BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10274_g1_i1 len=590 path=[1:0-589]

Length=590
                                                                      Score     E

gb|AFK46374.1|  unknown                                                 188   4e-55   
emb|CAG28306.1|  proton-exporting ATPase                                186   3e-54   Cucumis sativus [cucumbers]
gb|KGN62871.1|  hypothetical protein Csa_2G378530                       179   2e-53   
gb|KHN35778.1|  Plasma membrane ATPase 4                                184   7e-53   
ref|XP_006404985.1|  hypothetical protein EUTSA_v10000729mg             178   1e-52   
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            186   1e-51   
gb|KHN22686.1|  Plasma membrane ATPase 4                                188   2e-51   
gb|AAY42948.1|  plasma membrane H+ ATPase                               188   2e-51   Lupinus albus
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    188   2e-51   
gb|KHN17608.1|  Plasma membrane ATPase 4                                188   2e-51   
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    187   4e-51   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           187   4e-51   
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 187   4e-51   
emb|CAA59799.1|  H(+)-transporting ATPase                               187   4e-51   Phaseolus vulgaris [French bean]
ref|XP_006382164.1|  H+-ATPase family protein                           187   5e-51   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             186   5e-51   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    186   6e-51   
dbj|BAD16687.1|  plasma membrane H+-ATPase                              186   6e-51   Daucus carota [Queen Anne's lace]
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                186   6e-51   
gb|KHG28536.1|  Plasma membrane ATPase 4                                184   7e-51   
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      186   7e-51   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           186   7e-51   
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          186   7e-51   
gb|AAB17186.1|  plasma membrane H+-ATPase                               186   8e-51   Solanum lycopersicum
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                186   8e-51   
gb|ACE77057.1|  plasma membrane proton pump                             186   9e-51   Cucumis sativus [cucumbers]
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           186   1e-50   
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    186   1e-50   
emb|CAB69823.1|  plasma membrane H+ ATPase                              186   1e-50   Prunus persica
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             186   1e-50   
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                186   1e-50   Vitis vinifera
gb|KEH39758.1|  plasma membrane H+-ATPase                               186   1e-50   
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             186   1e-50   
gb|KHN16462.1|  Plasma membrane ATPase 4                                186   1e-50   
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      186   1e-50   
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    186   1e-50   
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   185   1e-50   
emb|CAN64375.1|  hypothetical protein VITISV_014422                     186   1e-50   Vitis vinifera
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    185   1e-50   
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                185   1e-50   
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    185   2e-50   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                185   2e-50   
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                185   2e-50   
gb|AAY42950.1|  plasma membrane H+ ATPase                               185   2e-50   Lupinus albus
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                185   2e-50   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                185   2e-50   
gb|AAY42949.1|  plasma membrane H+ ATPase                               185   2e-50   Lupinus albus
emb|CAG28305.1|  proton-exporting ATPase                                176   2e-50   Cucumis sativus [cucumbers]
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     185   2e-50   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           185   3e-50   
emb|CAD62443.1|  proton-exporting ATPase                                176   3e-50   Zea mays [maize]
gb|AFM52333.1|  plasma membrane H+-ATPase                               184   3e-50   
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           184   4e-50   
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             184   4e-50   
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           184   4e-50   
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          184   4e-50   
emb|CDP04837.1|  unnamed protein product                                173   5e-50   
gb|AAB84202.2|  plasma membrane proton ATPase                           184   5e-50   Kosteletzkya virginica [seashore mallow]
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like           184   5e-50   
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  184   5e-50   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             184   5e-50   
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    182   6e-50   Ricinus communis
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           184   6e-50   
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         184   6e-50   
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           183   7e-50   Populus trichocarpa [western balsam poplar]
gb|KCW80657.1|  hypothetical protein EUGRSUZ_C02035                     169   8e-50   
dbj|BAA37150.1|  p-type H+-ATPase                                       183   8e-50   Vicia faba [broad bean]
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           183   8e-50   
gb|KHN15309.1|  Plasma membrane ATPase 4                                183   9e-50   
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    183   9e-50   
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             183   9e-50   
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             182   9e-50   
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 182   1e-49   
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             183   1e-49   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             183   1e-49   
ref|XP_010094202.1|  Plasma membrane ATPase 4                           183   1e-49   
dbj|BAC77530.1|  plasma membrane H+-ATPase                              183   1e-49   Sesbania rostrata
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    182   1e-49   
gb|KHG26452.1|  Plasma membrane ATPase 4                                181   1e-49   
gb|ABM68570.1|  plasma membrane H+ ATPase                               171   1e-49   Lilium longiflorum [Easter lily]
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           183   1e-49   
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             183   1e-49   
emb|CBI20766.3|  unnamed protein product                                182   1e-49   
dbj|BAO45902.1|  plasma membrane H+-ATPase                              182   1e-49   
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         182   2e-49   
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           182   2e-49   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     182   2e-49   
emb|CBW30211.1|  Plasma membrane ATPase                                 182   2e-49   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     182   2e-49   
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                182   2e-49   
emb|CBW30173.1|  Plasma membrane ATPase 4                               182   2e-49   
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                182   2e-49   
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           182   2e-49   
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                182   2e-49   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              182   2e-49   Sesbania rostrata
emb|CAD29579.1|  proton-exporting ATPase                                174   2e-49   Zea mays [maize]
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    182   2e-49   Ricinus communis
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     182   2e-49   
dbj|BAD16684.1|  plasma membrane H+-ATPase                              182   2e-49   Daucus carota [Queen Anne's lace]
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                182   3e-49   Vitis vinifera
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   182   3e-49   Vicia faba [broad bean]
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   182   3e-49   
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             181   4e-49   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             181   4e-49   
gb|KHF98166.1|  Plasma membrane ATPase 4                                179   4e-49   
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           181   4e-49   
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    181   4e-49   
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           181   6e-49   
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    181   7e-49   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 181   7e-49   
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type-like     181   8e-49   
gb|AAB41898.1|  H+-transporting ATPase                                  181   8e-49   Mesembryanthemum crystallinum
gb|KHN01287.1|  Plasma membrane ATPase 4                                180   9e-49   
emb|CAC29436.1|  P-type H+-ATPase                                       180   9e-49   Vicia faba [broad bean]
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             180   1e-48   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    180   1e-48   
gb|KEH35952.1|  plasma membrane H+-ATPase                               180   1e-48   
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           180   2e-48   
gb|AEQ27822.1|  PM H+-ATPase R                                          179   2e-48   
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          179   2e-48   
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           179   2e-48   
ref|NP_180028.1|  H(+)-ATPase 5                                         179   2e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002324397.1|  H+-ATPase family protein                           179   2e-48   Populus trichocarpa [western balsam poplar]
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    179   3e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          179   3e-48   
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg             179   3e-48   
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  179   4e-48   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          179   4e-48   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             179   4e-48   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             178   4e-48   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           178   4e-48   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     178   5e-48   Vitis vinifera
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          178   6e-48   Vitis vinifera
dbj|BAD16685.1|  plasma membrane H+-ATPase                              178   8e-48   Daucus carota [Queen Anne's lace]
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                177   9e-48   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           177   1e-47   
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          177   1e-47   
gb|AFW04239.1|  plasma membrane H+-ATPase                               177   1e-47   
ref|XP_008666713.1|  PREDICTED: plasma membrane ATPase-like             164   1e-47   
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       177   1e-47   
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             177   1e-47   
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           177   1e-47   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  177   1e-47   
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     177   2e-47   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4-like           177   2e-47   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              177   2e-47   Daucus carota [Queen Anne's lace]
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                177   2e-47   
gb|AHK23067.1|  plasma membrane ATPase 4                                176   3e-47   
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       176   3e-47   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     176   3e-47   
gb|ABW25091.1|  plasma membrane proton pump                             176   3e-47   Cucumis sativus [cucumbers]
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             176   4e-47   
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    176   4e-47   
emb|CDP02997.1|  unnamed protein product                                176   4e-47   
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                176   4e-47   
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           176   5e-47   
ref|XP_007023380.1|  H(+)-ATPase 9                                      175   5e-47   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           176   5e-47   
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       174   6e-47   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   175   6e-47   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  175   7e-47   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     175   7e-47   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             175   8e-47   
gb|KHN38020.1|  Plasma membrane ATPase                                  174   9e-47   
emb|CBI35956.3|  unnamed protein product                                174   1e-46   
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           174   1e-46   
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          174   1e-46   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             174   2e-46   
emb|CAN78639.1|  hypothetical protein VITISV_031738                     174   2e-46   Vitis vinifera
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          174   2e-46   
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             174   2e-46   Vitis vinifera
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          174   2e-46   Sorghum bicolor [broomcorn]
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     174   2e-46   
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           173   3e-46   
gb|AAO72564.1|  plasma membrane H+-ATPase-like protein                  170   3e-46   Oryza sativa Japonica Group [Japonica rice]
gb|ACL54575.1|  unknown                                                 173   3e-46   Zea mays [maize]
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  173   4e-46   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             173   4e-46   
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       173   4e-46   
dbj|BAL41366.1|  plasma membrane H+-ATPase                              173   4e-46   
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     172   4e-46   
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    173   5e-46   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       173   5e-46   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                173   5e-46   
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       173   5e-46   
emb|CDO98206.1|  unnamed protein product                                172   5e-46   
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        172   5e-46   Lilium longiflorum [Easter lily]
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       172   6e-46   
ref|XP_003594954.1|  Plasma membrane ATPase                             172   6e-46   
gb|AEO22063.1|  plasma membrane H+-ATPase                               172   6e-46   
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           172   6e-46   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                172   6e-46   
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             172   6e-46   
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    172   7e-46   
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    170   8e-46   Ricinus communis
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          172   9e-46   
gb|KFK32649.1|  hypothetical protein AALP_AA6G270500                    171   9e-46   
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    172   1e-45   
gb|AAK31799.2|  plasma membrane H+ ATPase                               171   1e-45   Lilium longiflorum [Easter lily]
dbj|BAG94605.1|  unnamed protein product                                171   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          171   1e-45   
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             171   1e-45   
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       171   2e-45   
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     171   2e-45   
gb|ABR18001.1|  unknown                                                 171   2e-45   Picea sitchensis
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           171   2e-45   
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    171   2e-45   
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         171   3e-45   
emb|CAD29313.1|  plasma membrane H+-ATPase                              171   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    170   3e-45   
gb|KHN22411.1|  ATPase 9, plasma membrane-type                          170   4e-45   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             170   4e-45   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          170   6e-45   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054118.1|  Os04g0656100                                       170   6e-45   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD94367.1|  plasma membrane proton ATPase                          160   8e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             169   9e-45   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    169   9e-45   
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     169   9e-45   
ref|XP_009117122.1|  PREDICTED: ATPase 5, plasma membrane-type          169   1e-44   
emb|CDY34767.1|  BnaA09g41340D                                          169   1e-44   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     169   1e-44   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     169   1e-44   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             169   1e-44   
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     168   1e-44   
gb|KEH39623.1|  plasma membrane H+-ATPase                               169   1e-44   
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          169   1e-44   
gb|EPS63245.1|  hypothetical protein M569_11541                         168   2e-44   
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                     168   2e-44   Zostera marina
gb|AAK60570.1|  H+-ATPase                                               155   2e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                168   2e-44   
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           168   2e-44   
gb|EPS65442.1|  hypothetical protein M569_09334                         168   2e-44   
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     168   2e-44   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          167   2e-44   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     168   2e-44   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             168   3e-44   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          168   3e-44   
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             167   3e-44   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     167   4e-44   
emb|CDP14275.1|  unnamed protein product                                165   4e-44   
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     167   4e-44   
dbj|BAF03589.1|  P-type H+-ATPase                                       167   5e-44   Zostera marina
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     167   5e-44   
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     167   6e-44   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     167   6e-44   
emb|CDX76810.1|  BnaC08g33960D                                          166   6e-44   
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             167   6e-44   
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    166   7e-44   
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    166   7e-44   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     167   7e-44   
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    166   8e-44   
emb|CDY03545.1|  BnaC03g68040D                                          164   8e-44   
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like     166   9e-44   
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       165   9e-44   
gb|AAF27113.1|AC018849_1  aha9, 5' partial; 1-2403                      164   9e-44   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             166   9e-44   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           166   9e-44   
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    166   1e-43   
ref|XP_002324564.1|  ATPase 6 family protein                            166   1e-43   Populus trichocarpa [western balsam poplar]
ref|NP_001190870.1|  H(+)-ATPase 2                                      166   1e-43   
dbj|BAO02511.1|  predicted H+ ATPase ortholog                           164   1e-43   
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          166   1e-43   
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          166   1e-43   
gb|AAR32129.2|  proton P-ATPase                                         166   1e-43   Nicotiana tabacum [American tobacco]
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           166   2e-43   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             166   2e-43   
gb|AAD46186.1|  plasma membrane proton ATPase                           165   2e-43   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_001185450.1|  H(+)-ATPase 9                                      165   3e-43   
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          165   3e-43   
emb|CDP14278.1|  unnamed protein product                                166   3e-43   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             165   3e-43   
ref|NP_178181.1|  H(+)-ATPase 9                                         165   3e-43   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14186.1|  BnaA08g13170D                                          165   3e-43   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  165   3e-43   
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          164   4e-43   
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                164   4e-43   
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like           164   4e-43   
ref|NP_194748.1|  H(+)-ATPase 2                                         164   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           164   4e-43   
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                164   4e-43   
ref|XP_010429928.1|  PREDICTED: ATPase 9, plasma membrane-type-like     156   5e-43   
ref|XP_007023381.1|  H(+)-ATPase 9                                      164   5e-43   
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             164   5e-43   
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     164   6e-43   
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           164   6e-43   
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          164   6e-43   
ref|XP_002309321.1|  ATPase 6 family protein                            164   7e-43   
ref|XP_002307856.1|  ATPase 6 family protein                            164   7e-43   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             164   7e-43   
dbj|BAJ34124.1|  unnamed protein product                                164   7e-43   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          164   8e-43   
gb|KFK29576.1|  h(+)-atpase 2                                           163   1e-42   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       163   1e-42   
gb|KGN60167.1|  hypothetical protein Csa_3G881800                       160   1e-42   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           163   1e-42   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     163   1e-42   
gb|AAQ19041.1|  P-type H+-ATPase                                        157   2e-42   
emb|CDX87330.1|  BnaA07g35430D                                          162   2e-42   
emb|CDY39956.1|  BnaC06g40340D                                          162   2e-42   
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    162   3e-42   
dbj|BAJ33915.1|  unnamed protein product                                162   3e-42   
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             162   3e-42   
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   162   4e-42   
ref|NP_179486.1|  H(+)-ATPase 1                                         162   4e-42   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    161   5e-42   
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150             161   5e-42   
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          161   5e-42   
gb|EPS59184.1|  hypothetical protein M569_15622                         158   6e-42   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          161   6e-42   
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    161   6e-42   
emb|CAC50884.1|  plasma membrane H+-ATPase                              159   6e-42   
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like           161   6e-42   
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like           161   6e-42   
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             161   7e-42   
ref|XP_004973040.1|  PREDICTED: plasma membrane ATPase-like             160   9e-42   
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     160   9e-42   
ref|XP_009126895.1|  PREDICTED: ATPase 3, plasma membrane-type-like     159   9e-42   
ref|XP_007012006.1|  H(+)-ATPase 8                                      160   9e-42   
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     160   1e-41   
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    160   1e-41   
ref|XP_002979990.1|  hypothetical protein SELMODRAFT_419690             160   1e-41   
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          160   2e-41   
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     160   2e-41   
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    160   2e-41   
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             160   2e-41   
ref|XP_006401213.1|  hypothetical protein EUTSA_v10015530mg             160   2e-41   
gb|EMT26270.1|  Plasma membrane ATPase                                  160   2e-41   
gb|EMS60594.1|  Plasma membrane ATPase                                  160   2e-41   
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...    160   2e-41   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    159   2e-41   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          159   3e-41   
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          159   3e-41   
emb|CDY64741.1|  BnaCnng44750D                                          159   3e-41   
gb|AAN15220.1|  plasma membrane P-type proton pump ATPase               159   3e-41   
emb|CDX82608.1|  BnaC07g02580D                                          159   3e-41   
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          159   3e-41   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                159   3e-41   
ref|NP_001169274.1|  uncharacterized protein LOC100383137               159   3e-41   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     159   4e-41   
ref|XP_008677590.1|  PREDICTED: uncharacterized protein LOC100383...    159   4e-41   
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          159   5e-41   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    159   5e-41   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    159   5e-41   
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     159   5e-41   
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                158   6e-41   
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                158   6e-41   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          158   7e-41   
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    158   7e-41   
dbj|BAF01699.1|  plasma membrane ATPase 3                               153   8e-41   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     158   8e-41   
emb|CDY47940.1|  BnaA02g08160D                                          158   9e-41   
ref|XP_010467151.1|  PREDICTED: ATPase 6, plasma membrane-type-like     150   1e-40   
gb|AAV71150.1|  plasma membrane H+-ATPase                               157   1e-40   
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             157   2e-40   
gb|KFK27283.1|  h(+)-atpase 3                                           157   2e-40   
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     157   2e-40   
gb|AAQ19039.1|  P-type H+-ATPase                                        152   2e-40   
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          157   2e-40   
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             157   2e-40   
gb|AAO22672.1|  putative plasma membrane proton ATPase                  151   2e-40   
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     157   2e-40   
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          157   2e-40   
gb|KDO53125.1|  hypothetical protein CISIN_1g0105231mg                  144   3e-40   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    156   3e-40   
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          156   3e-40   
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             156   3e-40   
gb|AAQ55291.1|  plasma membrane H+-ATPase                               155   1e-39   
gb|AAL09726.1|  AT5g57350/MJB24_16                                      154   1e-39   
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...    154   2e-39   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    154   2e-39   
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    154   2e-39   
ref|NP_200545.1|  H(+)-ATPase 3                                         154   2e-39   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             154   2e-39   
gb|ABA18090.1|  putative plasma membrane ATPase                         154   2e-39   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     154   2e-39   
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    152   2e-39   
gb|AFC88896.1|  plasma membrane H+-ATPase                               154   2e-39   
emb|CDX93092.1|  BnaA03g38140D                                          154   2e-39   
emb|CDY50939.1|  BnaC03g74390D                                          154   2e-39   
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             154   2e-39   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     154   3e-39   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     154   3e-39   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          154   3e-39   
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          154   3e-39   
emb|CDY25913.1|  BnaC09g32850D                                          154   3e-39   
ref|XP_010087815.1|  hypothetical protein L484_001526                   147   3e-39   
ref|XP_010531800.1|  PREDICTED: ATPase 4, plasma membrane-type-like     153   5e-39   
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     153   5e-39   
ref|XP_002444096.1|  hypothetical protein SORBIDRAFT_07g007610          153   6e-39   
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    153   6e-39   
ref|XP_010914191.1|  PREDICTED: plasma membrane ATPase-like             152   6e-39   
ref|NP_001067382.1|  Os12g0638700                                       152   6e-39   
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                152   7e-39   
gb|EAZ21357.1|  hypothetical protein OsJ_37014                          152   7e-39   
emb|CDY51651.1|  BnaAnng10910D                                          152   8e-39   
gb|EEC69747.1|  hypothetical protein OsI_39279                          152   8e-39   
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    152   9e-39   
emb|CDY38294.1|  BnaA10g11420D                                          152   9e-39   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          152   1e-38   
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    152   1e-38   
emb|CDX72218.1|  BnaC07g42400D                                          152   1e-38   
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         152   1e-38   
ref|NP_001183637.1|  uncharacterized protein LOC100502231               145   1e-38   
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         152   1e-38   
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           152   1e-38   
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             151   1e-38   
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    151   2e-38   
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg             151   2e-38   
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         151   2e-38   
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          151   2e-38   
ref|XP_002875872.1|  predicted protein                                  141   2e-38   
ref|NP_178762.1|  H(+)-ATPase 6                                         151   2e-38   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     151   2e-38   
emb|CDY51650.1|  BnaAnng10900D                                          151   2e-38   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     151   2e-38   
gb|ACN49187.1|  plasma membrane ATPase 1-like protein                   149   2e-38   
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    151   2e-38   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     151   2e-38   
emb|CDX72217.1|  BnaC07g42390D                                          151   2e-38   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    151   2e-38   
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     151   2e-38   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like     150   3e-38   
emb|CDX67957.1|  BnaA07g19970D                                          150   3e-38   
gb|EMT31912.1|  Plasma membrane ATPase 1                                150   3e-38   
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           150   4e-38   
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         150   4e-38   
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    150   4e-38   
gb|KHG14131.1|  ATPase 4, plasma membrane-type -like protein            149   4e-38   
emb|CDY30730.1|  BnaA02g33520D                                          149   5e-38   
ref|NP_001169998.1|  uncharacterized protein LOC100383904               146   5e-38   
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1                150   5e-38   
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             150   5e-38   
gb|KEH24964.1|  plasma membrane H+-ATPase                               150   5e-38   
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         150   5e-38   
ref|NP_189850.1|  H(+)-ATPase 8                                         150   6e-38   
dbj|BAK04567.1|  predicted protein                                      150   6e-38   
dbj|BAJ92653.1|  predicted protein                                      150   6e-38   
gb|KEH24965.1|  plasma membrane H+-ATPase                               150   6e-38   
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type-like    150   7e-38   
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    149   7e-38   
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         149   7e-38   
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    149   7e-38   
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     149   8e-38   
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    149   9e-38   
gb|EYU24620.1|  hypothetical protein MIMGU_mgv1a001404mg                149   9e-38   
gb|EMS45119.1|  Plasma membrane ATPase 1                                149   9e-38   
gb|ABA18112.1|  putative plasma membrane ATPase                         149   9e-38   
gb|EYU35892.1|  hypothetical protein MIMGU_mgv1a0008592mg               142   9e-38   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             149   1e-37   
dbj|BAK05828.1|  predicted protein                                      149   1e-37   
ref|XP_006428674.1|  hypothetical protein CICLE_v10011040mg             149   1e-37   
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    149   1e-37   
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     149   1e-37   
ref|XP_006480481.1|  PREDICTED: ATPase 4, plasma membrane-type-like     149   1e-37   
dbj|BAC77533.1|  plasma membrane H+-ATPase                              144   1e-37   
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             149   1e-37   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          149   1e-37   
ref|XP_006651704.1|  PREDICTED: plasma membrane ATPase 1-like           149   1e-37   
ref|XP_010050873.1|  PREDICTED: plasma membrane ATPase 4-like           137   2e-37   
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    149   2e-37   
dbj|BAC77532.1|  plasma membrane H+-ATPase                              149   2e-37   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    149   2e-37   
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                149   2e-37   
ref|XP_002511508.1|  H(\+)-transporting atpase plant/fungi plasma...    148   2e-37   
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                148   2e-37   
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                148   2e-37   
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    148   2e-37   
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    148   2e-37   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             148   2e-37   
gb|AAC43034.1|  plasma membrane proton-ATPase                           135   2e-37   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          148   2e-37   
emb|CDY67153.1|  BnaAnng23670D                                          148   2e-37   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             148   2e-37   
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type         148   3e-37   
gb|KEH39753.1|  plasma membrane H+-ATPase                               148   3e-37   
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         148   3e-37   
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    148   3e-37   
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           147   3e-37   
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    147   3e-37   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    147   4e-37   
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    147   4e-37   
gb|AAV44084.1|  putative plasma membrane H+ ATPase                      147   4e-37   
emb|CAD29312.1|  plasma membrane H+-ATPase                              147   4e-37   
emb|CDY45757.1|  BnaC02g42250D                                          147   4e-37   
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg             147   4e-37   
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                     147   4e-37   
ref|XP_007032427.1|  H(+)-ATPase 4 isoform 1                            147   4e-37   
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    147   4e-37   
emb|CAD29297.1|  plasma membrane H+ ATPase                              147   4e-37   
emb|CDX79363.1|  BnaC06g19400D                                          147   5e-37   
gb|EEC78976.1|  hypothetical protein OsI_19456                          147   5e-37   
gb|KGN64262.1|  hypothetical protein Csa_1G045600                       146   5e-37   
gb|KGN52442.1|  hypothetical protein Csa_5G635370                       147   5e-37   
ref|NP_001055186.1|  Os05g0319800                                       147   5e-37   
ref|XP_008230721.1|  PREDICTED: plasma membrane ATPase 1-like           147   5e-37   
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                147   5e-37   
ref|XP_002438748.1|  hypothetical protein SORBIDRAFT_10g025470          147   5e-37   
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           147   6e-37   
ref|XP_007214948.1|  hypothetical protein PRUPE_ppa000931mg             147   6e-37   
ref|NP_001048395.2|  Os02g0797300                                       147   6e-37   



>gb|AFK46374.1| unknown [Lotus japonicus]
Length=289

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSNVF EKNSYRELSEIAEQAKRRA
Sbjct  195  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNVFNEKNSYRELSEIAEQAKRRA  254

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  255  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  289



>emb|CAG28306.1| proton-exporting ATPase [Cucumis sativus]
Length=310

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+F+EK+SYRELSEIAEQAKRRA
Sbjct  216  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSYRELSEIAEQAKRRA  275

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  276  EIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  310



>gb|KGN62871.1| hypothetical protein Csa_2G378530 [Cucumis sativus]
Length=170

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F EK+SYRELSEIAEQAKRRA
Sbjct  76   ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRA  135

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  136  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  170



>gb|KHN35778.1| Plasma membrane ATPase 4 [Glycine soja]
Length=365

 Score =   184 bits (467),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F EK+SYREL+EIAEQAKRRA
Sbjct  271  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRA  330

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  331  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  365



>ref|XP_006404985.1| hypothetical protein EUTSA_v10000729mg [Eutrema salsugineum]
 gb|ESQ46438.1| hypothetical protein EUTSA_v10000729mg [Eutrema salsugineum]
Length=197

 Score =   178 bits (452),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/95 (88%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPET+N+F EKN Y ELSEIAEQAKRRA
Sbjct  103  DNKTAFTTKKDYGREEREAQWAAAQRTLHGLQPPETNNIFNEKNCYSELSEIAEQAKRRA  162

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKG VESVVKLKGLDI+TIQQHYTV
Sbjct  163  EVARLRELNTLKGQVESVVKLKGLDIDTIQQHYTV  197



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   186 bits (472),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 89/95 (94%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F EK+SYRELSEIAEQAKRRA
Sbjct  565  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNEKSSYRELSEIAEQAKRRA  624

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  625  EVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  659



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   188 bits (477),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 89/95 (94%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETS +F EKNSYRELSEIAEQAKRRA
Sbjct  859  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSYRELSEIAEQAKRRA  918

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  919  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   188 bits (477),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSN+F E N+YRELSEIAEQAKRRA
Sbjct  862  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNIFNESNNYRELSEIAEQAKRRA  921

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  922  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   188 bits (477),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 89/95 (94%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETS +F EKNSYRELSEIAEQAKRRA
Sbjct  859  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSYRELSEIAEQAKRRA  918

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  919  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   188 bits (477),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 89/95 (94%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETS +F EKNSYRELSEIAEQAKRRA
Sbjct  859  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSGIFNEKNSYRELSEIAEQAKRRA  918

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  919  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   187 bits (474),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =   187 bits (474),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 91/96 (95%), Positives = 94/96 (98%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETS-NVFTEKNSYRELSEIAEQAKRR  178
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETS N+F+EKNSYRELSEIAEQAKRR
Sbjct  860  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETSHNMFSEKNSYRELSEIAEQAKRR  919

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AEMARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  AEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   187 bits (474),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F+E++SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNIFSERSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   187 bits (474),  Expect = 4e-51, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =   187 bits (474),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 91/96 (95%), Positives = 94/96 (98%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETS-NVFTEKNSYRELSEIAEQAKRR  178
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETS N+F+EKNSYRELSEIAEQAKRR
Sbjct  860  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETSHNMFSEKNSYRELSEIAEQAKRR  919

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AEMARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  AEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   186 bits (473),  Expect = 5e-51, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   186 bits (473),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   186 bits (473),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP  SN+F +KNSYRELSEIAEQAKRRA
Sbjct  855  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPADSNIFDDKNSYRELSEIAEQAKRRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  915  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   186 bits (473),  Expect = 6e-51, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+F+EK+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KHG28536.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   184 bits (467),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F +KNSYRELSEIAEQAKRRA
Sbjct  562  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRA  621

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  622  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  656



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   186 bits (473),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 89/95 (94%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F EKNSYRELSEIAEQAKRRA
Sbjct  858  DNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            EMARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  918  EMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =   186 bits (473),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+F+EK+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KHM99449.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=940

 Score =   186 bits (472),  Expect = 7e-51, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F +KNSYRELSEIAEQAKRRA
Sbjct  846  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRA  905

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  906  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  940



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   186 bits (472),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 89/95 (94%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F EKNSYRELSEIAEQAKRRA
Sbjct  858  DNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            EMARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  918  EMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   186 bits (472),  Expect = 8e-51, Method: Composition-based stats.
 Identities = 89/95 (94%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F EKNSYRELSEIAEQAKRRA
Sbjct  858  DNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            EMARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  918  EMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   186 bits (472),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE++N+F+EK+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPESTNIFSEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F EKNSYRELSEIAEQAKRRA
Sbjct  854  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRA  913

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  914  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F EKNSYRELSEIAEQAKRRA
Sbjct  841  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRA  900

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  901  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  935



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F+EKNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F +KNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SNVF EKNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPEASNVFNEKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRE++TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLREVHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_007225350.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
 gb|EMJ26549.1| hypothetical protein PRUPE_ppa000977mg [Prunus persica]
Length=943

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F+EKNSYRELSEIAEQAKRRA
Sbjct  849  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFSEKNSYRELSEIAEQAKRRA  908

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  909  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  943



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   185 bits (469),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+ +F++KNSYRELSEIAEQAKRRA
Sbjct  791  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRA  850

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  851  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   186 bits (471),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F +KNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFXDKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   185 bits (470),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPET+ +F EK+SYRELSEIAEQAKRRA
Sbjct  858  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETAGIFNEKSSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  918  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_008360343.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=885

 Score =   185 bits (469),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE+S++F +KNSYRELSEIAEQAKRRA
Sbjct  791  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPESSSIFHDKNSYRELSEIAEQAKRRA  850

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  851  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   185 bits (470),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +N+F EKNSYRELSEIAEQAKRRA
Sbjct  858  DNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            EMARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  918  EMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   185 bits (469),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +N+F EKNSYRELSEIAEQAKRRA
Sbjct  858  DNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            EMARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  918  EMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   185 bits (469),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +N+F EKNSYRELSEIAEQAKRRA
Sbjct  858  DNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNEKNSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            EMARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  918  EMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score =   185 bits (469),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKD GKEEREAQWAHAQRTLHGLQPPETSN+F E N+YRELSEIAEQAKRRA
Sbjct  859  ENKTAFTTKKDCGKEEREAQWAHAQRTLHGLQPPETSNIFNESNNYRELSEIAEQAKRRA  918

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  919  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_008367709.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=956

 Score =   185 bits (469),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F EKNSYRELSEIAEQAKRRA
Sbjct  862  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRA  921

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  922  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   185 bits (469),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F EKNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   185 bits (469),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>emb|CAG28305.1| proton-exporting ATPase [Cucumis sativus]
Length=311

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PETSNVFTEKNSYRELSEIAEQAKRR  178
            ENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE +++F EKNSYRELSEIAEQAKRR
Sbjct  216  ENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSEIAEQAKRR  275

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AE+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  276  AEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  311



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   185 bits (469),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F EKNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   185 bits (469),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F EKNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CAD62443.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE  TS +F +KNSYRELSEIAEQAKR
Sbjct  216  ENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKR  275

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  276  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  312



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   184 bits (468),  Expect = 3e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F E+NSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNLFNERNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELTTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   184 bits (467),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F EKNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_006453323.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474211.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Citrus sinensis]
 gb|ESR66563.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=885

 Score =   184 bits (466),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F EK+SYRELSEIAEQAKRRA
Sbjct  791  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETNNLFPEKSSYRELSEIAEQAKRRA  850

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  851  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   184 bits (467),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNIFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+T+QQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   184 bits (467),  Expect = 4e-50, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE+S +F EK+SYRELSEIAEQAKRRA
Sbjct  858  DNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPESSGIFNEKSSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  918  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>emb|CDP04837.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   173 bits (438),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NK AFTTKKDYGKEEREAQWA AQRTLHGLQPP+ S +  EK+SYRELSEIAEQAKRRA
Sbjct  133  DNKIAFTTKKDYGKEEREAQWAVAQRTLHGLQPPDASGILDEKSSYRELSEIAEQAKRRA  192

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            EMARLREL+TLKGHVESVVKLKGLDIETIQQH TV
Sbjct  193  EMARLRELHTLKGHVESVVKLKGLDIETIQQHCTV  227



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   184 bits (467),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 89/95 (94%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F EKNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFHEKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   184 bits (466),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE+SN+F++K+SYRELSEIAEQAKRRA
Sbjct  861  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPESSNIFSDKSSYRELSEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+ IQQHYTV
Sbjct  921  EVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  955



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   184 bits (466),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            EN+TAFTTKKDYG+EEREAQWA AQRTLHGLQPPET+N+F++KNSYRELSEIAEQAKRRA
Sbjct  860  ENRTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETANLFSDKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   184 bits (466),  Expect = 5e-50, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPET+N+F+EK+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETANIFSEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+AR+RELNTLKGHVESVVKLKGLDI+ IQQHYTV
Sbjct  920  EIARIRELNTLKGHVESVVKLKGLDIDNIQQHYTV  954



>ref|XP_002515334.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF46783.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=734

 Score =   182 bits (462),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/95 (92%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N F +KNSYRELSEIAEQAKRRA
Sbjct  640  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTNFFADKNSYRELSEIAEQAKRRA  699

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  700  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  734



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   184 bits (466),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETS+VF EK+SYRELSEIAEQAKRRA
Sbjct  862  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSSVFNEKSSYRELSEIAEQAKRRA  921

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  922  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   184 bits (466),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+++F EKNSYRELSEIAEQAKRRA
Sbjct  858  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETASIFNEKNSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  918  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   183 bits (465),  Expect = 7e-50, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPET+ +F EK+SYRELSEIAEQAKRRA
Sbjct  858  DNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETAGIFNEKSSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  918  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|KCW80657.1| hypothetical protein EUGRSUZ_C02035 [Eucalyptus grandis]
Length=130

 Score =   169 bits (428),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/94 (84%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +2

Query  5    NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRAE  184
             +TAFT+KKDYGKEEREAQWA AQ+TLHGLQPPE+SN+F++K+SYRELSEIAEQAKRRAE
Sbjct  37   TQTAFTSKKDYGKEEREAQWATAQKTLHGLQPPESSNLFSDKSSYRELSEIAEQAKRRAE  96

Query  185  MARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            +ARLREL+TLKGHVESVVKLKGLDI++IQQHYT 
Sbjct  97   VARLRELHTLKGHVESVVKLKGLDIDSIQQHYTF  130



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =   183 bits (465),  Expect = 8e-50, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE+S +F EK+SYRELSEIAEQAKRRA
Sbjct  858  DNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPESSGIFNEKSSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  918  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   183 bits (465),  Expect = 8e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F EK+SYREL+EIAEQAKRRA
Sbjct  861  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  921  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   183 bits (465),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F EK+SYREL+EIAEQAKRRA
Sbjct  861  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  921  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   183 bits (465),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F EK+SYREL+EIAEQAKRRA
Sbjct  861  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  921  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   183 bits (465),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F++K+SYRELSEIAEQAKRRA
Sbjct  860  QNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPPETTNLFSDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006381782.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
 gb|ERP59579.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
Length=885

 Score =   182 bits (463),  Expect = 9e-50, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+ VF EK+ YRELSEIAEQAKRRA
Sbjct  791  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETAGVFNEKSGYRELSEIAEQAKRRA  850

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  851  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_007014223.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
 gb|EOY31842.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
Length=886

 Score =   182 bits (463),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +N+F +K+SYRELSEIAEQAKRRA
Sbjct  792  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNDKSSYRELSEIAEQAKRRA  851

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  852  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  886



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   183 bits (464),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+ +F++KNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   183 bits (464),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+ +F++KNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   183 bits (464),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F EK+SYRELSEIAEQAKRRA
Sbjct  863  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETTNLFPEKSSYRELSEIAEQAKRRA  922

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  923  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  957



>dbj|BAC77530.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=951

 Score =   183 bits (464),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+++F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETTSIFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KCW81010.1| hypothetical protein EUGRSUZ_C023861, partial [Eucalyptus grandis]
Length=935

 Score =   182 bits (463),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETS +F++K+SYRELSEIAEQAKRRA
Sbjct  841  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSTIFSDKSSYRELSEIAEQAKRRA  900

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  901  EVARLRELQTLKGHVESVVKLKGLDIDTIQQHYTV  935



>gb|KHG26452.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   181 bits (458),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F +K+SYRELSEIAEQAKRRA
Sbjct  562  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNLFNDKSSYRELSEIAEQAKRRA  621

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  622  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  656



>gb|ABM68570.1| plasma membrane H+ ATPase [Lilium longiflorum]
Length=191

 Score =   171 bits (432),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYGK EREAQWA AQRTLHGLQ  +TS++F +KNSYRELSEIAEQAKRRA
Sbjct  97   QNKTAFTSKKDYGKGEREAQWATAQRTLHGLQTADTSSLFNDKNSYRELSEIAEQAKRRA  156

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  157  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  191



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   183 bits (464),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET N+F E+NSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETXNLFNERNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELTTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   183 bits (464),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F EK+SYRELSEIAEQAKRRA
Sbjct  861  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNIFNEKSSYRELSEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  921  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>emb|CBI20766.3| unnamed protein product [Vitis vinifera]
Length=862

 Score =   182 bits (461),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F++K+ YRELSEIAEQAKRRA
Sbjct  768  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNIFSDKSGYRELSEIAEQAKRRA  827

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGH+ESVVKLKGLDI+TIQ HYTV
Sbjct  828  EVARLRELNTLKGHMESVVKLKGLDIDTIQHHYTV  862



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =   182 bits (463),  Expect = 1e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETS++F +KNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSSIFNDKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   182 bits (463),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N F EK+ YRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPPETNNFFGEKSGYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =   182 bits (463),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE+S++F +KNSYRELSEIAEQAKRRA
Sbjct  861  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPESSSIFNDKNSYRELSEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  921  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =   182 bits (463),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP ETS++F +K+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPRETSSIFNDKHSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRE+NTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLREVNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CBW30211.1| Plasma membrane ATPase [Musa balbisiana]
Length=954

 Score =   182 bits (462),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F++K+SYRELSEIAEQAKRRA
Sbjct  860  QNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPPETTNLFSDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010046966.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Eucalyptus grandis]
Length=990

 Score =   182 bits (463),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP ETS++F +K+SYRELSEIAEQAKRRA
Sbjct  896  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPRETSSIFNDKHSYRELSEIAEQAKRRA  955

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRE+NTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  956  EVARLREVNTLKGHVESVVKLKGLDIDTIQQHYTV  990



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   182 bits (462),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F +K+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSNLFNDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =   182 bits (462),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F++K+SYRELSEIAEQAKRRA
Sbjct  860  QNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPPETTNLFSDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   182 bits (462),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPET+N+F EKNSYRELSEIAEQAKRRA
Sbjct  860  EKKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETTNLFNEKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004138879.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=1038

 Score =   182 bits (463),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2     ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
             ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F EK+SYRELSEIAEQAKRRA
Sbjct  944   ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRA  1003

Query  182   EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
             E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  1004  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  1038



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =   182 bits (462),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETS +F++K+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSTIFSDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELQTLKGHVESVVKLKGLDIDTIQQHYTV  954



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   182 bits (462),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETS +F EK+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETSGIFNEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CAD29579.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSN--VFTEKNSYRELSEIAEQAKR  175
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE S+  +F +K+SYRELSEIAEQAKR
Sbjct  216  ENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYRELSEIAEQAKR  275

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  276  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  312



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =   182 bits (462),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+++F EK+SYRELSEIAEQAKRRA
Sbjct  858  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETASIFNEKSSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  918  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   182 bits (462),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F EKNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYT  283
            E+ARLREL+TLKGHVESVVKLKGLDI++IQQHYT
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDSIQQHYT  953



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   182 bits (462),  Expect = 2e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +N+TAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F EK+SYRELSEIAEQAKRRA
Sbjct  856  DNRTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEASNIFNEKSSYRELSEIAEQAKRRA  915

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  916  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   182 bits (461),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPETSN+F++K+ YRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETSNIFSDKSGYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGH+ESVVKLKGLDI+TIQ HYTV
Sbjct  920  EVARLRELNTLKGHMESVVKLKGLDIDTIQHHYTV  954



>gb|AAB35314.2| plasma membrane H(+)-ATPase precursor [Vicia faba]
Length=956

 Score =   182 bits (461),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGK EREAQWAHAQRTLHGL+PPE+S +F EKNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKGEREAQWAHAQRTLHGLEPPESSGIFHEKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   182 bits (461),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F EK+SYRELSEIAEQAKRRA
Sbjct  859  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETNNLFPEKSSYRELSEIAEQAKRRA  918

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  919  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =   181 bits (460),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYG+EEREAQWAHAQRTLHGLQPPET+++F EKNSYRELSEIAEQA +RA
Sbjct  859  ENKTAFTTKKDYGREEREAQWAHAQRTLHGLQPPETTSIFNEKNSYRELSEIAEQAMKRA  918

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+ IQQHYTV
Sbjct  919  EVARLRELHTLKGHVESVVKLKGLDIDNIQQHYTV  953



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   181 bits (460),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+N+F EK+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPETNNLFPEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KHF98166.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=663

 Score =   179 bits (455),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPET+++F E++SYRELSEIAEQAKRRA
Sbjct  569  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPETTSIFNERSSYRELSEIAEQAKRRA  628

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+ IQQHYTV
Sbjct  629  EVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  663



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   181 bits (460),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F EK+SYRELSEIAEQAKRRA
Sbjct  861  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  921  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   181 bits (460),  Expect = 4e-49, Method: Composition-based stats.
 Identities = 87/95 (92%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE SN+F EK+SYRELSEIAEQAKRRA
Sbjct  861  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  921  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   181 bits (459),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFT+KKDYG+EEREAQWA AQRTLHGLQPPET+N+F +KNSYRELSEIAEQAKRRA
Sbjct  860  EKKTAFTSKKDYGREEREAQWAMAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_010526269.1| PREDICTED: ATPase 5, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=931

 Score =   181 bits (458),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP + +NVF++KNSYRELSEIAEQAKRRA
Sbjct  837  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPADAANVFSDKNSYRELSEIAEQAKRRA  896

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  897  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  931



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   181 bits (458),  Expect = 7e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQPPE +N+F +K+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPEATNLFNDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=954

 Score =   181 bits (458),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGK EREAQWA AQRTLHGLQPPETS++F +KN+YRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSDIFNDKNNYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   181 bits (458),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGKEEREAQWA AQRT+HGLQPPET+N+F EK++YRELSEIAEQAKRRA
Sbjct  859  DNKTAFTTKKDYGKEEREAQWAAAQRTMHGLQPPETTNLFPEKSNYRELSEIAEQAKRRA  918

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  919  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|KHN01287.1| Plasma membrane ATPase 4 [Glycine soja]
Length=885

 Score =   180 bits (456),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGL PPET  +F+EKN+YRELSEIA+QA++RA
Sbjct  791  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLNPPETEQIFSEKNNYRELSEIADQARKRA  850

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  851  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   180 bits (457),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ PET+N+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPETTNLFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+T+QQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   180 bits (457),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFT+KKDYG+EEREAQWA AQRTLHGLQPPET+N+F +KNSYRELSEIAEQAKRRA
Sbjct  860  EKKTAFTSKKDYGREEREAQWATAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010526268.1| PREDICTED: ATPase 5, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=956

 Score =   180 bits (457),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP + +NVF++KNSYRELSEIAEQAKRRA
Sbjct  862  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPADAANVFSDKNSYRELSEIAEQAKRRA  921

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  922  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   180 bits (457),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ P+T+N+F +KNSYRELSEIAEQAKRRA
Sbjct  856  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSYRELSEIAEQAKRRA  915

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+T+QQHYTV
Sbjct  916  EVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  950



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   180 bits (456),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGL+ PE+S++F +K+SYRELSEIAEQAKRRA
Sbjct  861  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLEAPESSSIFNDKSSYRELSEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  921  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   179 bits (455),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE  N+F EKNSYRELSEIAEQAKRRA
Sbjct  856  EKKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAVNLFNEKNSYRELSEIAEQAKRRA  915

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  916  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   179 bits (455),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ P+T+N+F +KNSYRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSPDTTNLFNDKNSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+T+QQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   179 bits (455),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTK +YGKEEREAQWA AQRTLHGLQPPET+N+F EK+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKSNYGKEEREAQWAAAQRTLHGLQPPETTNLFPEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|NP_180028.1| H(+)-ATPase 5 [Arabidopsis thaliana]
 gb|AAD23893.1| putative plasma membrane proton ATPase [Arabidopsis thaliana]
 gb|AEC07588.1| H(+)-ATPase 5 [Arabidopsis thaliana]
Length=931

 Score =   179 bits (454),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E +N+F EKNSY ELS+IAEQAKRRA
Sbjct  837  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAEKNNIFNEKNSYSELSQIAEQAKRRA  896

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ RLRE+NTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  897  EVVRLREINTLKGHVESVVKLKGLDIDTIQQHYTV  931



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =   179 bits (455),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP +T+ +F++K+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPAQTNTIFSDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            EMARLRELNTLKGHVESVVKLKGLDI+TIQQHYT+
Sbjct  920  EMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTL  954



>sp|Q9SJB3.3|PMA5_ARATH RecName: Full=ATPase 5, plasma membrane-type; AltName: Full=Proton 
pump 5 [Arabidopsis thaliana]
Length=949

 Score =   179 bits (453),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E +N+F EKNSY ELS+IAEQAKRRA
Sbjct  855  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAEKNNIFNEKNSYSELSQIAEQAKRRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ RLRE+NTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  915  EVVRLREINTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   179 bits (453),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFT+KKDYG+EEREAQWA AQRTLHGLQPPE SN+F EK+SYRELSEIAEQAKRRA
Sbjct  856  EKKTAFTSKKDYGREEREAQWALAQRTLHGLQPPEASNLFNEKSSYRELSEIAEQAKRRA  915

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  916  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_006293643.1| hypothetical protein CARUB_v10022598mg [Capsella rubella]
 gb|EOA26541.1| hypothetical protein CARUB_v10022598mg [Capsella rubella]
Length=931

 Score =   179 bits (453),  Expect = 3e-48, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP ET+N+F EKNSY +LS+IAEQAKRRA
Sbjct  837  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAETNNIFNEKNSYHDLSQIAEQAKRRA  896

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ RLRE+NTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  897  EVVRLREINTLKGHVESVVKLKGLDIDTIQQHYTV  931



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   179 bits (453),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPET+N+F +K+SYRELSEIAEQAKRRA
Sbjct  860  EKKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPETTNLFNDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010472461.1| PREDICTED: ATPase 5, plasma membrane-type [Camelina sativa]
Length=957

 Score =   179 bits (453),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP ET+N+F EKNSY ELS+IAEQAKRRA
Sbjct  863  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAETNNIFNEKNSYSELSQIAEQAKRRA  922

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ RLRE+N+LKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  923  EVVRLREINSLKGHVESVVKLKGLDIDTIQQHYTV  957



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   179 bits (453),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPP+T+N+F EK+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGREEREAQWAMAQRTLHGLQPPDTANLFPEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESV KLKGLDI+ IQQHYTV
Sbjct  920  EIARLRELHTLKGHVESVFKLKGLDIDNIQQHYTV  954



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   178 bits (452),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 86/95 (91%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E+KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPETS +F EKNSYRELSEIAEQAKRRA
Sbjct  859  ESKTAFTTKKDYGREEREAQWALAQRTLHGLQPPETSALFNEKNSYRELSEIAEQAKRRA  918

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI TIQQ YTV
Sbjct  919  EIARLRELNTLKGHVESVVKLKGLDISTIQQSYTV  953



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   178 bits (452),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGK EREAQWA AQRTLHGLQPPETS++F +K+SYRELSEIAEQAKRRA
Sbjct  860  QNKTAFTTKKDYGKGEREAQWALAQRTLHGLQPPETSSLFNDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =   178 bits (452),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPETSN+F + +SYRELSEIAEQAKRRA
Sbjct  873  QNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPETSNLFNDNSSYRELSEIAEQAKRRA  932

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  933  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  967



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   178 bits (452),  Expect = 6e-48, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPETSN+F + +SYRELSEIAEQAKRRA
Sbjct  858  QNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPETSNLFNDNSSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  918  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   178 bits (451),  Expect = 8e-48, Method: Composition-based stats.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNS-YRELSEIAEQAKRR  178
            E + AFTTKKDYGKEEREAQWAH QRTLHGLQPPE +N+F +KNS YRELSEIAEQAKRR
Sbjct  856  EQRVAFTTKKDYGKEEREAQWAHVQRTLHGLQPPEATNIFNDKNSNYRELSEIAEQAKRR  915

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  916  AEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   177 bits (450),  Expect = 9e-48, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            EN+TAFTTK +YGKEEREAQWA +QRTLHGLQPPET+N+F EK+SYRELSEIAEQAKRRA
Sbjct  860  ENRTAFTTKSNYGKEEREAQWAASQRTLHGLQPPETANLFAEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_003529784.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   177 bits (450),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGL PPET  +F+EKN+YRELSEIA+QA++RA
Sbjct  855  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLNPPETEQIFSEKNNYRELSEIADQARKRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  915  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =   177 bits (450),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFTTKKDYGK EREAQWA AQRTLHGLQPPETS +F +KN+YRELSEIAEQAKRRA
Sbjct  860  ERKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSELFNDKNNYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AFW04239.1| plasma membrane H+-ATPase [Sesuvium portulacastrum]
Length=953

 Score =   177 bits (449),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSN-VFTEKNSYRELSEIAEQAKRR  178
            E+KTAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE SN +F EKNSYRELSEIAEQAKRR
Sbjct  858  ESKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPEPSNHLFNEKNSYRELSEIAEQAKRR  917

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  918  AEVARLRELHTLKGHVESVVKLKGLDIDTIQQNYTV  953



>ref|XP_008666713.1| PREDICTED: plasma membrane ATPase-like, partial [Zea mays]
 ref|XP_008666716.1| PREDICTED: plasma membrane ATPase-like, partial [Zea mays]
Length=159

 Score =   164 bits (416),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 89/97 (92%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSN--VFTEKNSYRELSEIAEQAKR  175
            ENK AFTTKKDYG+ EREAQWA AQRTLHGLQPPE S+  +F +K+SYRELSEIAEQAKR
Sbjct  63   ENKAAFTTKKDYGRGEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYRELSEIAEQAKR  122

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQ +YTV
Sbjct  123  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQHNYTV  159



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =   177 bits (449),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE  TS +F +KNSYRELSEIAEQAKR
Sbjct  886  ENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKR  945

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  946  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  982



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   177 bits (449),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ PE +N+F +K+SYRELSEIAEQAKRRA
Sbjct  861  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQAPEAANLFNDKSSYRELSEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  921  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   177 bits (449),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYGKEEREAQWA AQRTLHGLQPPE S +F EK+SYRELSEIAEQAKRRA
Sbjct  858  DNKTAFTSKKDYGKEEREAQWALAQRTLHGLQPPEASGIFNEKSSYRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  918  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   177 bits (449),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 85/95 (89%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFTTKKDYG+EEREAQWA AQRTLHGLQPPETS +F EK+SYRELSEIAEQAKRRA
Sbjct  860  ERKTAFTTKKDYGREEREAQWATAQRTLHGLQPPETSTLFNEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI TIQQ YTV
Sbjct  920  EIARLRELNTLKGHVESVVKLKGLDISTIQQSYTV  954



>ref|XP_011045011.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Populus euphratica]
Length=954

 Score =   177 bits (448),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP +T+ +F++K+SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPAQTNTIFSDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            EMARLRELNTLKGHVESVVKLKGLDI+ IQQHYT+
Sbjct  920  EMARLRELNTLKGHVESVVKLKGLDIDRIQQHYTL  954



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   177 bits (448),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +N+TAFTTKKDYGKEEREAQWAHAQRTLHGLQ PE+S++F +K+SYRELSEIAEQAKRRA
Sbjct  861  DNRTAFTTKKDYGKEEREAQWAHAQRTLHGLQAPESSSLFNDKSSYRELSEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            EMARLREL TLKGHVESV KLKGLD+++IQQHYTV
Sbjct  921  EMARLRELTTLKGHVESVAKLKGLDLDSIQQHYTV  955



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   177 bits (448),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +N+TAF+TKKDYGKEEREAQWA AQRTLHGLQPPE S +F +K+SYRELSEIAEQAKRRA
Sbjct  856  DNRTAFSTKKDYGKEEREAQWALAQRTLHGLQPPEASTIFNDKSSYRELSEIAEQAKRRA  915

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  916  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   177 bits (448),  Expect = 2e-47, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQ PE +N+F +K+SYRELSEIAEQAKRRA
Sbjct  861  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQAPEAANLFNDKSSYRELSEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  921  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|AHK23067.1| plasma membrane ATPase 4 [Fagopyrum tataricum]
Length=965

 Score =   176 bits (447),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 85/102 (83%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSN-VFTEKNSYRELSEIAEQAKRR  178
            +NKTAFTTKKDYGKEEREAQWA AQRTLHGLQPP+T+N +F+EK+SYRELSEIAEQA+RR
Sbjct  859  DNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPPQTTNAMFSEKSSYRELSEIAEQARRR  918

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV*LKTLL  304
            AEMARLREL TLKGHVESV KLKG+DIETIQQ YTV ++TL+
Sbjct  919  AEMARLRELQTLKGHVESVAKLKGIDIETIQQSYTVLVETLI  960



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   176 bits (447),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE  TS +F +KNSYRELSEIAEQAKR
Sbjct  855  ENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKR  914

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  915  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   176 bits (447),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 86/97 (89%), Positives = 92/97 (95%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE  TS +F +KNSYRELSEIAEQAKR
Sbjct  865  ENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKR  924

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  925  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  961



>gb|ABW25091.1| plasma membrane proton pump [Cucumis sativus]
Length=953

 Score =   176 bits (446),  Expect = 3e-47, Method: Composition-based stats.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PETSNVFTEKNSYRELSEIAEQAKRR  178
            ENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE +++F EKNSYRELSEIAEQAKRR
Sbjct  858  ENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSEIAEQAKRR  917

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AE+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  918  AEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   176 bits (446),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E +TAFTTKKDYG+EEREAQWA AQRTLHGLQPPET+N+F++K+SYRELSEIAE+AKRRA
Sbjct  860  ERRTAFTTKKDYGREEREAQWAIAQRTLHGLQPPETTNLFSDKSSYRELSEIAEKAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004161788.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=953

 Score =   176 bits (445),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PETSNVFTEKNSYRELSEIAEQAKRR  178
            ENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE +++F EKNSYRELSEIAEQAKRR
Sbjct  858  ENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSEIAEQAKRR  917

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AE+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  918  AEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   176 bits (445),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NK AFTTKKDYGKEEREAQWA AQRTLHGLQPP+ S +  EK+SYRELSEIAEQAKRRA
Sbjct  860  DNKIAFTTKKDYGKEEREAQWAVAQRTLHGLQPPDASGILDEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            EMARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  920  EMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   176 bits (445),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 84/95 (88%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYGK EREAQWA AQRTLHGLQ PE +N+F EK+SYRELSEIAEQAKRRA
Sbjct  857  DNKTAFTTKKDYGKGEREAQWALAQRTLHGLQTPEATNIFNEKSSYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  917  EIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_004146327.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=953

 Score =   176 bits (445),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PETSNVFTEKNSYRELSEIAEQAKRR  178
            ENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE +++F EKNSYRELSEIAEQAKRR
Sbjct  858  ENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSEIAEQAKRR  917

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AE+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  918  AEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_007023380.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26002.1| H(+)-ATPase 9 [Theobroma cacao]
Length=926

 Score =   175 bits (444),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPET+++F EK +YRELSEIAEQA++RA
Sbjct  832  QNKTAFTTKKDYGRGEREAQWAMAQRTLHGLQPPETTDLFNEKTNYRELSEIAEQARKRA  891

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  892  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  926



>ref|XP_008453588.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=953

 Score =   176 bits (445),  Expect = 5e-47, Method: Composition-based stats.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PETSNVFTEKNSYRELSEIAEQAKRR  178
            ENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE +++F EKNSYRELSEIAEQAKRR
Sbjct  858  ENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSEIAEQAKRR  917

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AE+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  918  AEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|KGN65469.1| hypothetical protein Csa_1G423270 [Cucumis sativus]
Length=807

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 91/96 (95%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP-PETSNVFTEKNSYRELSEIAEQAKRR  178
            ENKTAFTTKKDYG+EEREAQWA  QRTLHGLQP PE +++F EKNSYRELSEIAEQAKRR
Sbjct  712  ENKTAFTTKKDYGREEREAQWAATQRTLHGLQPAPERASLFLEKNSYRELSEIAEQAKRR  771

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AE+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  772  AEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  807



>gb|KDO45595.1| hypothetical protein CISIN_1g044543mg [Citrus sinensis]
Length=962

 Score =   175 bits (444),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYG+ EREAQWA AQRTLHGL PPETS +  +KN+YRELSEIAEQAKRRA
Sbjct  868  ENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNYRELSEIAEQAKRRA  927

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  928  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   175 bits (444),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPP+ S +  +KNSYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTTKKDYGREEREAQWALAQRTLHGLQPPDLSGLLNDKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  920  EIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  954



>ref|XP_006465284.1| PREDICTED: ATPase 9, plasma membrane-type-like [Citrus sinensis]
Length=962

 Score =   175 bits (444),  Expect = 7e-47, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYG+ EREAQWA AQRTLHGL PPETS +  +KN+YRELSEIAEQAKRRA
Sbjct  868  ENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNYRELSEIAEQAKRRA  927

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  928  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>ref|XP_006427547.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
 gb|ESR40787.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
Length=962

 Score =   175 bits (443),  Expect = 8e-47, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYG+ EREAQWA AQRTLHGL PPETS +  +KN+YRELSEIAEQAKRRA
Sbjct  868  ENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPETSELLNDKNNYRELSEIAEQAKRRA  927

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  928  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>gb|KHN38020.1| Plasma membrane ATPase [Glycine soja]
Length=885

 Score =   174 bits (442),  Expect = 9e-47, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQW  AQRTLHGL PPET  +F+EKN+YRELS+IA+QA++RA
Sbjct  791  ENKTAFTTKKDYGKEEREAQWVTAQRTLHGLNPPETEQIFSEKNNYRELSDIADQARKRA  850

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL TLKGHVESVVKLKGLDI TIQQHYTV
Sbjct  851  EVARLRELYTLKGHVESVVKLKGLDIGTIQQHYTV  885



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   174 bits (442),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPP+TS +FTEK +YRELSE+AEQAKRRA
Sbjct  858  QNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNYRELSEMAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIE IQQHYTV
Sbjct  918  EVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  952



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/95 (89%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENK AFTTKKDYGKEEREAQWA AQRTLHGLQ PE + VF EK+SYRELSEIAEQAKRRA
Sbjct  859  ENKIAFTTKKDYGKEEREAQWALAQRTLHGLQTPEATTVFNEKSSYRELSEIAEQAKRRA  918

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  919  EIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  953



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =   174 bits (442),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFTTKKDYGK EREAQWA AQRTLHGLQPPETS +F +KN+Y ELSEIAEQAKRRA
Sbjct  860  ERKTAFTTKKDYGKGEREAQWATAQRTLHGLQPPETSELFNDKNNYGELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   174 bits (441),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 92/95 (97%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFTTKKDYG+EEREAQWA AQRTLHGLQPP+T+++F +K+SYRELSEIAEQAKRRA
Sbjct  860  ERKTAFTTKKDYGREEREAQWAIAQRTLHGLQPPDTTSLFNDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+T+QQHYTV
Sbjct  920  EIARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  954



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =   174 bits (441),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPP+TS +FTEK +YRELSE+AEQAKRRA
Sbjct  864  QNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNYRELSEMAEQAKRRA  923

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIE IQQHYTV
Sbjct  924  EVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  958



>ref|XP_009390572.1| PREDICTED: ATPase 9, plasma membrane-type [Musa acuminata subsp. 
malaccensis]
Length=949

 Score =   174 bits (440),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQP +TS++F +K+SYRELSEIAEQAKRRA
Sbjct  855  QNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPADTSDLFNDKSSYRELSEIAEQAKRRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  915  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   174 bits (440),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPP+TS +FTEK +YRELSE+AEQAKRRA
Sbjct  856  QNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPPQTSELFTEKGNYRELSEMAEQAKRRA  915

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIE IQQHYTV
Sbjct  916  EVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  950



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =   174 bits (440),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE  T+ +F +K+SYRELSEIAEQAKR
Sbjct  855  ENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATNTLFNDKSSYRELSEIAEQAKR  914

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  915  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_008386550.1| PREDICTED: ATPase 9, plasma membrane-type-like [Malus domestica]
Length=962

 Score =   174 bits (440),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 90/95 (95%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGK +REAQWA AQRTLHGLQPPET+ +F +KN YRELSEIAEQAK+RA
Sbjct  869  ENKTAFTTKKDYGKGDREAQWATAQRTLHGLQPPETAELFHDKN-YRELSEIAEQAKKRA  927

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  928  EVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  962



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   173 bits (439),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYG+ EREAQWA AQRTLHGLQ P+TS +F +KNSYRELSEIAEQAKRRA
Sbjct  856  QNKTAFTSKKDYGRGEREAQWAMAQRTLHGLQSPDTSALFNDKNSYRELSEIAEQAKRRA  915

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  916  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>gb|AAO72564.1| plasma membrane H+-ATPase-like protein [Oryza sativa Japonica 
Group]
Length=503

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSN--VFTEKNSYRELSEIAEQAKR  175
            ENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ++  +F +K+SYRELSEIAEQAKR
Sbjct  407  ENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKR  466

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  467  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  503



>gb|ACL54575.1| unknown [Zea mays]
Length=951

 Score =   173 bits (439),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSN--VFTEKNSYRELSEIAEQAKR  175
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE S+  +F +K+SYRELSEIAEQAKR
Sbjct  855  ENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYRELSEIAEQAKR  914

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  915  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_008668762.1| PREDICTED: plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score =   173 bits (438),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSN--VFTEKNSYRELSEIAEQAKR  175
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE S+  +F +K+SYRELSEIAEQAKR
Sbjct  855  ENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYRELSEIAEQAKR  914

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  915  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_004960134.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=951

 Score =   173 bits (438),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 83/97 (86%), Positives = 92/97 (95%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE  ++ +F +K+SYRELSEIAEQAKR
Sbjct  855  ENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAASNTLFNDKSSYRELSEIAEQAKR  914

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  915  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_009399551.1| PREDICTED: plasma membrane ATPase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1008

 Score =   173 bits (439),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2     ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
             +NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ P+TS +F + NSYRELSEIA+QA RRA
Sbjct  914   QNKTAFTTKKDYGREEREAQWALAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRA  973

Query  182   EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
             E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  974   EVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  1008



>dbj|BAL41366.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   173 bits (438),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE  ++ +F EK+SYRELSEIAEQAKR
Sbjct  855  ENKTAFTTKKDYGREEREAQWAAAQRTLHGLQPPEVASNTLFNEKSSYRELSEIAEQAKR  914

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  915  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFT+KKDYGKEEREAQWA AQRTLHGLQPPETSN  ++K SYRELSEIAEQAKRRA
Sbjct  721  ENKTAFTSKKDYGKEEREAQWATAQRTLHGLQPPETSNQKSDKGSYRELSEIAEQAKRRA  780

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYT  283
            E+ARLREL+TLKGHVESVVKLKGLDI++IQQHYT
Sbjct  781  EVARLRELHTLKGHVESVVKLKGLDIDSIQQHYT  814



>ref|XP_011010708.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=951

 Score =   173 bits (438),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREA WA AQRTLHGLQPPET+ VF EK+ YRELSEIAEQAKRRA
Sbjct  857  ENKTAFTTKKDYGKEEREAHWALAQRTLHGLQPPETAGVFNEKSGYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGH ESVVKLKGLDI+TIQQH TV
Sbjct  917  EVARLRELHTLKGHDESVVKLKGLDIDTIQQHCTV  951



>ref|XP_009399552.1| PREDICTED: plasma membrane ATPase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=982

 Score =   173 bits (438),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ P+TS +F + NSYRELSEIA+QA RRA
Sbjct  888  QNKTAFTTKKDYGREEREAQWALAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRA  947

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  948  EVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  982



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   173 bits (438),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFT+KKDYGKEEREAQWA AQRTLHGLQPPETSN  ++K SYRELSEIAEQAKRRA
Sbjct  860  ENKTAFTSKKDYGKEEREAQWATAQRTLHGLQPPETSNQKSDKGSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYT  283
            E+ARLREL+TLKGHVESVVKLKGLDI++IQQHYT
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDSIQQHYT  953



>ref|XP_009399553.1| PREDICTED: plasma membrane ATPase isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=981

 Score =   173 bits (438),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ P+TS +F + NSYRELSEIA+QA RRA
Sbjct  887  QNKTAFTTKKDYGREEREAQWALAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRA  946

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  947  EVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  981



>emb|CDO98206.1| unnamed protein product [Coffea canephora]
Length=956

 Score =   172 bits (437),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGL PPE S++  +KN+YRELSEIAEQAK+RA
Sbjct  862  QNKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPENSDILNDKNNYRELSEIAEQAKKRA  921

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  922  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  956



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =   172 bits (437),  Expect = 5e-46, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYGK EREAQWA AQRTLHGLQ  +TS++F +KNSYRELSEIAEQAKRRA
Sbjct  860  QNKTAFTSKKDYGKGEREAQWATAQRTLHGLQTADTSSLFNDKNSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_009399554.1| PREDICTED: plasma membrane ATPase isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score =   172 bits (437),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ P+TS +F + NSYRELSEIA+QA RRA
Sbjct  861  QNKTAFTTKKDYGREEREAQWALAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  921  EVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   172 bits (437),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 84/96 (88%), Positives = 91/96 (95%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-TSNVFTEKNSYRELSEIAEQAKRR  178
            ENKTAFT KKDYGKEEREAQWAHAQRTLHGL  PE TS++F +KN+YRELSEIAEQAKRR
Sbjct  863  ENKTAFTNKKDYGKEEREAQWAHAQRTLHGLSAPEETSSLFNDKNTYRELSEIAEQAKRR  922

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AE+ARLREL+TLKGHVESVVKLKGLDIET+QQHYTV
Sbjct  923  AEVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  958



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   172 bits (437),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENKTAFTTKKDYG+EEREAQWA AQRTLHGLQPPE  ++ +F EK+SYRELSEIAEQAKR
Sbjct  855  ENKTAFTTKKDYGREEREAQWAAAQRTLHGLQPPEVASNTLFNEKSSYRELSEIAEQAKR  914

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  915  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_003531728.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   172 bits (437),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQW  AQRTLHGL PPET  +F+EKN YRELS+IA+QA++RA
Sbjct  855  ENKTAFTTKKDYGKEEREAQWVTAQRTLHGLNPPETEQIFSEKNKYRELSDIADQARKRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL TLKGHVESVVKLKGLDI TIQQHYTV
Sbjct  915  EVARLRELYTLKGHVESVVKLKGLDIGTIQQHYTV  949



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =   172 bits (437),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NK AF+TK+DYGK EREAQWAHAQRTLHGLQ PE  N+F EK+SYRELSEIAEQAKRRA
Sbjct  860  DNKIAFSTKQDYGKGEREAQWAHAQRTLHGLQNPEAGNLFNEKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007135798.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
 gb|ESW07792.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
Length=949

 Score =   172 bits (437),  Expect = 6e-46, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGL PPET   F+E+N+YRELSEIAEQA++RA
Sbjct  855  ENKTAFTTKKDYGKEEREAQWATAQRTLHGLNPPETEPTFSERNNYRELSEIAEQARKRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGH+ESVVKLKGLDI+TIQ HYTV
Sbjct  915  EVARLRELHTLKGHMESVVKLKGLDIDTIQHHYTV  949



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   172 bits (437),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYG+ EREAQW  AQRTLHGLQPP+TS +F +KN Y ELSEIAEQAKRRA
Sbjct  885  QNKTAFTSKKDYGRGEREAQWVMAQRTLHGLQPPDTSGLFNDKNGYTELSEIAEQAKRRA  944

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  945  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  979



>ref|XP_002527322.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF35074.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=733

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 90/95 (95%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQPPET+ +F +KN YRELSEIAEQAKRRA
Sbjct  640  QNKTAFTTKKDYGRGEREAQWAAAQRTLHGLQPPETAEIFQDKN-YRELSEIAEQAKRRA  698

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  699  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  733



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   172 bits (436),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPETS++F +K +YRELSEIAEQAK+RA
Sbjct  857  QNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSDLFNDKTNYRELSEIAEQAKKRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>gb|KFK32649.1| hypothetical protein AALP_AA6G270500 [Arabis alpina]
Length=838

 Score =   171 bits (433),  Expect = 9e-46, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFT KKDYGKEEREAQWA AQRTLHGLQP E +N+F EKNS+ ELSEIAEQAKRRA
Sbjct  744  ENKTAFTMKKDYGKEEREAQWAAAQRTLHGLQPAERNNIFNEKNSFSELSEIAEQAKRRA  803

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ RLRELNTLK  VESVVKLKGLDI+TIQQHYTV
Sbjct  804  EVVRLRELNTLKRQVESVVKLKGLDIDTIQQHYTV  838



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   172 bits (435),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYG+ EREAQW  AQRTLHGLQPP+TS +F +KN Y ELSEIAEQAKRRA
Sbjct  856  QNKTAFTSKKDYGRGEREAQWVMAQRTLHGLQPPDTSGLFNDKNGYTELSEIAEQAKRRA  915

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  916  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYGK EREAQWA AQRTLHGLQ  +TSN+F +KN+YRELSEIAEQAKRRA
Sbjct  857  QNKTAFTSKKDYGKGEREAQWATAQRTLHGLQTADTSNLFNDKNNYRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>dbj|BAG94605.1| unnamed protein product [Oryza sativa Japonica Group]
Length=908

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE  ++ +F +K+SYRELSEIAEQAKR
Sbjct  812  ENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKR  871

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  872  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  908



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYGK EREAQWA AQRTLHGLQPPE+S +F +K +YREL+E+AEQAKRRA
Sbjct  860  QNKTAFTSKKDYGKGEREAQWALAQRTLHGLQPPESSQIFNDKTNYRELTELAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_009417440.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   171 bits (434),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYG+ EREAQWA AQRTLHGLQP +T  +F +K+SYRELSEIAEQAK+RA
Sbjct  862  ENKTAFTTKKDYGRGEREAQWALAQRTLHGLQPADTPGLFNDKSSYRELSEIAEQAKKRA  921

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  922  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  956



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   171 bits (432),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPETS +F +K +YRELSEIAEQAK+RA
Sbjct  796  QNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNYRELSEIAEQAKKRA  855

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  856  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  890



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   171 bits (433),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPETS +F +K +YRELSEIAEQAK+RA
Sbjct  857  QNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNYRELSEIAEQAKKRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>gb|ABR18001.1| unknown [Picea sitchensis]
Length=955

 Score =   171 bits (433),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 90/95 (95%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFT+KKDYGKEEREAQWAHAQRTLHGL PPET ++F E++SYRELSEIAEQAKRRA
Sbjct  862  ERKTAFTSKKDYGKEEREAQWAHAQRTLHGLHPPET-HLFNERSSYRELSEIAEQAKRRA  920

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQ YTV
Sbjct  921  EVARLRELNTLKGHVESVVKLKGLDIDTIQQSYTV  955



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   171 bits (433),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYGK EREAQWA AQRTLHGLQ P+TS  F +K+SY+ELSEIAEQAKRRA
Sbjct  856  QNKTAFTSKKDYGKGEREAQWAMAQRTLHGLQSPDTSGFFNDKSSYKELSEIAEQAKRRA  915

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHV+SVVKLKGLDIETIQQHYTV
Sbjct  916  EVARLRELHTLKGHVDSVVKLKGLDIETIQQHYTV  950



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   171 bits (433),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +N+TAFT+KKDYG  EREAQWA AQRTLHGLQPPETS +F +K +YRELSEIAEQAK+RA
Sbjct  857  QNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPPETSELFNDKTNYRELSEIAEQAKKRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   171 bits (432),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 90/95 (95%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +N+TAFTTKKDYG+ EREAQWA AQRTLHGLQPPET+ +F +KN YRELSEIAEQAKRRA
Sbjct  859  QNRTAFTTKKDYGRGEREAQWAAAQRTLHGLQPPETAELFQDKN-YRELSEIAEQAKRRA  917

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  918  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>emb|CAD29313.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=948

 Score =   171 bits (432),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE  ++ +F +K+SYRELSEIAEQAKR
Sbjct  852  ENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKR  911

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  912  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  948



>ref|XP_010429432.1| PREDICTED: ATPase 5, plasma membrane-type-like isoform X2 [Camelina 
sativa]
Length=958

 Score =   170 bits (431),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +2

Query  8    KTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRAEM  187
            +TAFTTKKDYGKEEREAQWA AQRTLHGLQP E +N+F EKNSY ELS+IAEQAKRRAE+
Sbjct  866  QTAFTTKKDYGKEEREAQWAAAQRTLHGLQPAEKNNIFNEKNSYSELSQIAEQAKRRAEV  925

Query  188  ARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
             RLRE+N+LKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  926  VRLREINSLKGHVESVVKLKGLDIDTIQQHYTV  958



>gb|KHN22411.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=916

 Score =   170 bits (430),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            EN+ AFTTKKDYGK EREAQWA AQRTLHGL PPET  +  EKN+YRELSE+AEQAK+RA
Sbjct  822  ENRVAFTTKKDYGKGEREAQWAAAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRA  881

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIET+QQHYTV
Sbjct  882  EVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  916



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score =   170 bits (431),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSN--VFTEKNSYRELSEIAEQAKR  175
            ENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE ++  +F +K+SYRELSEIAEQAKR
Sbjct  855  ENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNALFNDKSSYRELSEIAEQAKR  914

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  915  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>gb|EAZ32257.1| hypothetical protein OsJ_16461 [Oryza sativa Japonica Group]
Length=951

 Score =   170 bits (430),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE  ++ +F +K+SYRELSEIAEQAKR
Sbjct  855  ENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKR  914

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  915  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|NP_001054118.1| Os04g0656100 [Oryza sativa Japonica Group]
 sp|Q7XPY2.1|PMA1_ORYSJ RecName: Full=Plasma membrane ATPase; AltName: Full=Proton pump 
[Oryza sativa Japonica Group]
 emb|CAE03410.3| OSJNBa0071I13.11 [Oryza sativa Japonica Group]
 dbj|BAF16032.1| Os04g0656100 [Oryza sativa Japonica Group]
 emb|CAH66693.1| OSIGBa0158D24.1 [Oryza sativa Indica Group]
 gb|EAY95868.1| hypothetical protein OsI_17734 [Oryza sativa Indica Group]
Length=951

 Score =   170 bits (430),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE--TSNVFTEKNSYRELSEIAEQAKR  175
            ENK AFTTKKDYG+EEREAQWA AQRTLHGLQPPE  ++ +F +K+SYRELSEIAEQAKR
Sbjct  855  ENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKR  914

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLRELNTLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  915  RAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>dbj|BAD94367.1| plasma membrane proton ATPase [Arabidopsis thaliana]
Length=262

 Score =   160 bits (406),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +N+TAFTTKKDYG  EREAQWA AQRTLHGLQP E  N+F EK SYRELSEIAEQAKRRA
Sbjct  168  DNRTAFTTKKDYGIGEREAQWAQAQRTLHGLQPKEDVNIFPEKGSYRELSEIAEQAKRRA  227

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESV KLKGLDI+T   HYTV
Sbjct  228  EIARLRELHTLKGHVESVAKLKGLDIDTAGHHYTV  262



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =   169 bits (428),  Expect = 9e-45, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFTTKKDYGK EREAQWA AQRTLHGLQ  ET+ +F++KN+YRELSEIAEQAKRRA
Sbjct  860  ERKTAFTTKKDYGKGEREAQWATAQRTLHGLQSAETAELFSDKNNYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KFK42449.1| hypothetical protein AALP_AA2G258100 [Arabis alpina]
Length=953

 Score =   169 bits (428),  Expect = 9e-45, Method: Composition-based stats.
 Identities = 78/95 (82%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFT+KKDYGK EREAQWA AQRTLHGLQPP+TS++F +K++YRELSEIA+QAKRRA
Sbjct  859  ENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQPPQTSDMFNDKSTYRELSEIADQAKRRA  918

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRE +TLKGHVESVVK KGLDIE IQQHYT+
Sbjct  919  EVARLRECHTLKGHVESVVKQKGLDIEAIQQHYTL  953



>ref|XP_010097155.1| ATPase 9, plasma membrane-type [Morus notabilis]
 gb|EXB67222.1| ATPase 9, plasma membrane-type [Morus notabilis]
Length=878

 Score =   169 bits (427),  Expect = 9e-45, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 90/95 (95%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEK-NSYRELSEIAEQAKRR  178
            +NKTAFTTKKDYG+EEREAQWA A RTLHGLQ P+TS++FT+K  SYRELSEIAEQAK+R
Sbjct  783  QNKTAFTTKKDYGREEREAQWAMAHRTLHGLQAPQTSDIFTDKATSYRELSEIAEQAKKR  842

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYT  283
            AE+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYT
Sbjct  843  AEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYT  877



>ref|XP_009117122.1| PREDICTED: ATPase 5, plasma membrane-type [Brassica rapa]
Length=956

 Score =   169 bits (428),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP ET+ +F EKN Y ELSEIAEQAKRRA
Sbjct  862  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPRETNIIFNEKNCYSELSEIAEQAKRRA  921

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTL G VESVVKL+GLDI+ IQQHYTV
Sbjct  922  EVARLRELNTLTGQVESVVKLRGLDIDAIQQHYTV  956



>emb|CDY34767.1| BnaA09g41340D [Brassica napus]
Length=956

 Score =   169 bits (428),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP ET+ +F EKN Y ELSEIAEQAKRRA
Sbjct  862  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPRETNIIFNEKNCYSELSEIAEQAKRRA  921

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTL G VESVVKL+GLDI+ IQQHYTV
Sbjct  922  EVARLRELNTLTGQVESVVKLRGLDIDAIQQHYTV  956



>ref|XP_003547446.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   169 bits (427),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            EN+ AFTTKKDYGK EREAQWA AQRTLHGL PPET  +  EKN+YRELSE+AEQAK+RA
Sbjct  855  ENRVAFTTKKDYGKGEREAQWAAAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIET+QQHYTV
Sbjct  915  EVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  949



>ref|XP_003543699.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   169 bits (427),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            EN+ AFTTKKDYGK EREAQWA AQRTLHGL PPET  +  EKN+YRELSE+AEQAK+RA
Sbjct  855  ENRVAFTTKKDYGKGEREAQWAAAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIET+QQHYTV
Sbjct  915  EVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  949



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   169 bits (427),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFT+KKDYG+EEREAQWA AQRTLHGLQP ETS +F+EK+SY ELSEIAEQAKRRA
Sbjct  860  ERKTAFTSKKDYGREEREAQWATAQRTLHGLQPRETSTLFSEKSSYHELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+A+LRELNTLKGHVESVVKLKGLDI TIQQ YTV
Sbjct  920  EIAKLRELNTLKGHVESVVKLKGLDINTIQQSYTV  954



>ref|XP_010539422.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Tarenaya hassleriana]
Length=885

 Score =   168 bits (426),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 79/95 (83%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+EEREAQWA AQRTLHGLQP E +N+F EK SYRELSEIAEQAKRRA
Sbjct  791  DNKTAFTTKKDYGREEREAQWATAQRTLHGLQPKEGANIFPEKGSYRELSEIAEQAKRRA  850

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+    HYTV
Sbjct  851  EIARLRELHTLKGHVESVVKLKGLDIDAPAGHYTV  885



>gb|KEH39623.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =   169 bits (427),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            EN+TAFT+KKDYGK EREAQWA AQRTLHGL PPET  V  E N+YRELSE+A+QAK+RA
Sbjct  855  ENRTAFTSKKDYGKGEREAQWAAAQRTLHGLNPPETDQVLNESNNYRELSELADQAKKRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  915  EIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =   169 bits (427),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E KTAFTTKKDYG+ EREAQWA AQRTLHGLQ  ET+ +F++KN+YRELSEIAEQAKRRA
Sbjct  860  ERKTAFTTKKDYGRGEREAQWATAQRTLHGLQSAETAELFSDKNNYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  920  EVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|EPS63245.1| hypothetical protein M569_11541, partial [Genlisea aurea]
Length=935

 Score =   168 bits (426),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTK +YGKE+REAQWA AQRTLHGLQ  ETS+V  EKNSYRELSEIAEQAK+RA
Sbjct  841  ENKTAFTTKSNYGKEDREAQWALAQRTLHGLQTTETSSVMNEKNSYRELSEIAEQAKKRA  900

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  901  EIARLRELHTLKGHVESVVKLKGLDIETIQQNYTV  935



>dbj|BAA08134.1| putative plasma membrane H+-ATPase [Zostera marina]
Length=952

 Score =   168 bits (426),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 82/96 (85%), Positives = 89/96 (93%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPE-TSNVFTEKNSYRELSEIAEQAKRR  178
            ENKTAFT+KKDYG+EEREAQWA AQRTLHGLQ  E T+N+F +K  YRELSEIAEQAKRR
Sbjct  857  ENKTAFTSKKDYGREEREAQWATAQRTLHGLQTAESTTNIFPDKGGYRELSEIAEQAKRR  916

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AE+ARLRELNTLKGHVESVVKLKGLDIETIQQ+YTV
Sbjct  917  AEVARLRELNTLKGHVESVVKLKGLDIETIQQNYTV  952



>gb|AAK60570.1| H+-ATPase [Triticum aestivum]
Length=136

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 89/97 (92%), Gaps = 2/97 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSN--VFTEKNSYRELSEIAEQAKR  175
            +NKTAFTTK++YGK EREAQWA AQRTLHGLQ PE ++  +F +K+SYRELSEIAEQAKR
Sbjct  40   QNKTAFTTKENYGKGEREAQWATAQRTLHGLQAPEPASHTLFNDKSSYRELSEIAEQAKR  99

Query  176  RAEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            RAE+ARLR+LNTLKGHVESVVKLKGLDI+TI Q+YTV
Sbjct  100  RAEIARLRKLNTLKGHVESVVKLKGLDIDTINQNYTV  136



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   168 bits (426),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 82/96 (85%), Positives = 91/96 (95%), Gaps = 1/96 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETS-NVFTEKNSYRELSEIAEQAKRR  178
            E+KTAFT+KKDYGKEEREAQWA AQRTLHGLQ PE+S  +F +KNSYRELSEIAEQAKRR
Sbjct  858  ESKTAFTSKKDYGKEEREAQWALAQRTLHGLQAPESSATLFNDKNSYRELSEIAEQAKRR  917

Query  179  AEMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            AE+ARLREL+TLKGHVESVVKLKGLDI+TIQQ+YTV
Sbjct  918  AEVARLRELHTLKGHVESVVKLKGLDIDTIQQNYTV  953



>ref|XP_004486623.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=949

 Score =   168 bits (426),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 78/95 (82%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +N+TAFTTKKDYG+ EREAQWA AQRTLHGL PPET  V  E N+YR+LSE+AEQAK+RA
Sbjct  855  DNRTAFTTKKDYGRGEREAQWAAAQRTLHGLNPPETEQVLNESNNYRDLSELAEQAKKRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  915  EIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   168 bits (425),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +N+TAFTTKKDYGKEEREAQWA AQRT+HGL+  +  N+FT+K+SYRELSEIAEQAKRRA
Sbjct  860  DNRTAFTTKKDYGKEEREAQWALAQRTMHGLKTNDAGNLFTDKSSYRELSEIAEQAKRRA  919

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  920  EIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_010525721.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   168 bits (425),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 87/95 (92%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQP E+ +VF EK  YRELSEIAEQAKRRA
Sbjct  855  ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPKESVDVFPEKGGYRELSEIAEQAKRRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIET   HYTV
Sbjct  915  EIARLRELHTLKGHVESVVKLKGLDIET-PGHYTV  948



>gb|KHN31888.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=841

 Score =   167 bits (423),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            EN+ AFTTKKDYGK EREAQWA AQRTLHGL PPET  +  EKN+YRELSE+AEQAK+RA
Sbjct  747  ENRVAFTTKKDYGKGEREAQWAAAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRA  806

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIET+QQHYTV
Sbjct  807  EVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  841



>ref|XP_010438207.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   168 bits (425),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 85/95 (89%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFT KKDYGKEEREAQWAHAQRTLHGLQP E  N F EK SYRELSEIAEQAKRRA
Sbjct  855  ENKTAFTMKKDYGKEEREAQWAHAQRTLHGLQPKEADNTFPEKGSYRELSEIAEQAKRRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIET   HYTV
Sbjct  915  EIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  948



>ref|XP_007150788.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
 gb|ESW22782.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
Length=949

 Score =   168 bits (425),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 78/95 (82%), Positives = 86/95 (91%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            EN+ AFT+K DYGK EREAQWA AQRTLHGL PPET  +  EKN+YRELSE+AEQAK+RA
Sbjct  855  ENRVAFTSKNDYGKGEREAQWAAAQRTLHGLNPPETDEMLNEKNNYRELSELAEQAKKRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  915  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>ref|XP_010433017.1| PREDICTED: ATPase 2, plasma membrane-type [Camelina sativa]
Length=948

 Score =   168 bits (425),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 83/95 (87%), Positives = 85/95 (89%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFT KKDYGKEEREAQWAHAQRTLHGLQP E  N F EK SYRELSEIAEQAKRRA
Sbjct  855  ENKTAFTMKKDYGKEEREAQWAHAQRTLHGLQPKEADNTFPEKGSYRELSEIAEQAKRRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIET   HYTV
Sbjct  915  EIARLRELHTLKGHVESVVKLKGLDIET-PSHYTV  948



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   167 bits (424),  Expect = 3e-44, Method: Composition-based stats.
 Identities = 79/95 (83%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYG+ EREAQWA AQRTLHGLQ  +TS +F +K+SYRELSE+AEQAKRRA
Sbjct  862  QNKTAFTSKKDYGRGEREAQWALAQRTLHGLQTADTSVLFNDKSSYRELSEVAEQAKRRA  921

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  922  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  956



>ref|XP_006343689.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=951

 Score =   167 bits (424),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 88/95 (93%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ PE S +F +KN YRELSEIAEQAKRRA
Sbjct  858  QNKTAFTTKKDYGRGEREAQWALAQRTLHGLQTPEASGLFNDKN-YRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>emb|CDP14275.1| unnamed protein product [Coffea canephora]
Length=635

 Score =   165 bits (418),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 90/95 (95%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ PE++ +F +K+ YRELSEIAEQAKRRA
Sbjct  542  QNKTAFTTKKDYGREEREAQWALAQRTLHGLQTPESAGLFNDKH-YRELSEIAEQAKRRA  600

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  601  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  635



>ref|XP_004146701.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004165941.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=948

 Score =   167 bits (423),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 89/95 (94%), Gaps = 2/95 (2%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGK EREAQWA AQRT+HGLQPPET  +F EK++Y +LSEIAEQAK+RA
Sbjct  856  ENKTAFTTKKDYGKGEREAQWAIAQRTMHGLQPPET--IFHEKSNYEDLSEIAEQAKKRA  913

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  914  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  948



>dbj|BAF03589.1| P-type H+-ATPase [Zostera marina]
Length=964

 Score =   167 bits (423),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 79/95 (83%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+EEREAQWA AQRTLHGLQ  E+  +F +  +YRELSEIAEQAKRRA
Sbjct  870  DNKTAFTTKKDYGREEREAQWATAQRTLHGLQTNESQTLFADTRNYRELSEIAEQAKRRA  929

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRELNTLKGHVESVVKLKGLDI+TIQQHYTV
Sbjct  930  EVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  964



>ref|XP_004253510.2| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum lycopersicum]
Length=951

 Score =   167 bits (423),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ PE + +F +KN YRELSEIAEQAKRRA
Sbjct  858  QNKTAFTTKKDYGRGEREAQWALAQRTLHGLQTPEAAGLFNDKN-YRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   167 bits (422),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 82/95 (86%), Positives = 87/95 (92%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP E+ N+F EK SYRELSEIAEQAKRRA
Sbjct  855  ENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPKESGNIFPEKGSYRELSEIAEQAKRRA  914

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDI+T   HYTV
Sbjct  915  EIARLRELHTLKGHVESVVKLKGLDIDT-PGHYTV  948



>ref|XP_006343688.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=951

 Score =   167 bits (422),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ PE + +F +KN YRELSEIAEQAKRRA
Sbjct  858  QNKTAFTTKKDYGRGEREAQWALAQRTLHGLQTPEAAGLFNDKN-YRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>emb|CDX76810.1| BnaC08g33960D [Brassica napus]
Length=854

 Score =   166 bits (421),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 80/95 (84%), Positives = 85/95 (89%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            ENKTAFTTKKDYGKEEREAQWA AQRTLHGLQP ET+ +F EKN Y ELSEIAEQAKRRA
Sbjct  760  ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPRETNIIFNEKNCYSELSEIAEQAKRRA  819

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TL G VESVVKL GLDI+ IQQHYTV
Sbjct  820  EVARLRELSTLTGQVESVVKLGGLDIDAIQQHYTV  854



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score =   167 bits (422),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 78/95 (82%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            E K AFT+KKDYG+EEREAQWA AQRTLHGLQPPET  +F EK+SY ELSEIAEQA+RRA
Sbjct  863  ERKIAFTSKKDYGREEREAQWATAQRTLHGLQPPETRTLFHEKSSYHELSEIAEQARRRA  922

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLRE+NTLKGHVESVVKLKG+DI+TIQQ YTV
Sbjct  923  EVARLREMNTLKGHVESVVKLKGIDIDTIQQSYTV  957



>ref|XP_009410182.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   166 bits (421),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 79/95 (83%), Positives = 88/95 (93%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYGK EREAQWA AQRTLHGL PPET+ +F EK SYRELSEIAEQAKRRA
Sbjct  790  QNKTAFTSKKDYGKGEREAQWALAQRTLHGLHPPETTGLFDEK-SYRELSEIAEQAKRRA  848

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGL+IE +QQHYT+
Sbjct  849  EVARLRELHTLKGHVESVVKLKGLNIENMQQHYTL  883



>ref|XP_009410181.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=883

 Score =   166 bits (421),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 79/95 (83%), Positives = 88/95 (93%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFT+KKDYGK EREAQWA AQRTLHGL PPET+ +F EK SYRELSEIAEQAKRRA
Sbjct  790  QNKTAFTSKKDYGKGEREAQWALAQRTLHGLHPPETTGLFDEK-SYRELSEIAEQAKRRA  848

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGL+IE +QQHYT+
Sbjct  849  EVARLRELHTLKGHVESVVKLKGLNIENMQQHYTL  883



>ref|XP_004242977.2| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum lycopersicum]
Length=951

 Score =   167 bits (422),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 81/95 (85%), Positives = 88/95 (93%), Gaps = 1/95 (1%)
 Frame = +2

Query  2    ENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPETSNVFTEKNSYRELSEIAEQAKRRA  181
            +NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ PE + +F +KN YRELSEIAEQAKRRA
Sbjct  858  QNKTAFTTKKDYGRGEREAQWALAQRTLHGLQTPEAAGLFNDKN-YRELSEIAEQAKRRA  916

Query  182  EMARLRELNTLKGHVESVVKLKGLDIETIQQHYTV  286
            E+ARLREL+TLKGHVESVVKLKGLDIETIQQHYTV
Sbjct  917  EVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 692065518870