++ERPG+LL+ AF+ AQL+ATL+AVYANWGFARI G GWGWAG
Sbjct  755  SIVSQALIFVTRSRSWSYIERPGLLLMSAFVAAQLIATLLAVYANWGFARIHGIGWGWAG  814

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLDI+KF  RY LSG+AW+NLL+NKTAF
Sbjct  815  VIWLYSIIFYIPLDILKFIIRYALSGRAWDNLLQNKTAF  853



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   385 bits (988),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV  SPLP
Sbjct  647  MKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKASPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIF TG+VLG YLA+MTVIFFW M DTDFFSDKF VRS+RNS++EMMAALYLQV
Sbjct  707  DSWKLREIFTTGIVLGTYLAVMTVIFFWAMKDTDFFSDKFQVRSLRNSEDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSW FVERPG+LL+ AF++AQLVATLIAVYA+WGFARI+G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWFFVERPGLLLVTAFIVAQLVATLIAVYADWGFARIKGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+VF+ PLD+ KFA RYILSGKAW+NLLE KTAF
Sbjct  827  VIWLYSVVFFFPLDLFKFAIRYILSGKAWDNLLEKKTAF  865



>ref|XP_010033995.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=931

 Score =   384 bits (986),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+L++LIWKYDFS FMVLIIAILNDGTIM ISKDRV PSP+P
Sbjct  646  MKNYTIYAVSITIRIVLGFLLLALIWKYDFSPFMVLIIAILNDGTIMPISKDRVKPSPVP  705

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLA+MTV+FFW  H TDFFSDKFGVRSIRN+ +E+ AA+YLQV
Sbjct  706  DSWKLKEIFATGVVLGTYLAVMTVVFFWAAHKTDFFSDKFGVRSIRNNPDELTAAVYLQV  765

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS++ERPG+LL+ AF+ AQL+ATL+AVYANWGFARI G GWGWAG
Sbjct  766  SIVSQALIFVTRSRSWSYIERPGLLLMSAFVAAQLIATLLAVYANWGFARIHGIGWGWAG  825

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLDI+KF  RY LSG+AW+NLL+NKTAF
Sbjct  826  VIWLYSIIFYIPLDILKFIIRYALSGRAWDNLLQNKTAF  864



>ref|XP_010033994.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW53878.1| hypothetical protein EUGRSUZ_J03094 [Eucalyptus grandis]
Length=929

 Score =   384 bits (986),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+L++LIWKYDFS FMVLIIAILNDGTIM ISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVLGFLLLALIWKYDFSPFMVLIIAILNDGTIMPISKDRVKPSPVP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLA+MTV+FFW  H TDFFSDKFGVRSIRN+ +E+ AA+YLQV
Sbjct  704  DSWKLKEIFATGVVLGTYLAVMTVVFFWAAHKTDFFSDKFGVRSIRNNPDELTAAVYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS++ERPG+LL+ AF+ AQL+ATL+AVYANWGFARI G GWGWAG
Sbjct  764  SIVSQALIFVTRSRSWSYIERPGLLLMSAFVAAQLIATLLAVYANWGFARIHGIGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLDI+KF  RY LSG+AW+NLL+NKTAF
Sbjct  824  VIWLYSIIFYIPLDILKFIIRYALSGRAWDNLLQNKTAF  862



>gb|EMT26270.1| Plasma membrane ATPase [Aegilops tauschii]
Length=951

 Score =   384 bits (986),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG YLALMTV+FFW++H TDFF++KFGVRSIR+S+ EMM+ALYLQV
Sbjct  702  DSWKLNEIFATGVVLGTYLALMTVVFFWVIHKTDFFTNKFGVRSIRDSEFEMMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LL+ AFL+AQLVATLIAVYANW FARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFVERPGFLLVTAFLLAQLVATLIAVYANWEFARIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+SIVFY PLDI KF  R++LSG+AW+NLL+NKTAF
Sbjct  822  VIWLFSIVFYFPLDIFKFFIRFVLSGRAWDNLLQNKTAF  860



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   384 bits (986),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG YLA+MTV+FFWI + TDFFSDKFGV SIR +D E+ AA+YLQV
Sbjct  704  DSWKLREIFATGVVLGSYLAVMTVVFFWIANATDFFSDKFGVHSIRGNDGELTAAVYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            S VSQALIFVTRSRSWSFVERPG+LL+ AF +AQLVATLIAVYANWGFA ++G GWGWAG
Sbjct  764  STVSQALIFVTRSRSWSFVERPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS++FY+PLD++KFATRY LSGKAWNN+++N+TAF
Sbjct  824  VIWIYSVIFYIPLDVLKFATRYALSGKAWNNMIQNRTAF  862



>gb|KFK29576.1| h(+)-atpase 2 [Arabis alpina]
Length=948

 Score =   384 bits (986),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY A+MTVIFFW  H TDFFSD FGVRSIR+++ E+M A+YLQV
Sbjct  702  DSWKLKEIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AFLIAQL+ATLIAVYANW FA+I+G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWQFAKIRGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y P D+ KFA RYILSGKAW NL ENKTAF
Sbjct  822  VIWLYSIVTYFPQDVFKFAIRYILSGKAWLNLFENKTAF  860



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   384 bits (986),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG YLA+MTV+FFWI + TDFFSDKFGV SIR +D E+ AA+YLQV
Sbjct  704  DSWKLREIFATGVVLGSYLAVMTVVFFWIANATDFFSDKFGVHSIRGNDGELTAAVYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            S VSQALIFVTRSRSWSFVERPG+LL+ AF +AQLVATLIAVYANWGFA ++G GWGWAG
Sbjct  764  STVSQALIFVTRSRSWSFVERPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS++FY+PLD++KFATRY LSGKAWNN+++N+TAF
Sbjct  824  VIWIYSVIFYIPLDVLKFATRYALSGKAWNNMIQNRTAF  862



>ref|XP_002527322.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF35074.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=733

 Score =   378 bits (971),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  427  MKNYTIYAVSITIRIVMGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  486

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLA+MTV+FFW  + +DFFSD FGVRSIR +  E+ AA+YLQV
Sbjct  487  DSWKLKEIFATGVVLGTYLAIMTVVFFWAANSSDFFSDHFGVRSIRENHNELTAAIYLQV  546

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+LL+ AF+IAQL+ATL+AVYANW FA+I G GWGWAG
Sbjct  547  SIVSQALIFVTRSRSWSYVERPGLLLVAAFIIAQLIATLLAVYANWAFAKIHGIGWGWAG  606

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD++KFA RY LSGKAW+NL++NKTAF
Sbjct  607  VIWLYSIVFYIPLDVLKFAIRYALSGKAWDNLVQNKTAF  645



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   384 bits (985),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+ I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+ALMTV+FFW M DT+FFS+KFGVR + +S ++MMAALYLQV
Sbjct  704  DSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGVRPLSDSPDKMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL AF IAQLVAT IAVYANW FARI+G GWGWAG
Sbjct  764  SIISQALIFVTRSRSWSFVERPGLLLLGAFFIAQLVATFIAVYANWSFARIKGMGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLD++KFA RYILSGKAW+NLLENKTAF
Sbjct  824  VIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAF  862



>gb|KFK33846.1| hypothetical protein AALP_AA5G067500 [Arabis alpina]
Length=948

 Score =   384 bits (985),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVLGFMLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG Y+AL TV+FFW+ HDT FFS+ FGVRSI+  +EE+MAALYLQV
Sbjct  705  DSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTTFFSETFGVRSIQGKEEELMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AF++AQLVATLIAVYANWGFARIQGCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGFLLIIAFILAQLVATLIAVYANWGFARIQGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+ Y+PLDI+KFA RY L+GKAW+N+++ KTAF
Sbjct  825  VIWLYSIITYIPLDILKFAIRYALTGKAWDNMIQQKTAF  863



>dbj|BAF01699.1| plasma membrane ATPase 3 [Arabidopsis thaliana]
Length=397

 Score =   367 bits (942),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 194/219 (89%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  91   MKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPTP  150

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY+A+MTV+FFW  + TDFF   F VR +R S+ EMM+ALYLQV
Sbjct  151  DSWKLKEIFATGVVLGGYMAIMTVVFFWAAYKTDFFPRTFHVRDLRGSEHEMMSALYLQV  210

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF ERPG  LL+AF +AQL+AT IAVY NW FARI+G GWGWAG
Sbjct  211  SIVSQALIFVTRSRSWSFTERPGYFLLIAFWVAQLIATAIAVYGNWEFARIKGIGWGWAG  270

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLDIMKFA RYIL+G AW N+++N+TAF
Sbjct  271  VIWLYSIVFYFPLDIMKFAIRYILAGTAWKNIIDNRTAF  309



>ref|XP_006279406.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
 gb|EOA12304.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
Length=949

 Score =   383 bits (984),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL+TV+FFW+ HDT FFSDKFGVRS++  +EE++A LYLQV
Sbjct  704  DSWKLKEIFATGVVLGTYMALVTVVFFWLAHDTTFFSDKFGVRSLQGKNEELIAVLYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL+AF +AQL+ATLIA YA+W FARI+GCGWGW G
Sbjct  764  SIISQALIFVTRSRSWSFVERPGLLLLIAFFVAQLIATLIAAYAHWEFARIKGCGWGWCG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y+PLDI+KF TRY LSGKAWNN++EN+TAF
Sbjct  824  VIWIYSIVTYIPLDILKFITRYTLSGKAWNNMIENRTAF  862



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=954

 Score =   383 bits (984),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 205/219 (94%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIR+V GF+L++LIWK+DFS FMVLIIA+LNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRVVLGFLLLALIWKFDFSPFMVLIIAVLNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+A+MTV+FFW  +D++FFSDKFGVRSIR SD E+ AA+YLQV
Sbjct  707  DSWKLKEIFATGVVLGTYMAVMTVVFFWAANDSNFFSDKFGVRSIRGSDRELTAAVYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG++L++AFLIAQL+AT++AVYANWGFARI+G GWGWAG
Sbjct  767  SIISQALIFVTRSRSWSFVERPGVMLMIAFLIAQLLATILAVYANWGFARIKGMGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIV Y+PLDI+KF  RY LSGKAW+N+LENKTAF
Sbjct  827  VIWLYSIVTYIPLDILKFMIRYALSGKAWDNVLENKTAF  865



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   383 bits (984),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  649  MKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  708

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIF TG+VLGGYLA+MTVIFFW+  DT FF +KFGVR I ++ +E+ AALYLQV
Sbjct  709  DSWKLREIFVTGIVLGGYLAMMTVIFFWVAKDTKFFPNKFGVRDIHDNHDELTAALYLQV  768

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPGMLL+ AFL AQL+ATLIAVYANWGFARI G GWGWAG
Sbjct  769  SIVSQALIFVTRSRSWSYVERPGMLLMGAFLTAQLIATLIAVYANWGFARIHGIGWGWAG  828

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLD++KF  RY+LSGKAW NLLENKTAF
Sbjct  829  VIWLYSIIFYLPLDVIKFFIRYLLSGKAWQNLLENKTAF  867



>gb|AAN15220.1| plasma membrane P-type proton pump ATPase [Hordeum vulgare subsp. 
vulgare]
Length=956

 Score =   383 bits (983),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVLGFLLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG YLALMTV+FFWI+H TDFF++KFGVRSIR ++ E M+ALYLQV
Sbjct  707  DSWKLNEIFATGVVLGTYLALMTVVFFWIIHRTDFFTNKFGVRSIRENETEKMSALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LL++AFL+AQLVATLIAVYANWGFARI G GWGWAG
Sbjct  767  SIVSQALIFVTRSRSWSFVERPGFLLVIAFLLAQLVATLIAVYANWGFARISGIGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+SIVFY PLDI KF  R++LSG+AW+NLL+NKTAF
Sbjct  827  VIWLFSIVFYFPLDIFKFFIRFVLSGRAWDNLLQNKTAF  865



>ref|XP_006396088.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
 gb|ESQ36867.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
Length=949

 Score =   382 bits (982),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL+TV+FFW+ HDT+FFSDKFGVRS++  +EE++A LYLQV
Sbjct  704  DSWKLKEIFATGVVLGTYMALITVVFFWLAHDTNFFSDKFGVRSLQGKNEELIAVLYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL+AFL AQL+ATL+A YA+W FARI+GCGWGW G
Sbjct  764  SIISQALIFVTRSRSWSFVERPGVLLLIAFLSAQLIATLLAAYAHWEFARIKGCGWGWCG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+W+YSI+ Y+PLDI+KF TRY LSGKAWNN++EN+TAF
Sbjct  824  VVWIYSIITYIPLDILKFITRYTLSGKAWNNMIENRTAF  862



>ref|XP_003580730.1| PREDICTED: plasma membrane ATPase [Brachypodium distachyon]
Length=951

 Score =   382 bits (982),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG YLALMTV+FFW +H TDFF++KFGVRSIRNS+ E+M+ALYLQV
Sbjct  702  DSWKLNEIFATGVVLGTYLALMTVVFFWAIHKTDFFTNKFGVRSIRNSEFELMSALYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LL+ AFL+AQLVATLIAVYANW FARI+G GWGWAG
Sbjct  762  SIVSQALIFVTRSRSWSFVERPGFLLVTAFLLAQLVATLIAVYANWEFARIKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWL+SIVFY PLD+ KF  R++LSG+AW+NLL+NKTAF
Sbjct  822  VIWLFSIVFYFPLDVFKFFIRFVLSGRAWDNLLQNKTAF  860



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   382 bits (982),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  646  MKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  705

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLA+MTV+FFW+ H +DFF++KFGVRSIR + +E+ AA+YLQV
Sbjct  706  DSWKLKEIFATGVVLGAYLAIMTVVFFWVAHSSDFFTEKFGVRSIRENHDELTAAVYLQV  765

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AFLIAQL+AT+IAVY +W FARIQG GWGWAG
Sbjct  766  SIVSQALIFVTRSRSWSFVERPGLLLVTAFLIAQLIATIIAVYGDWKFARIQGIGWGWAG  825

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLD++KF  RY LSGKAW+NL++N+TAF
Sbjct  826  VIWLYSIVFYVPLDVLKFIIRYALSGKAWDNLVQNRTAF  864



>gb|KDO67283.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
 gb|KDO67284.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=883

 Score =   380 bits (977),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 181/216 (84%), Positives = 196/216 (91%), Gaps = 0/216 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLA+MTV+FFW+M  TDFFSD FGVRS+R   +EMMAALYLQV
Sbjct  707  DSWKLKEIFATGVVLGSYLAIMTVVFFWLMRKTDFFSDAFGVRSLRTRPDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPG+LL  AF+IAQLVAT IAVYANW FARI+GCGWGWAG
Sbjct  767  SIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVATFIAVYANWSFARIEGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENK  649
            VIWLYS+V Y PLDI+KF  RYILSGKAW+ LLENK
Sbjct  827  VIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENK  862



>ref|XP_010496144.1| PREDICTED: ATPase 6, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   382 bits (981),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL+TV+FFW+ HDT FF DKFGVRS++  +EE++A LYLQV
Sbjct  704  DSWKLKEIFATGVVLGTYMALVTVVFFWLAHDTTFFPDKFGVRSLQGKNEELIAVLYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL+AF +AQL+ATLIA YA+W FARI+GCGWGW G
Sbjct  764  SIISQALIFVTRSRSWSFVERPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCGWGWCG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y+PLDI+KF TRY LSGKAWNN++EN+TAF
Sbjct  824  VIWIYSIVTYIPLDILKFITRYTLSGKAWNNMIENRTAF  862



>ref|XP_010488815.1| PREDICTED: ATPase 6, plasma membrane-type [Camelina sativa]
Length=949

 Score =   382 bits (981),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL+TV+FFW+ HDT FF DKFGVRS++  +EE++A LYLQV
Sbjct  704  DSWKLKEIFATGVVLGTYMALVTVVFFWLAHDTTFFPDKFGVRSLQGKNEELIAVLYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL+AF +AQL+ATLIA YA+W FARI+GCGWGW G
Sbjct  764  SIISQALIFVTRSRSWSFVERPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCGWGWCG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y+PLDI+KF TRY LSGKAWNN++EN+TAF
Sbjct  824  VIWIYSIVTYIPLDILKFITRYTLSGKAWNNMIENRTAF  862



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =   382 bits (980),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 203/219 (93%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG YLALMT+IFFW M +TDFF +KFGVR + +  +EMM+ALYLQV
Sbjct  708  DSWKLQEIFATGVVLGSYLALMTIIFFWAMKETDFFPEKFGVRHLNH--DEMMSALYLQV  765

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPGMLL++AF+IAQ++AT+IAVYA+W FA+++G GWGWAG
Sbjct  766  SIVSQALIFVTRSRSWSFVERPGMLLIIAFMIAQMIATIIAVYADWSFAKVKGIGWGWAG  825

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY PLD+MKFA RYILSGKAW NLLENKTAF
Sbjct  826  VIWLYSIVFYFPLDLMKFAIRYILSGKAWVNLLENKTAF  864



>emb|CDX93092.1| BnaA03g38140D [Brassica napus]
Length=949

 Score =   381 bits (978),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL+TV+FFW+ HDTDFF  KFGVRS++   EE++A LYLQV
Sbjct  704  DSWKLKEIFATGVVLGTYMALITVLFFWLAHDTDFFPQKFGVRSLKGQPEELIAVLYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LLL+AFLIAQL ATLIA YA+W FARI+GCGWGW G
Sbjct  764  SIISQALIFVTRSRSWSFVERPGFLLLIAFLIAQLAATLIAAYAHWEFARIKGCGWGWCG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSI+ Y+PLD++KF TRYIL+GKAWNN++EN+TAF
Sbjct  824  VIWIYSIITYIPLDVLKFITRYILTGKAWNNMIENRTAF  862



>gb|KGN60167.1| hypothetical protein Csa_3G881800 [Cucumis sativus]
Length=657

 Score =   373 bits (957),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGF+LI+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  349  MKNYTIYAVSITIRIVFGFLLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLP  408

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            D+WKLKEIFATG+VLGGYLALMTV+FFWIM DTDFF+  F V S+RN++++MMAALYLQV
Sbjct  409  DNWKLKEIFATGIVLGGYLALMTVLFFWIMKDTDFFTSIFCVPSLRNNNQKMMAALYLQV  468

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LL+ AF++AQL+AT+IAVYA W FARI G GWGWA 
Sbjct  469  SIVSQALIFVTRSRSWSFVERPGFLLVFAFIMAQLIATVIAVYAKWSFARIHGAGWGWAA  528

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS++ Y+PLDI+KF  RY LSG+AWNNL++NKTAF
Sbjct  529  VIWLYSLITYIPLDILKFTIRYALSGRAWNNLVQNKTAF  567



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =   381 bits (979),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 188/250 (75%), Positives = 206/250 (82%), Gaps = 31/250 (12%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIW+YDFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  642  MKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFS-----------------------  292
            DSWKLKEIFATG+VLG YLALMTVIFFW MH TDFFS                       
Sbjct  702  DSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSVKKYPPLAICIVWILFSLYGCSH  761

Query  293  --------DKFGVRSIRNSDEEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGMLLLVA  448
                    DKFGVRSIR+S+ EMM+ALYLQVSIVSQALIFVTRSRSWSFVERPG+LL+ A
Sbjct  762  YTSRVIAQDKFGVRSIRDSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTA  821

Query  449  FLIAQLVATLIAVYANWGFARIQGCGWGWAGVIWLYSIVFYVPLDIMKFATRYILSGKAW  628
            FL+AQLVAT +AVYANWGFARI+G GWGWAGV+WLYSIVFY PLD++KF  R++LSG+AW
Sbjct  822  FLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLSGRAW  881

Query  629  NNLLENKTAF  658
            +NLLENKTAF
Sbjct  882  DNLLENKTAF  891



>ref|XP_009128205.1| PREDICTED: ATPase 8, plasma membrane-type [Brassica rapa]
Length=948

 Score =   380 bits (976),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVLGFMLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG Y+AL TV+FFW+ HDT+FFS  FGVRSI+ ++EE+MAALYLQV
Sbjct  705  DSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTNFFSKTFGVRSIQENEEELMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LLL+AF+IAQLVATLIAVYANWGFARI GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGFLLLIAFVIAQLVATLIAVYANWGFARILGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+ Y+PLDI+KF  RY L+GKAW+N+++ KTAF
Sbjct  825  VIWLYSIITYIPLDILKFTIRYSLTGKAWDNMIQQKTAF  863



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   380 bits (976),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 199/219 (91%), Gaps = 1/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  650  MKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  709

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY+ALMTVIFFW M DT FF  KFGVR I +S  EM AALYLQV
Sbjct  710  DSWKLKEIFATGIVLGGYMALMTVIFFWAMKDTTFFPRKFGVRPIHDSPYEMTAALYLQV  769

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            S VSQALIFVTRSRSWSFVERPGMLL+ AF+IAQL+AT+IAVYANWGFA+IQG GWGWAG
Sbjct  770  STVSQALIFVTRSRSWSFVERPGMLLMGAFVIAQLIATIIAVYANWGFAKIQGVGWGWAG  829

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+VFY PLD++KFA RY+LSGKAW N +ENKTAF
Sbjct  830  VIWLYSVVFYFPLDLLKFAIRYVLSGKAWVN-IENKTAF  867



>ref|XP_010520558.1| PREDICTED: ATPase 8, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   380 bits (975),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVLGFMLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL TV+FFW+   TDFFS+KFGVRSI+  +EE+MAALYLQV
Sbjct  705  DSWKLKEIFATGVVLGTYMALTTVLFFWLAQSTDFFSNKFGVRSIQGKEEELMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LLL AF+IAQLVAT+IAVYA+W FARI+GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGLLLLGAFIIAQLVATVIAVYAHWEFARIEGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW YSIV Y+PLDI+KF  RY LSGKAW+N++ENKTAF
Sbjct  825  VIWAYSIVTYIPLDILKFIIRYSLSGKAWDNMIENKTAF  863



>gb|KFK27283.1| h(+)-atpase 3 [Arabis alpina]
Length=951

 Score =   380 bits (975),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 181/219 (83%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  645  MKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPTP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY+ALMTVIFFW  + TD+F   F V+ +R S+ EMM+ALYLQV
Sbjct  705  DSWKLKEIFATGVVLGGYMALMTVIFFWAAYKTDYFPRTFHVKDLRGSEHEMMSALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG LLL+AF IAQ +ATLIAVY+NW FARIQG GWGWAG
Sbjct  765  SIVSQALIFVTRSRSWSFVERPGTLLLIAFAIAQSIATLIAVYSNWEFARIQGIGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS +FY+PLDIMKFA RYIL+G AWNNL++NKTAF
Sbjct  825  VIWLYSFIFYIPLDIMKFAIRYILTGNAWNNLIDNKTAF  863



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =   380 bits (975),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+L++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  639  MKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVP  698

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFA GVVLG YLA++TV+FFW+ H TDFFSDKFGVRSIR   +E+ AALYLQV
Sbjct  699  DSWKLKEIFAMGVVLGTYLAIITVLFFWLAHGTDFFSDKFGVRSIRGKPDELTAALYLQV  758

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF ERPG+LL+ AFL AQLVAT+IAVYANWGFARIQG GWGWAG
Sbjct  759  SIISQALIFVTRSRSWSFTERPGLLLVGAFLAAQLVATVIAVYANWGFARIQGIGWGWAG  818

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            +IW++SI+ Y+PLDI+KF TRY L+GKAW+NLLENKTAF
Sbjct  819  IIWIFSIITYIPLDILKFITRYALTGKAWDNLLENKTAF  857



>ref|XP_009136182.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 6, plasma membrane-type 
[Brassica rapa]
Length=980

 Score =   380 bits (977),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  675  MKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  734

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL+TV+FFW+ HDTDFF  KFGVRS++   EE++A LYLQV
Sbjct  735  DSWKLKEIFATGVVLGTYMALITVLFFWLAHDTDFFPQKFGVRSLKGQPEELIAVLYLQV  794

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LLL+AFLIAQL ATLIA YA+W FARI+GCGWGW G
Sbjct  795  SIISQALIFVTRSRSWSFVERPGFLLLIAFLIAQLAATLIAAYAHWEFARIKGCGWGWCG  854

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSI+ Y+PLD++KF TRYIL+GKAWNN++EN+TAF
Sbjct  855  VIWIYSIITYIPLDVLKFITRYILTGKAWNNMIENRTAF  893



>emb|CDY50939.1| BnaC03g74390D [Brassica napus]
Length=949

 Score =   380 bits (975),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATGVVLG Y+AL+TV+FFW+ HDTDFF  KFGVRS++   EE++A LYLQV
Sbjct  704  DSWKLREIFATGVVLGTYMALITVLFFWLAHDTDFFPQKFGVRSLKGQPEELIAVLYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LLL+AFLIAQL ATLIA YA+W FARI+GCGWGW G
Sbjct  764  SIISQALIFVTRSRSWSFVERPGFLLLIAFLIAQLAATLIAAYAHWEFARIKGCGWGWCG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSI+ Y+PLD++KF TRYIL+GKAWNN++EN+TAF
Sbjct  824  VIWIYSIITYIPLDVLKFITRYILTGKAWNNMIENRTAF  862



>gb|ABA18090.1| putative plasma membrane ATPase [Olimarabidopsis pumila]
Length=948

 Score =   379 bits (974),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVLGFMLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG Y+AL TV+FFW+ HDTDFFS  FGVRSI+ ++EE+MAALYLQV
Sbjct  705  DSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTDFFSKTFGVRSIQGNEEELMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AF+IAQLVATLIAVYANWGFARI GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGFLLMIAFVIAQLVATLIAVYANWGFARIIGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSI+ Y+PLDI+KF  RY L+GKAW+N+++ KTAF
Sbjct  825  VIWVYSIITYIPLDILKFIIRYALTGKAWDNMIQQKTAF  863



>ref|XP_006341374.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Solanum tuberosum]
Length=992

 Score =   380 bits (977),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKD+V PSP+P
Sbjct  686  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMP  745

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLG YLA+MTVIFFW+ H ++FFSDKFGVRSIR++  E+ AALYLQV
Sbjct  746  DSWKLREIFATGIVLGTYLAVMTVIFFWLAHQSNFFSDKFGVRSIRDNVHELNAALYLQV  805

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG LLL AF +AQLVAT+IAVYANWGFARI G GWGWAG
Sbjct  806  SIVSQALIFVTRSRSWSYVERPGFLLLAAFFVAQLVATIIAVYANWGFARIHGIGWGWAG  865

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLD +KFA RYILSG+AWN+++ENK AF
Sbjct  866  VIWLYSIIFYIPLDFLKFAIRYILSGRAWNSMIENKVAF  904



>gb|KFK39922.1| hypothetical protein AALP_AA3G306500 [Arabis alpina]
Length=949

 Score =   379 bits (974),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG Y+AL+TV+FFW+ HDT FFSDKFGVRS++  +EE++A LYLQV
Sbjct  704  DSWKLKEIFATGVVLGTYMALITVVFFWLAHDTTFFSDKFGVRSLQGKNEELIAVLYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            S++SQALIFVTRSRSWSF+ERPG LLL+AFLIAQL+AT+IA YA+W FARI+GCGWGW G
Sbjct  764  SVISQALIFVTRSRSWSFLERPGFLLLIAFLIAQLIATIIAAYAHWEFARIKGCGWGWCG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+W+YS++ Y+PLDI+KF TRY LSGKAWNN++EN+TAF
Sbjct  824  VVWVYSLITYIPLDILKFITRYTLSGKAWNNMIENRTAF  862



>ref|XP_010533093.1| PREDICTED: ATPase 6, plasma membrane-type [Tarenaya hassleriana]
Length=949

 Score =   379 bits (974),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+L++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  644  MKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLG YLAL TV+FFW+ HDTDFF+DKFGVRS++  +EEMMAALYLQV
Sbjct  704  DSWKLKEIFATGVVLGTYLALATVLFFWLAHDTDFFADKFGVRSLQGKEEEMMAALYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS++ERPG+LL+ AFL+AQL+AT++A YANW FARI+GCGWGW+G
Sbjct  764  SIISQALIFVTRSRSWSYIERPGLLLVAAFLVAQLIATVLATYANWEFARIKGCGWGWSG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            V+WLYS V Y+PLD++KF  RY LSGKAW+N++EN+ AF
Sbjct  824  VVWLYSFVTYIPLDVLKFIIRYSLSGKAWDNMIENRIAF  862



>gb|KFK40274.1| hypothetical protein AALP_AA3G353600 [Arabis alpina]
Length=949

 Score =   379 bits (974),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGVVLGGY A+M+VIFFW  H TDFFSDKFGVRSIR++++E+M A+YLQV
Sbjct  702  DSWKLKEIFATGVVLGGYQAVMSVIFFWAAHKTDFFSDKFGVRSIRDNNDELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AF+IAQLVATLIAVYANW FA+++G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFVIAQLVATLIAVYANWTFAKVKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y P D++KFA RYILSGKAW +L +N+TAF
Sbjct  822  VIWIYSIVTYFPQDLLKFAIRYILSGKAWVSLFDNRTAF  860



>ref|XP_006465284.1| PREDICTED: ATPase 9, plasma membrane-type-like [Citrus sinensis]
Length=962

 Score =   380 bits (975),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  655  MKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVP  714

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            D+WKLKEIFATG+VLG YLA+MTV+FFW +H + FFS+KFGVRSIR+S  E+ AA+YLQV
Sbjct  715  DTWKLKEIFATGIVLGTYLAVMTVLFFWAIHSSTFFSEKFGVRSIRDSPHELTAAVYLQV  774

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQLVATLIAVYAN+GFARI G GWGWAG
Sbjct  775  SIVSQALIFVTRSRSWSFLERPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIGWGWAG  834

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD++KF  RY L+GKAW+NLLENKTAF
Sbjct  835  VIWLYSIVFYIPLDVLKFIVRYALTGKAWDNLLENKTAF  873



>ref|XP_010425792.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
 ref|XP_010425793.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
 ref|XP_010425794.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   379 bits (974),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVLGFMLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG Y+AL TV+FFW+ HDTDFFS  FGVRSI+ ++EE+MAALYLQV
Sbjct  705  DSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTDFFSRTFGVRSIQGNEEELMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AF+IAQLVATLIAVYANWGFARI GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGFLLIIAFIIAQLVATLIAVYANWGFARIIGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSI+ Y+PLDI+KF  RY L+GKAW+N+++ KTAF
Sbjct  825  VIWVYSIITYIPLDILKFIIRYALTGKAWDNMIQQKTAF  863



>ref|XP_010514696.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514698.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514699.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
 ref|XP_010514700.1| PREDICTED: ATPase 8, plasma membrane-type [Camelina sativa]
Length=948

 Score =   379 bits (973),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVLGFMLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG Y+AL TV+FFW+ HDTDFFS  FGVRSI+ ++EE+MAALYLQV
Sbjct  705  DSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTDFFSRTFGVRSIQGNEEELMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AF+IAQLVATLIAVYANWGFARI GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGFLLIIAFIIAQLVATLIAVYANWGFARIIGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSI+ Y+PLDI+KF  RY L+GKAW+N+++ KTAF
Sbjct  825  VIWVYSIITYIPLDILKFIIRYALTGKAWDNMIQQKTAF  863



>ref|NP_179486.1| H(+)-ATPase 1 [Arabidopsis thaliana]
 sp|P20649.3|PMA1_ARATH RecName: Full=ATPase 1, plasma membrane-type; AltName: Full=Proton 
pump 1 [Arabidopsis thaliana]
 gb|AAC09030.1| plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AAP40498.1| putative plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AEC06832.1| H(+)-ATPase 1 [Arabidopsis thaliana]
Length=949

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY A+M+VIFFW  H TDFFSDKFGVRSIR++++E+M A+YLQV
Sbjct  702  DSWKLKEIFATGIVLGGYQAIMSVIFFWAAHKTDFFSDKFGVRSIRDNNDELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AF+IAQLVATLIAVYA+W FA+++G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFVIAQLVATLIAVYADWTFAKVKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y P DI+KFA RYILSGKAW +L +N+TAF
Sbjct  822  VIWIYSIVTYFPQDILKFAIRYILSGKAWASLFDNRTAF  860



>ref|XP_002886251.1| hypothetical protein ARALYDRAFT_480836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62510.1| hypothetical protein ARALYDRAFT_480836 [Arabidopsis lyrata subsp. 
lyrata]
Length=949

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY A+M+VIFFW  H TDFFSDKFGVRSIR++++E+M A+YLQV
Sbjct  702  DSWKLKEIFATGIVLGGYQAIMSVIFFWAAHKTDFFSDKFGVRSIRDNNDELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL+VAF++AQLVAT+IAVYA+W FA+++G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMVAFVVAQLVATMIAVYADWTFAKVKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y P DI+KFA RYILSGKAW +L +N+TAF
Sbjct  822  VIWIYSIVTYFPQDILKFAIRYILSGKAWTSLFDNRTAF  860



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   379 bits (973),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/219 (83%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIW++DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  650  MKNYTIYAVSITIRIVFGFMFIALIWEFDFAPFMVLIIAILNDGTIMTISKDRVKPSPTP  709

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLGGYLALMTVIFFW  ++TDFF   F VR +R  + EMMAALYLQV
Sbjct  710  DSWKLREIFATGIVLGGYLALMTVIFFWAAYETDFFPKTFSVRDLRGREHEMMAALYLQV  769

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG LL++AF++AQLVATLIAVYANW FARI+G GWGWAG
Sbjct  770  SIVSQALIFVTRSRSWSYVERPGTLLVIAFILAQLVATLIAVYANWSFARIKGIGWGWAG  829

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLD+MKFA RYILSGKAW +LL+NKTAF
Sbjct  830  VIWLYSIVFYVPLDLMKFAIRYILSGKAWLSLLDNKTAF  868



>ref|XP_010539422.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Tarenaya hassleriana]
Length=885

 Score =   377 bits (968),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM ++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  578  MKNYTIYAVSITIRIVFGFMFVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPTP  637

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLGGY+ALMTVIFFW  ++TD F   FGVR +R  + EMMAALYLQV
Sbjct  638  DSWKLNEIFATGVVLGGYMALMTVIFFWGAYETDVFPRMFGVRDLRGREHEMMAALYLQV  697

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF++AQLVAT+IAVYANW FARI+G GWGWAG
Sbjct  698  SIVSQALIFVTRSRSWSFVERPGLLLVTAFILAQLVATVIAVYANWSFARIKGIGWGWAG  757

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLD+MKF  RY+LSGKAW NL++NKTAF
Sbjct  758  VIWLYSIVFYVPLDVMKFGIRYVLSGKAWVNLIDNKTAF  796



>ref|XP_010489446.1| PREDICTED: ATPase 1, plasma membrane-type [Camelina sativa]
Length=949

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY A+M+VIFFW  H TDFFSDKFGVRSIR++++E+M A+YLQV
Sbjct  702  DSWKLKEIFATGIVLGGYQAIMSVIFFWAAHKTDFFSDKFGVRSIRDNNDELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AF+IAQLVATLIAVYA+W FA+++G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFVIAQLVATLIAVYADWTFAKVKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y P D++KFA RYILSGKAW +L +N+TAF
Sbjct  822  VIWIYSIVTYFPQDLLKFAIRYILSGKAWTSLFDNRTAF  860



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   378 bits (971),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  644  MKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  703

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL+EIFATG+VLG YLA+MTV+FFWI + TDFF+DKFGV SIR S  E+ AA+YLQV
Sbjct  704  DSWKLREIFATGIVLGSYLAVMTVVFFWIANATDFFTDKFGVHSIRGSGGELTAAVYLQV  763

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            S VSQALIFVTRSRSWSF+ERPG+LL+ AF +AQLVATLIAVYANWGFA ++G GWGWAG
Sbjct  764  STVSQALIFVTRSRSWSFIERPGLLLVFAFFVAQLVATLIAVYANWGFADMKGIGWGWAG  823

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YS+VFY+PLD++KFATRY LSGKAWNN+++N+TAF
Sbjct  824  VIWIYSVVFYIPLDVLKFATRYALSGKAWNNMIQNRTAF  862



>ref|XP_010414918.1| PREDICTED: ATPase 1, plasma membrane-type-like isoform X2 [Camelina 
sativa]
Length=949

 Score =   378 bits (971),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 203/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY A+M+VIFFW  H TDFFSDKFGVRSIR++++E+M A+YLQV
Sbjct  702  DSWKLKEIFATGIVLGGYQAIMSVIFFWAAHKTDFFSDKFGVRSIRDNNDELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AF+IAQLVATLIAVYA+W FA+++G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFVIAQLVATLIAVYADWTFAKVKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y P D++KFA RYILSGKAW +L +N+TAF
Sbjct  822  VIWIYSIVTYFPQDLLKFAIRYILSGKAWTSLFDNRTAF  860



>ref|XP_011002373.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=944

 Score =   378 bits (971),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+L++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  639  MKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVP  698

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFA GVVLG YLA++TV+FFW+ H TDFFSDKFG RSIR   +E+ AALYLQV
Sbjct  699  DSWKLKEIFAMGVVLGTYLAIITVLFFWLAHGTDFFSDKFGARSIRGKPDELTAALYLQV  758

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF ERPG+LL+ AFL AQLVAT+IAVYANWGFARIQG GWGWAG
Sbjct  759  SIISQALIFVTRSRSWSFTERPGLLLVGAFLAAQLVATVIAVYANWGFARIQGIGWGWAG  818

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            +IW++SI+ Y+PLDI+KF TRY L+GKAW+NLLENKTAF
Sbjct  819  IIWIFSIITYIPLDILKFITRYALTGKAWDNLLENKTAF  857



>gb|KEH39623.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =   378 bits (971),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  642  MKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLA+MTV+FFW  H +DFF++KFGV SIR + EE+ AA+YLQV
Sbjct  702  DSWKLKEIFATGIVLGAYLAVMTVVFFWAAHASDFFTEKFGVHSIRENHEELTAAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            S VSQALIFVTRSRSWSFVERPG+LL+VAFLIAQL+ATLIAVYANW FA ++G GWGWAG
Sbjct  762  STVSQALIFVTRSRSWSFVERPGILLMVAFLIAQLIATLIAVYANWEFASMKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLD++KF  RY LSGKAWNN+ EN+TAF
Sbjct  822  VIWLYSIIFYIPLDVLKFVIRYALSGKAWNNITENRTAF  860



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   378 bits (970),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 183/219 (84%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+V G YLALMTVIFFW M DT FFSD F VRS+++S++EMMAALYLQV
Sbjct  707  DSWKLKEIFATGIVFGSYLALMTVIFFWAMKDTHFFSDIFKVRSLKDSEDEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSW FVERPG+LL+ AF+IAQLVAT+IAVYA+WGFARI+G GW WAG
Sbjct  767  SIVSQALIFVTRSRSWCFVERPGLLLVSAFIIAQLVATVIAVYADWGFARIKGIGWRWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIVF+ PLD  KFA RYILSGKAW+NLL+NKTAF
Sbjct  827  VIWIYSIVFFFPLDWFKFAIRYILSGKAWDNLLQNKTAF  865



>ref|XP_002875581.1| hypothetical protein ARALYDRAFT_323063 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51840.1| hypothetical protein ARALYDRAFT_323063 [Arabidopsis lyrata subsp. 
lyrata]
Length=948

 Score =   378 bits (970),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVLGFMLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG Y+AL TV+FFW+ HDT+FFS  FGVRSI+ ++EE+MAALYLQV
Sbjct  705  DSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTNFFSKTFGVRSIQGNEEELMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LLL+AF+IAQLVATLIAVYANWGFARI GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGFLLLIAFVIAQLVATLIAVYANWGFARIVGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSI+ Y+PLDI+KF  RY L+GKAW+N++  KTAF
Sbjct  825  VIWVYSIITYIPLDILKFIIRYALTGKAWDNMINQKTAF  863



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   378 bits (970),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIF TG+VLGGYLALMTV+FFW + DT+FFS+KF V+S+++S EE+MAALYLQV
Sbjct  708  DSWKLKEIFGTGIVLGGYLALMTVLFFWAVKDTNFFSEKFNVKSLKDSPEELMAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS++ERPG+LL+ AF+IAQLVAT+IAVYANWGFARI+G GWGWAG
Sbjct  768  SIISQALIFVTRSRSWSYMERPGLLLVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLDI+KF  RY  SGKAW+ LLENKTAF
Sbjct  828  VIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAF  866



>ref|XP_006279360.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
 gb|ABA18104.1| putative plasma membrane ATPase [Capsella rubella]
 gb|EOA12258.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
Length=948

 Score =   378 bits (970),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIW++DF+ FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  645  MKNYTIYAVSITIRIVLGFMLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVP  704

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLG Y+AL TV+FFW+ HDT+FFS  FGVRSI+ ++EE+MAALYLQV
Sbjct  705  DSWKLNEIFATGVVLGTYMALTTVLFFWLAHDTNFFSKTFGVRSIQGNEEELMAALYLQV  764

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AF+IAQLVATLIAVYANWGFARI GCGWGWAG
Sbjct  765  SIISQALIFVTRSRSWSFVERPGFLLIIAFIIAQLVATLIAVYANWGFARIIGCGWGWAG  824

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSI+ Y+PLDI+KF  RY L+GKAW+N+++ KTAF
Sbjct  825  VIWIYSIITYIPLDILKFIIRYALTGKAWDNMIQQKTAF  863



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   378 bits (970),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 180/219 (82%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM ++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  643  MKNYTIYAVSITIRIVFGFMFVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPTP  702

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATGVVLGGY+ALMTVIFFW  ++TD F   FGVR +R  + EMMAALYLQV
Sbjct  703  DSWKLNEIFATGVVLGGYMALMTVIFFWGAYETDVFPRMFGVRDLRGREHEMMAALYLQV  762

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSFVERPG+LL+ AF++AQLVAT+IAVYANW FARI+G GWGWAG
Sbjct  763  SIVSQALIFVTRSRSWSFVERPGLLLVTAFILAQLVATVIAVYANWSFARIKGIGWGWAG  822

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFYVPLD+MKF  RY+LSGKAW NL++NKTAF
Sbjct  823  VIWLYSIVFYVPLDVMKFGIRYVLSGKAWVNLIDNKTAF  861



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   378 bits (970),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFM I+LIWK+DF+ FMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  648  MKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQP  707

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIF TG+VLGGYLALMTV+FFW + DT+FFS+KF V+S+++S EE+MAALYLQV
Sbjct  708  DSWKLKEIFGTGIVLGGYLALMTVLFFWAVKDTNFFSEKFNVKSLKDSPEELMAALYLQV  767

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWS++ERPG+LL+ AF+IAQLVAT+IAVYANWGFARI+G GWGWAG
Sbjct  768  SIISQALIFVTRSRSWSYMERPGLLLVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAG  827

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYS+V Y+PLDI+KF  RY  SGKAW+ LLENKTAF
Sbjct  828  VIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAF  866



>ref|XP_006296920.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
 gb|EOA29818.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
Length=949

 Score =   377 bits (969),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY A+M+V+FFW  H TDFF+DKFGVRSIR++++E+M A+YLQV
Sbjct  702  DSWKLKEIFATGIVLGGYQAIMSVVFFWAAHKTDFFTDKFGVRSIRDNNDELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG+LL+VAF+IAQLVATLIAVYA+W FA+++G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGVLLMVAFVIAQLVATLIAVYADWTFAKVKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y P D++KFA RYILSGKAW +L +N+TAF
Sbjct  822  VIWIYSIVTYFPQDLLKFAIRYILSGKAWTSLFDNRTAF  860



>emb|CDX82608.1| BnaC07g02580D [Brassica napus]
Length=949

 Score =   377 bits (969),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIVFGFMLI+LIW++DFSAFMVLIIAILNDGTIMTISKDRV PSP P
Sbjct  642  MKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTP  701

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLGGY A+M+V+FFW +H TDFFSDKFGVRSIR++++E+M A+YLQV
Sbjct  702  DSWKLKEIFATGIVLGGYQAVMSVVFFWAIHKTDFFSDKFGVRSIRDNNDELMGAVYLQV  761

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSFVERPG LL++AF+IAQLVATLIAVYA+W FA+++G GWGWAG
Sbjct  762  SIISQALIFVTRSRSWSFVERPGALLMIAFVIAQLVATLIAVYADWTFAKVKGIGWGWAG  821

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIW+YSIV Y P D++KFA RYILSGKAW +L +N+TAF
Sbjct  822  VIWVYSIVTYFPQDLLKFAIRYILSGKAWTSLFDNRTAF  860



>ref|XP_006427547.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
 gb|ESR40787.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
Length=962

 Score =   378 bits (970),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  655  MKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVP  714

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            D+WKLKEIFATG+VLG YLA+MTV+FFW +H + FFS+KFGVRSIR+S  E+ AA+YLQV
Sbjct  715  DTWKLKEIFATGIVLGTYLAVMTVLFFWAIHSSTFFSEKFGVRSIRDSPHELTAAVYLQV  774

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQLVATLIAVYAN+GFARI G GWGW G
Sbjct  775  SIVSQALIFVTRSRSWSFLERPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIGWGWVG  834

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD++KF  RY L+GKAW+NLLENKTAF
Sbjct  835  VIWLYSIVFYIPLDVLKFIVRYALTGKAWDNLLENKTAF  873



>ref|XP_011015389.1| PREDICTED: plasma membrane ATPase-like [Populus euphratica]
Length=963

 Score =   378 bits (970),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAV+ITIRIV GF+L++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  656  MKNYTIYAVTITIRIVLGFLLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  715

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGV+LG YLALMTV+FFWI+H +DFFSDKFGVRSIRN+  E+++A+YLQV
Sbjct  716  DSWKLKEIFATGVILGTYLALMTVVFFWIVHSSDFFSDKFGVRSIRNNHYELISAVYLQV  775

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+ LL+AF++AQL+AT+IAVYANWGFARI G GWGWAG
Sbjct  776  SIVSQALIFVTRSRSWSYVERPGIYLLIAFVLAQLIATIIAVYANWGFARIHGIGWGWAG  835

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLD +KF  RY LS K+W++LL+NKTAF
Sbjct  836  VIWLYSIIFYIPLDFLKFIIRYALSSKSWDSLLQNKTAF  874



>ref|XP_011020653.1| PREDICTED: plasma membrane ATPase-like [Populus euphratica]
Length=963

 Score =   378 bits (970),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 204/219 (93%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAV+ITIRIV GF+L++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  656  MKNYTIYAVTITIRIVLGFLLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  715

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATGV+LG YLALMTV+FFWI+H +DFFSDKFGVRSIRN+  E+++A+YLQV
Sbjct  716  DSWKLKEIFATGVILGTYLALMTVVFFWIVHSSDFFSDKFGVRSIRNNHYELISAVYLQV  775

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWS+VERPG+ LL+AF++AQL+AT+IAVYANWGFARI G GWGWAG
Sbjct  776  SIVSQALIFVTRSRSWSYVERPGIYLLIAFVLAQLIATIIAVYANWGFARIHGIGWGWAG  835

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLD +KF  RY LS K+W++LL+NKTAF
Sbjct  836  VIWLYSIIFYIPLDFLKFIIRYALSSKSWDSLLQNKTAF  874



>gb|KHN01287.1| Plasma membrane ATPase 4 [Glycine soja]
Length=885

 Score =   376 bits (965),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 200/219 (91%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFML++LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  578  MKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  637

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKL EIFATG+VLG YLA+MTV+FFW  H +DFF++KFGVR IRN  +E+ AA+YLQV
Sbjct  638  DSWKLNEIFATGIVLGAYLAIMTVVFFWAAHASDFFTEKFGVRPIRNVQDELTAAVYLQV  697

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSR++SF+ERPG+LL+ AF+IAQL+ATLIAVYANWGFAR++G GWGWAG
Sbjct  698  SIVSQALIFVTRSRNFSFLERPGLLLVTAFIIAQLIATLIAVYANWGFARMRGIGWGWAG  757

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSI+FY+PLD +KF  RY LSGKAWNN+ ENKTAF
Sbjct  758  VIWLYSIIFYIPLDFLKFGIRYFLSGKAWNNITENKTAF  796



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   377 bits (969),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 201/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GFMLI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSPLP
Sbjct  647  MKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLP  706

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            DSWKLKEIFATG+VLG YLAL+TV+FFW M +TDFFSDKF VRS+R  D EMMAALYLQV
Sbjct  707  DSWKLKEIFATGIVLGTYLALVTVLFFWAMKETDFFSDKFHVRSLRERDHEMMAALYLQV  766

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SI+SQALIFVTRSRSWSF+ERPG+LL  AF++AQLVATLIAVYANWGFA+I+GCGWGWAG
Sbjct  767  SIISQALIFVTRSRSWSFLERPGLLLCGAFVVAQLVATLIAVYANWGFAKIKGCGWGWAG  826

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            +IWLYS + ++PLD +KF+ RYILSG+AW++L E +TAF
Sbjct  827  IIWLYSFITFIPLDWIKFSIRYILSGRAWDSLFERRTAF  865



>gb|KDO45595.1| hypothetical protein CISIN_1g044543mg [Citrus sinensis]
Length=962

 Score =   378 bits (970),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 202/219 (92%), Gaps = 0/219 (0%)
 Frame = +2

Query  2    MKNYTIYAVSITIRIVFGFMLISLIWKYDFSAFMVLIIAILNDGTIMTISKDRVVPSPLP  181
            MKNYTIYAVSITIRIV GF+LI+LIWK+DFS FMVLIIAILNDGTIMTISKDRV PSP+P
Sbjct  655  MKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVP  714

Query  182  DSWKLKEIFATGVVLGGYLALMTVIFFWIMHDTDFFSDKFGVRSIRNSDEEMMAALYLQV  361
            D+WKLKEIFATG+VLG YLA+MTV+FFW +H + FFS+KFGVRSIR+S  E+ AA+YLQV
Sbjct  715  DTWKLKEIFATGIVLGTYLAVMTVLFFWAIHSSTFFSEKFGVRSIRDSPHELTAAVYLQV  774

Query  362  SIVSQALIFVTRSRSWSFVERPGMLLLVAFLIAQLVATLIAVYANWGFARIQGCGWGWAG  541
            SIVSQALIFVTRSRSWSF+ERPG+LL+ AF+IAQLVATLIAVYAN+GFARI G GWGW G
Sbjct  775  SIVSQALIFVTRSRSWSFLERPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIGWGWVG  834

Query  542  VIWLYSIVFYVPLDIMKFATRYILSGKAWNNLLENKTAF  658
            VIWLYSIVFY+PLD++KF  RY L+GKAW+NLLENKTAF
Sbjct  835  VIWLYSIVFYIPLDVLKFIVRYALTGKAWDNLLENKTAF  873



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947515357384