BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c102724_g1_i1 len=262 path=[1:0-261]

Length=262
                                                                      Score     E

ref|XP_004236423.1|  PREDICTED: pentatricopeptide repeat-containi...    160   7e-44   
ref|XP_010275265.1|  PREDICTED: pentatricopeptide repeat-containi...    159   2e-43   
ref|XP_009601536.1|  PREDICTED: pentatricopeptide repeat-containi...    159   3e-43   
ref|XP_008374833.1|  PREDICTED: pentatricopeptide repeat-containi...    159   3e-43   
ref|XP_008240171.1|  PREDICTED: pentatricopeptide repeat-containi...    159   4e-43   
ref|XP_006341567.1|  PREDICTED: pentatricopeptide repeat-containi...    158   5e-43   
ref|XP_009356059.1|  PREDICTED: pentatricopeptide repeat-containi...    157   1e-42   
ref|XP_009769078.1|  PREDICTED: pentatricopeptide repeat-containi...    156   2e-42   
ref|XP_007210320.1|  hypothetical protein PRUPE_ppa002162mg             153   2e-41   
ref|XP_011084409.1|  PREDICTED: pentatricopeptide repeat-containi...    151   2e-40   
ref|XP_003634283.1|  PREDICTED: pentatricopeptide repeat-containi...    150   4e-40   
emb|CBI15551.3|  unnamed protein product                                149   4e-40   
ref|XP_004503293.1|  PREDICTED: pentatricopeptide repeat-containi...    150   4e-40   
ref|XP_004301257.1|  PREDICTED: pentatricopeptide repeat-containi...    149   7e-40   
ref|XP_010533968.1|  PREDICTED: pentatricopeptide repeat-containi...    148   2e-39   
ref|XP_006490750.1|  PREDICTED: pentatricopeptide repeat-containi...    148   2e-39   
ref|XP_008453471.1|  PREDICTED: pentatricopeptide repeat-containi...    147   6e-39   
emb|CDO98371.1|  unnamed protein product                                147   6e-39   
ref|XP_011039111.1|  PREDICTED: pentatricopeptide repeat-containi...    147   7e-39   
gb|KDO62894.1|  hypothetical protein CISIN_1g004024mg                   147   8e-39   
ref|XP_008797547.1|  PREDICTED: pentatricopeptide repeat-containi...    145   2e-38   
ref|XP_003524346.2|  PREDICTED: pentatricopeptide repeat-containi...    145   2e-38   
ref|XP_007036762.1|  Tetratricopeptide repeat (TPR)-like superfam...    145   3e-38   
ref|XP_002872815.1|  pentatricopeptide repeat-containing protein        144   5e-38   
ref|XP_002318526.2|  pentatricopeptide repeat-containing family p...    142   6e-38   Populus trichocarpa [western balsam poplar]
gb|KHN21662.1|  Pentatricopeptide repeat-containing protein             145   7e-38   
ref|XP_009402626.1|  PREDICTED: pentatricopeptide repeat-containi...    144   8e-38   
ref|XP_010087050.1|  hypothetical protein L484_012294                   144   1e-37   
ref|XP_010455917.1|  PREDICTED: pentatricopeptide repeat-containi...    142   5e-37   
ref|XP_006451657.1|  hypothetical protein CICLE_v10007619mg             141   7e-37   
ref|NP_192184.1|  pentatricopeptide repeat-containing protein           141   9e-37   Arabidopsis thaliana [mouse-ear cress]
gb|ABE80149.1|  Tetratricopeptide-like helical                          140   2e-36   Medicago truncatula
ref|XP_006393385.1|  hypothetical protein EUTSA_v10011302mg             139   2e-36   
ref|XP_010927442.1|  PREDICTED: pentatricopeptide repeat-containi...    140   2e-36   
ref|XP_006290208.1|  hypothetical protein CARUB_v10003899mg             140   2e-36   
ref|XP_010430241.1|  PREDICTED: pentatricopeptide repeat-containi...    140   3e-36   
ref|XP_009147955.1|  PREDICTED: pentatricopeptide repeat-containi...    140   3e-36   
ref|XP_003524347.1|  PREDICTED: pentatricopeptide repeat-containi...    139   3e-36   
ref|XP_003631084.1|  Pentatricopeptide repeat-containing protein        140   3e-36   
ref|XP_010031274.1|  PREDICTED: pentatricopeptide repeat-containi...    139   3e-36   
ref|XP_006580405.1|  PREDICTED: pentatricopeptide repeat-containi...    139   4e-36   
ref|XP_010422542.1|  PREDICTED: pentatricopeptide repeat-containi...    139   4e-36   
emb|CDY40596.1|  BnaC06g02120D                                          139   5e-36   
emb|CDX93683.1|  BnaA06g03650D                                          138   1e-35   
ref|XP_004160443.1|  PREDICTED: pentatricopeptide repeat-containi...    138   1e-35   
ref|XP_004137551.1|  PREDICTED: pentatricopeptide repeat-containi...    137   1e-35   
gb|AET05556.2|  pentatricopeptide (PPR) repeat protein                  137   2e-35   
ref|XP_004956593.1|  PREDICTED: pentatricopeptide repeat-containi...    137   3e-35   
tpg|DAA61049.1|  TPA: hypothetical protein ZEAMMB73_995105              136   5e-35   
ref|XP_007160511.1|  hypothetical protein PHAVU_002G328000g             135   6e-35   
ref|XP_008652556.1|  PREDICTED: pentatricopeptide repeat-containi...    136   6e-35   
gb|KCW50540.1|  hypothetical protein EUGRSUZ_J00262                     135   6e-35   
ref|XP_006393386.1|  hypothetical protein EUTSA_v10011306mg             135   7e-35   
ref|XP_007160512.1|  hypothetical protein PHAVU_002G328100g             135   9e-35   
ref|NP_001062888.2|  Os09g0327200                                       135   1e-34   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD23598.1|  putative pentatricopeptide (PPR) repeat-containi...    135   1e-34   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08632.1|  hypothetical protein OsI_30906                          135   2e-34   Oryza sativa Indica Group [Indian rice]
gb|KFK36081.1|  hypothetical protein AALP_AA4G075000                    135   2e-34   
gb|EPS65029.1|  tetratricopeptide-like helical                          134   2e-34   
ref|XP_006660540.1|  PREDICTED: pentatricopeptide repeat-containi...    132   9e-34   
gb|EAZ44271.1|  hypothetical protein OsJ_28890                          131   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002534168.1|  pentatricopeptide repeat-containing protein,...    130   2e-33   Ricinus communis
ref|XP_007151411.1|  hypothetical protein PHAVU_004G044000g             131   4e-33   
ref|XP_010693152.1|  PREDICTED: pentatricopeptide repeat-containi...    129   2e-32   
ref|XP_006829281.1|  hypothetical protein AMTR_s00001p00272900          125   4e-31   
gb|EMT13464.1|  Pentatricopeptide repeat-containing protein             124   7e-31   
gb|ABP02616.1|  Tetratricopeptide-like helical                          121   2e-30   Medicago truncatula
ref|XP_003631080.1|  Pentatricopeptide repeat-containing protein        121   1e-29   
ref|XP_010239337.1|  PREDICTED: pentatricopeptide repeat-containi...    120   2e-29   
ref|XP_010274971.1|  PREDICTED: pentatricopeptide repeat-containi...    113   1e-26   
ref|XP_002310520.1|  pentatricopeptide repeat-containing family p...    111   3e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011022929.1|  PREDICTED: pentatricopeptide repeat-containi...    111   3e-26   
ref|XP_009618316.1|  PREDICTED: pentatricopeptide repeat-containi...    111   3e-26   
ref|XP_009780195.1|  PREDICTED: pentatricopeptide repeat-containi...    110   6e-26   
gb|KDP29043.1|  hypothetical protein JCGZ_16432                         108   1e-25   
gb|KCW50538.1|  hypothetical protein EUGRSUZ_J00260                     108   1e-25   
ref|XP_002462229.1|  hypothetical protein SORBIDRAFT_02g022150          109   1e-25   Sorghum bicolor [broomcorn]
ref|XP_010031273.1|  PREDICTED: pentatricopeptide repeat-containi...    108   2e-25   
ref|XP_007027165.1|  Tetratricopeptide repeat-like superfamily pr...    107   3e-25   
ref|XP_010242606.1|  PREDICTED: pentatricopeptide repeat-containi...    108   4e-25   
gb|KDP37060.1|  hypothetical protein JCGZ_06116                         105   5e-25   
gb|KHN25259.1|  Pentatricopeptide repeat-containing protein             107   5e-25   
ref|XP_006436646.1|  hypothetical protein CICLE_v10030857mg             107   6e-25   
gb|KDO42139.1|  hypothetical protein CISIN_1g005881mg                   107   7e-25   
ref|XP_003540710.1|  PREDICTED: pentatricopeptide repeat-containi...    107   7e-25   
ref|XP_002525213.1|  pentatricopeptide repeat-containing protein,...    105   1e-24   Ricinus communis
ref|XP_011102053.1|  PREDICTED: pentatricopeptide repeat-containi...    102   2e-24   
gb|ADE76772.1|  unknown                                                 102   2e-24   
ref|XP_004250478.1|  PREDICTED: pentatricopeptide repeat-containi...    106   2e-24   
ref|XP_002264325.1|  PREDICTED: pentatricopeptide repeat-containi...    106   2e-24   Vitis vinifera
gb|KHN21887.1|  Pentatricopeptide repeat-containing protein             105   3e-24   
ref|XP_011015198.1|  PREDICTED: pentatricopeptide repeat-containi...    105   3e-24   
ref|XP_011048447.1|  PREDICTED: pentatricopeptide repeat-containi...    105   3e-24   
ref|XP_010270447.1|  PREDICTED: uncharacterized protein LOC104606779    106   3e-24   
ref|XP_004502949.1|  PREDICTED: pentatricopeptide repeat-containi...    105   3e-24   
ref|XP_010109634.1|  hypothetical protein L484_015589                   105   4e-24   
ref|XP_007010243.1|  Pentatricopeptide repeat-containing protein        105   5e-24   
ref|XP_011100928.1|  PREDICTED: pentatricopeptide repeat-containi...    105   5e-24   
ref|XP_010930665.1|  PREDICTED: pentatricopeptide repeat-containi...    105   5e-24   
ref|XP_007137795.1|  hypothetical protein PHAVU_009G156000g             105   5e-24   
ref|XP_003602631.1|  Pentatricopeptide repeat-containing protein        104   8e-24   
ref|XP_006361496.1|  PREDICTED: pentatricopeptide repeat-containi...    104   8e-24   
ref|XP_002323442.1|  hypothetical protein POPTR_0016s08300g             103   8e-24   Populus trichocarpa [western balsam poplar]
emb|CDO99888.1|  unnamed protein product                                104   9e-24   
ref|XP_008808493.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    104   9e-24   
ref|XP_010671740.1|  PREDICTED: pentatricopeptide repeat-containi...    103   9e-24   
ref|XP_009630538.1|  PREDICTED: pentatricopeptide repeat-containi...    104   9e-24   
ref|XP_008363910.1|  PREDICTED: pentatricopeptide repeat-containi...    103   9e-24   
gb|ADG37869.1|  AT1G13410-like protein                                99.4    1e-23   
ref|XP_010228458.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-23   
ref|XP_006342434.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-23   
ref|XP_009341886.1|  PREDICTED: pentatricopeptide repeat-containi...    102   1e-23   
gb|KDP30336.1|  hypothetical protein JCGZ_17483                         103   1e-23   
ref|XP_008239469.1|  PREDICTED: pentatricopeptide repeat-containi...    104   1e-23   
ref|XP_002883803.1|  pentatricopeptide repeat-containing protein        103   1e-23   
ref|NP_190904.1|  pentatricopeptide repeat-containing protein           104   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409682.1|  hypothetical protein EUTSA_v10022582mg             103   1e-23   
gb|KFK39938.1|  hypothetical protein AALP_AA3G309500                    103   1e-23   
ref|XP_004253182.1|  PREDICTED: pentatricopeptide repeat-containi...    103   1e-23   
ref|XP_007209027.1|  hypothetical protein PRUPE_ppa023983mg             103   2e-23   
ref|XP_002466303.1|  hypothetical protein SORBIDRAFT_01g005310          103   2e-23   Sorghum bicolor [broomcorn]
ref|XP_002517667.1|  pentatricopeptide repeat-containing protein,...    103   2e-23   Ricinus communis
gb|KFK39939.1|  hypothetical protein AALP_AA3G309500                    103   2e-23   
ref|XP_006384866.1|  hypothetical protein POPTR_0004s21780g             103   2e-23   
ref|XP_010424322.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-23   
emb|CDY18453.1|  BnaA04g21340D                                          102   2e-23   
ref|XP_009141647.1|  PREDICTED: pentatricopeptide repeat-containi...    102   2e-23   
ref|XP_008464730.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-23   
gb|EYU44151.1|  hypothetical protein MIMGU_mgv1a003236mg                103   2e-23   
gb|AFG58310.1|  hypothetical protein 0_9722_01                        97.8    2e-23   
gb|AFG58299.1|  hypothetical protein 0_9722_01                        97.8    2e-23   
ref|XP_010489866.1|  PREDICTED: pentatricopeptide repeat-containi...    102   2e-23   
ref|XP_008387621.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-23   
ref|XP_010467188.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-23   
ref|XP_008804169.1|  PREDICTED: pentatricopeptide repeat-containi...    101   2e-23   
ref|XP_003550640.2|  PREDICTED: pentatricopeptide repeat-containi...    102   2e-23   
ref|XP_011040829.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-23   
gb|AFG58313.1|  hypothetical protein 0_9722_01                        97.4    2e-23   
ref|XP_011102135.1|  PREDICTED: pentatricopeptide repeat-containi...    102   2e-23   
ref|XP_010488859.1|  PREDICTED: pentatricopeptide repeat-containi...    103   2e-23   
ref|XP_006412384.1|  hypothetical protein EUTSA_v10027494mg             103   2e-23   
gb|KHN17644.1|  Pentatricopeptide repeat-containing protein             101   3e-23   
ref|XP_010504479.1|  PREDICTED: pentatricopeptide repeat-containi...    101   3e-23   
ref|XP_006655184.1|  PREDICTED: pentatricopeptide repeat-containi...    102   3e-23   
ref|XP_003621264.1|  Pentatricopeptide repeat-containing protein        102   3e-23   
ref|XP_010045615.1|  PREDICTED: pentatricopeptide repeat-containi...    103   3e-23   
ref|XP_009143508.1|  PREDICTED: pentatricopeptide repeat-containi...    101   3e-23   
gb|KFK36618.1|  hypothetical protein AALP_AA4G147200                    101   3e-23   
ref|XP_006297108.1|  hypothetical protein CARUB_v10013108mg             102   3e-23   
ref|XP_006297107.1|  hypothetical protein CARUB_v10013108mg             102   3e-23   
ref|XP_011099721.1|  PREDICTED: pentatricopeptide repeat-containi...    102   3e-23   
emb|CBI33742.3|  unnamed protein product                                102   3e-23   
ref|XP_004492962.1|  PREDICTED: pentatricopeptide repeat-containi...    102   3e-23   
gb|EMT26142.1|  hypothetical protein F775_09158                         102   3e-23   
ref|XP_009343153.1|  PREDICTED: pentatricopeptide repeat-containi...    103   3e-23   
gb|KCW51843.1|  hypothetical protein EUGRSUZ_J01294                     102   4e-23   
emb|CDX74970.1|  BnaA05g07160D                                          101   4e-23   
ref|XP_006347856.1|  PREDICTED: pentatricopeptide repeat-containi...    103   4e-23   
ref|XP_008387699.1|  PREDICTED: pentatricopeptide repeat-containi...    101   4e-23   
ref|XP_002279137.1|  PREDICTED: pentatricopeptide repeat-containi...    102   4e-23   Vitis vinifera
ref|XP_010923534.1|  PREDICTED: pentatricopeptide repeat-containi...    102   4e-23   
ref|XP_009124193.1|  PREDICTED: pentatricopeptide repeat-containi...    102   4e-23   
ref|XP_009143507.1|  PREDICTED: pentatricopeptide repeat-containi...    101   4e-23   
ref|XP_003632690.2|  PREDICTED: pentatricopeptide repeat-containi...    102   4e-23   
emb|CBI30094.3|  unnamed protein product                                102   5e-23   
ref|XP_009124194.1|  PREDICTED: pentatricopeptide repeat-containi...    102   5e-23   
ref|NP_178983.1|  protein SLOW GROWTH 2                                 102   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb|KDP47022.1|  hypothetical protein JCGZ_10749                         102   5e-23   
ref|XP_007204096.1|  hypothetical protein PRUPE_ppa002338mg             102   5e-23   
ref|XP_010278845.1|  PREDICTED: pentatricopeptide repeat-containi...    102   5e-23   
ref|XP_006477459.1|  PREDICTED: pentatricopeptide repeat-containi...    102   5e-23   
ref|XP_007043099.1|  Pentatricopeptide repeat (PPR) superfamily p...    102   5e-23   
emb|CDP11486.1|  unnamed protein product                                101   5e-23   
ref|XP_010278851.1|  PREDICTED: pentatricopeptide repeat-containi...    102   6e-23   
ref|XP_010437793.1|  PREDICTED: pentatricopeptide repeat-containi...    102   6e-23   
ref|XP_010447274.1|  PREDICTED: pentatricopeptide repeat-containi...    102   6e-23   
emb|CDY28284.1|  BnaC03g66750D                                          102   6e-23   
ref|XP_006489927.1|  PREDICTED: pentatricopeptide repeat-containi...    102   6e-23   
gb|KFK36619.1|  hypothetical protein AALP_AA4G147200                    100   6e-23   
ref|XP_010435864.1|  PREDICTED: pentatricopeptide repeat-containi...    102   6e-23   
emb|CBI38165.3|  unnamed protein product                                102   6e-23   
ref|XP_009804752.1|  PREDICTED: pentatricopeptide repeat-containi...    102   6e-23   
gb|EYU25211.1|  hypothetical protein MIMGU_mgv1a001568mg                102   6e-23   
ref|XP_007162705.1|  hypothetical protein PHAVU_001G173400g             102   6e-23   
ref|XP_009614785.1|  PREDICTED: pentatricopeptide repeat-containi...    101   7e-23   
ref|XP_008805605.1|  PREDICTED: pentatricopeptide repeat-containi...    102   7e-23   
ref|XP_010435865.1|  PREDICTED: pentatricopeptide repeat-containi...    101   7e-23   
ref|XP_010243684.1|  PREDICTED: pentatricopeptide repeat-containi...    101   7e-23   
ref|XP_011098682.1|  PREDICTED: pentatricopeptide repeat-containi...    101   7e-23   
ref|XP_004981445.1|  PREDICTED: pentatricopeptide repeat-containi...    101   7e-23   
ref|XP_010111526.1|  hypothetical protein L484_001076                   101   7e-23   
ref|XP_008776808.1|  PREDICTED: pentatricopeptide repeat-containi...    100   7e-23   
ref|XP_010092936.1|  hypothetical protein L484_018873                   102   7e-23   
ref|XP_006421425.1|  hypothetical protein CICLE_v10004455mg             102   8e-23   
ref|XP_010526989.1|  PREDICTED: pentatricopeptide repeat-containi...    102   8e-23   
gb|KFK29928.1|  hypothetical protein AALP_AA7G196500                    102   8e-23   
gb|AEW07722.1|  hypothetical protein 0_9722_01                        96.3    8e-23   
ref|XP_003574410.2|  PREDICTED: pentatricopeptide repeat-containi...    101   8e-23   
ref|XP_004504222.1|  PREDICTED: pentatricopeptide repeat-containi...    101   8e-23   
ref|XP_010032449.1|  PREDICTED: pentatricopeptide repeat-containi...    101   8e-23   
ref|XP_004235997.1|  PREDICTED: pentatricopeptide repeat-containi...    101   8e-23   
ref|XP_010505312.1|  PREDICTED: pentatricopeptide repeat-containi...    100   9e-23   
ref|XP_007226336.1|  hypothetical protein PRUPE_ppa022305mg             100   9e-23   
ref|XP_010526990.1|  PREDICTED: pentatricopeptide repeat-containi...    101   9e-23   
ref|XP_004961435.1|  PREDICTED: pentatricopeptide repeat-containi...    102   9e-23   
ref|XP_007020712.1|  Pentatricopeptide repeat superfamily protein...    102   9e-23   
dbj|BAJ88458.1|  predicted protein                                      100   1e-22   
ref|XP_008238970.1|  PREDICTED: putative pentatricopeptide repeat...    102   1e-22   
gb|KDP29416.1|  hypothetical protein JCGZ_18337                         100   1e-22   
emb|CDP05081.1|  unnamed protein product                                101   1e-22   
ref|XP_006410915.1|  hypothetical protein EUTSA_v10017783mg             100   1e-22   
ref|XP_010107584.1|  hypothetical protein L484_024440                   101   1e-22   
ref|XP_009409927.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-22   
ref|XP_008808564.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-22   
emb|CDX89609.1|  BnaC03g45230D                                          101   1e-22   
ref|XP_008229674.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-22   
ref|XP_009152140.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-22   
ref|XP_003632994.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-22   
ref|XP_004305889.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-22   
ref|XP_010259970.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-22   
ref|XP_010516999.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-22   
gb|EMS46552.1|  hypothetical protein TRIUR3_15385                       100   1e-22   
ref|XP_002524945.1|  pentatricopeptide repeat-containing protein,...  99.4    1e-22   Ricinus communis
ref|XP_007156271.1|  hypothetical protein PHAVU_003G272400g             100   1e-22   
ref|XP_007044258.1|  Pentatricopeptide repeat (PPR) superfamily p...    101   1e-22   
ref|XP_009108814.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-22   
ref|XP_004231236.1|  PREDICTED: pentatricopeptide repeat-containi...    101   1e-22   
ref|NP_189568.1|  pentatricopeptide repeat-containing protein           100   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006364594.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-22   
ref|XP_010509351.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-22   
ref|XP_006466530.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-22   
ref|XP_006426011.1|  hypothetical protein CICLE_v10025167mg             100   1e-22   
ref|XP_009149215.1|  PREDICTED: putative pentatricopeptide repeat...    101   1e-22   
ref|XP_009368106.1|  PREDICTED: pentatricopeptide repeat-containi...    100   1e-22   
gb|ADG37864.1|  AT1G13410-like protein                                96.3    2e-22   
ref|XP_007206763.1|  hypothetical protein PRUPE_ppa025253mg             100   2e-22   
ref|XP_009124630.1|  PREDICTED: pentatricopeptide repeat-containi...    101   2e-22   
ref|XP_009412940.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_010273504.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_006842247.1|  hypothetical protein AMTR_s00078p00195340          101   2e-22   
ref|XP_004141894.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_009778667.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_003547890.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
gb|AFG58307.1|  hypothetical protein 0_9722_01                        95.5    2e-22   
ref|XP_006651199.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_002273989.2|  PREDICTED: pentatricopeptide repeat-containi...  99.8    2e-22   Vitis vinifera
ref|XP_010468211.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_010273499.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_009136220.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_002439788.1|  hypothetical protein SORBIDRAFT_09g020050          100   2e-22   Sorghum bicolor [broomcorn]
emb|CDX93118.1|  BnaA03g38400D                                          100   2e-22   
ref|XP_006836656.1|  hypothetical protein AMTR_s00088p00046280          100   2e-22   
ref|XP_002282164.2|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    101   2e-22   Vitis vinifera
ref|XP_009771244.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_002322556.1|  hypothetical protein POPTR_0016s02110g             100   2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_009366382.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_008455763.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_010911475.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
ref|XP_010505313.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    2e-22   
ref|XP_006489926.1|  PREDICTED: pentatricopeptide repeat-containi...    100   2e-22   
gb|KCW83778.1|  hypothetical protein EUGRSUZ_B00648                     100   2e-22   
emb|CDY45030.1|  BnaA08g11890D                                          100   2e-22   
ref|XP_006380676.1|  hypothetical protein POPTR_0007s10370g             100   3e-22   
ref|XP_008243240.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    3e-22   
ref|XP_009388158.1|  PREDICTED: putative pentatricopeptide repeat...    100   3e-22   
ref|XP_006577708.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
ref|XP_010526036.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
ref|XP_010430871.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    3e-22   
ref|XP_008781031.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
ref|XP_008240989.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
ref|XP_011008550.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
gb|KDO53700.1|  hypothetical protein CISIN_1g004425mg                   100   3e-22   
ref|XP_002282049.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   Vitis vinifera
ref|XP_009786964.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    3e-22   
ref|XP_010243341.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
emb|CBI30968.3|  unnamed protein product                                100   3e-22   
emb|CBI33393.3|  unnamed protein product                                100   3e-22   
ref|XP_009406673.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
ref|XP_004144359.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
ref|XP_008387316.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
ref|XP_001780298.1|  predicted protein                                  100   3e-22   
ref|XP_004157997.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
ref|XP_006827212.1|  hypothetical protein AMTR_s00010p00259620        97.4    3e-22   
ref|XP_008451342.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
gb|EMT13640.1|  hypothetical protein F775_19062                       99.4    3e-22   
ref|XP_008451337.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
ref|XP_010450784.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
gb|KGN54664.1|  hypothetical protein Csa_4G418570                       100   3e-22   
ref|XP_008240562.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
ref|XP_010441083.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    3e-22   
ref|XP_008451336.1|  PREDICTED: pentatricopeptide repeat-containi...    100   3e-22   
ref|XP_006384977.1|  hypothetical protein POPTR_0004s22750g           97.1    4e-22   
emb|CBI32643.3|  unnamed protein product                                100   4e-22   
ref|XP_008371557.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    4e-22   
ref|XP_010269714.1|  PREDICTED: pentatricopeptide repeat-containi...    100   4e-22   
gb|KHN07819.1|  Pentatricopeptide repeat-containing protein           98.2    4e-22   
ref|XP_010258202.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    4e-22   
emb|CDP04658.1|  unnamed protein product                              99.8    4e-22   
ref|XP_010521079.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    4e-22   
ref|NP_001049485.1|  Os03g0235200                                     99.8    4e-22   
gb|EPS60295.1|  hypothetical protein M569_14504                         100   4e-22   
emb|CDY48066.1|  BnaA06g33620D                                        99.4    4e-22   
dbj|BAD67155.1|  PpPPR_98                                               100   4e-22   
ref|XP_009352153.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    4e-22   
ref|XP_007204476.1|  hypothetical protein PRUPE_ppa021952mg             100   4e-22   
emb|CAN64870.1|  hypothetical protein VITISV_041329                   99.8    4e-22   
ref|XP_010514638.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    4e-22   
ref|XP_008451344.1|  PREDICTED: pentatricopeptide repeat-containi...    100   4e-22   
ref|XP_002525227.1|  pentatricopeptide repeat-containing protein,...  97.8    4e-22   
emb|CDX72130.1|  BnaC08g27440D                                        99.8    4e-22   
ref|NP_178481.1|  pentatricopeptide repeat-containing protein         99.8    4e-22   
gb|KDO79045.1|  hypothetical protein CISIN_1g038395mg                 98.6    4e-22   
ref|XP_010045582.1|  PREDICTED: pentatricopeptide repeat-containi...    100   4e-22   
ref|XP_010034596.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    4e-22   
gb|EMT17047.1|  Pentatricopeptide repeat-containing protein           98.6    4e-22   
ref|XP_006403701.1|  hypothetical protein EUTSA_v10010938mg             100   4e-22   
ref|XP_006842595.1|  hypothetical protein AMTR_s00077p00166950        99.4    4e-22   
emb|CDY41898.1|  BnaC05g47060D                                        99.8    4e-22   
ref|XP_007148025.1|  hypothetical protein PHAVU_006G174200g             100   4e-22   
ref|XP_010679561.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    4e-22   
ref|XP_002463323.1|  hypothetical protein SORBIDRAFT_02g041810        99.4    4e-22   
gb|EEC74826.1|  hypothetical protein OsI_10663                        99.8    4e-22   
ref|XP_007155872.1|  hypothetical protein PHAVU_003G238900g           99.4    4e-22   
ref|XP_004301528.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    4e-22   
gb|KCW52656.1|  hypothetical protein EUGRSUZ_J02031                   99.0    4e-22   
gb|KDP46560.1|  hypothetical protein JCGZ_08532                       99.0    4e-22   
ref|XP_008440984.1|  PREDICTED: pentatricopeptide repeat-containi...    100   4e-22   
ref|XP_007154694.1|  hypothetical protein PHAVU_003G140000g           99.0    5e-22   
ref|XP_004306236.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    5e-22   
ref|XP_006432168.1|  hypothetical protein CICLE_v10000448mg           99.8    5e-22   
gb|KGN44805.1|  hypothetical protein Csa_7G388380                       100   5e-22   
gb|AAO41891.1|  putative selenium-binding protein                     99.4    5e-22   
gb|KDP21214.1|  hypothetical protein JCGZ_21685                       99.4    5e-22   
dbj|BAK07747.1|  predicted protein                                    99.4    5e-22   
ref|XP_008464664.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    5e-22   
ref|XP_010654995.1|  PREDICTED: pentatricopeptide repeat-containi...    100   5e-22   
ref|XP_008373195.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    5e-22   
ref|XP_008241898.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    5e-22   
sp|Q9LIQ7.1|PP252_ARATH  RecName: Full=Pentatricopeptide repeat-c...  99.4    5e-22   
ref|XP_010320768.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    5e-22   
ref|XP_007205016.1|  hypothetical protein PRUPE_ppa003703mg           99.0    5e-22   
ref|XP_004977564.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    5e-22   
ref|XP_004304914.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    5e-22   
gb|KHN38337.1|  Pentatricopeptide repeat-containing protein           97.8    5e-22   
emb|CDX85257.1|  BnaC07g25680D                                        99.4    5e-22   
ref|XP_010242076.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    5e-22   
emb|CDY48316.1|  BnaC05g13700D                                        99.8    5e-22   
gb|KHN09480.1|  Pentatricopeptide repeat-containing protein, mito...  99.8    5e-22   
ref|NP_189042.4|  pentatricopeptide repeat-containing protein         99.4    5e-22   
gb|KDO48089.1|  hypothetical protein CISIN_1g0367041mg                97.1    5e-22   
ref|XP_006480733.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    5e-22   
ref|XP_011028281.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    5e-22   
gb|KCW83599.1|  hypothetical protein EUGRSUZ_B00493                   99.8    6e-22   
ref|XP_008646190.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    6e-22   
ref|XP_009372472.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  99.4    6e-22   
ref|XP_010529765.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    6e-22   
gb|ADG37868.1|  AT1G13410-like protein                                94.7    6e-22   
gb|ADG37866.1|  AT1G13410-like protein                                94.7    6e-22   
ref|XP_007216989.1|  hypothetical protein PRUPE_ppa002640mg           99.4    6e-22   
ref|XP_006369868.1|  hypothetical protein POPTR_0001s34330g           99.4    6e-22   
ref|XP_010931785.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    6e-22   
ref|XP_009116030.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    6e-22   
emb|CDX83525.1|  BnaC07g22650D                                        98.6    6e-22   
ref|XP_008227134.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    6e-22   
gb|AFW78806.1|  hypothetical protein ZEAMMB73_634908                  99.8    7e-22   
ref|XP_010253409.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    7e-22   
ref|XP_009151793.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    7e-22   
gb|ADG37867.1|  AT1G13410-like protein                                94.7    7e-22   
ref|XP_002533966.1|  pentatricopeptide repeat-containing protein,...  98.2    7e-22   
ref|XP_010528729.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    7e-22   
ref|XP_008359551.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    7e-22   
ref|XP_004147002.1|  PREDICTED: putative pentatricopeptide repeat...  99.8    7e-22   
ref|XP_010270723.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    7e-22   
ref|XP_010906852.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    7e-22   
ref|XP_008649898.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    7e-22   
ref|XP_008786691.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    7e-22   
ref|XP_004158941.1|  PREDICTED: putative pentatricopeptide repeat...  99.8    7e-22   
gb|ADG37865.1|  AT1G13410-like protein                                94.7    7e-22   
ref|XP_008440985.1|  PREDICTED: pentatricopeptide repeat-containi...  99.8    7e-22   
ref|XP_010662778.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  99.8    7e-22   
ref|XP_011076005.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    7e-22   
ref|XP_010112869.1|  hypothetical protein L484_017705                 99.4    7e-22   
ref|XP_004139380.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    7e-22   
ref|XP_006344297.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    7e-22   
gb|KFK37889.1|  hypothetical protein AALP_AA3G042400                  99.0    7e-22   
ref|XP_002514406.1|  pentatricopeptide repeat-containing protein,...  97.4    8e-22   
ref|XP_006290740.1|  hypothetical protein CARUB_v10016836mg           99.0    8e-22   
ref|XP_006840276.1|  hypothetical protein AMTR_s00045p00048330        98.6    8e-22   
ref|XP_009391896.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    8e-22   
ref|XP_010269167.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    8e-22   
ref|XP_004149135.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    8e-22   
gb|AHB18406.1|  pentatricopeptide repeat-containing protein           99.0    8e-22   
ref|XP_006285430.1|  hypothetical protein CARUB_v10006847mg           99.4    8e-22   
gb|AET04390.2|  pentatricopeptide (PPR) repeat protein                99.0    9e-22   
ref|XP_008791830.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    9e-22   
ref|XP_010516263.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    9e-22   
gb|AEN80816.1|  AT1G13410-like protein                                94.7    9e-22   
ref|XP_004306116.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    9e-22   
ref|XP_010427484.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    9e-22   
gb|EAY73376.1|  hypothetical protein OsI_01257                        97.8    9e-22   
ref|XP_006844721.1|  hypothetical protein AMTR_s00016p00252780        97.1    9e-22   
gb|KDP32019.1|  hypothetical protein JCGZ_12480                       98.6    9e-22   
ref|XP_010279098.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    9e-22   
ref|XP_010248161.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    9e-22   
ref|XP_003532785.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    1e-21   
ref|XP_003629914.1|  Pentatricopeptide repeat-containing protein      99.0    1e-21   
emb|CDX75336.1|  BnaA01g03660D                                        99.4    1e-21   
ref|XP_004310131.1|  PREDICTED: putative pentatricopeptide repeat...  99.0    1e-21   
ref|XP_008240994.1|  PREDICTED: pentatricopeptide repeat-containi...  95.5    1e-21   
ref|XP_009625939.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    1e-21   
ref|XP_002981179.1|  hypothetical protein SELMODRAFT_34638            95.5    1e-21   
ref|XP_010931403.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  98.6    1e-21   
ref|XP_004960355.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    1e-21   
gb|EYU34329.1|  hypothetical protein MIMGU_mgv1a001967mg              99.0    1e-21   
ref|XP_006417124.1|  hypothetical protein EUTSA_v10009406mg           98.2    1e-21   
gb|EYU37193.1|  hypothetical protein MIMGU_mgv1a021143mg              98.2    1e-21   
ref|XP_006410248.1|  hypothetical protein EUTSA_v10016243mg           99.0    1e-21   
ref|XP_010906170.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    1e-21   
ref|XP_008228390.1|  PREDICTED: putative pentatricopeptide repeat...  98.6    1e-21   
ref|XP_010267015.1|  PREDICTED: pentatricopeptide repeat-containi...  99.4    1e-21   
gb|KHN48066.1|  Pentatricopeptide repeat-containing protein, mito...  98.6    1e-21   
ref|XP_010502875.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    1e-21   
ref|XP_007030706.1|  Pentatricopeptide repeat (PPR) superfamily p...  99.0    1e-21   
ref|XP_008440332.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    1e-21   
emb|CDX93390.1|  BnaC04g45060D                                        97.4    1e-21   
emb|CDJ26517.1|  unnamed protein product                              98.2    1e-21   
ref|XP_002986091.1|  hypothetical protein SELMODRAFT_182148           98.2    1e-21   
ref|XP_006429006.1|  hypothetical protein CICLE_v10013887mg           97.1    1e-21   
ref|XP_008230780.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    1e-21   
ref|XP_007030705.1|  Pentatricopeptide repeat superfamily protein...  99.4    1e-21   
ref|XP_010556367.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    1e-21   
ref|XP_010934519.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    1e-21   
gb|AEB39774.1|  pentatricopeptide repeat protein 65                   98.6    1e-21   
gb|EAZ11310.1|  hypothetical protein OsJ_01174                        95.9    1e-21   
ref|XP_009377141.1|  PREDICTED: putative pentatricopeptide repeat...  98.6    1e-21   
gb|KDP40215.1|  hypothetical protein JCGZ_02213                       98.6    1e-21   
ref|XP_008785200.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    1e-21   
ref|XP_010907118.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    1e-21   
ref|XP_002878095.1|  pentatricopeptide repeat-containing protein      98.2    1e-21   
ref|NP_181269.1|  pentatricopeptide repeat-containing protein         97.4    1e-21   
ref|XP_007032637.1|  Tetratricopeptide repeat (TPR)-like superfam...  98.2    1e-21   
ref|XP_009370362.1|  PREDICTED: putative pentatricopeptide repeat...  98.6    1e-21   
ref|XP_010943720.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    1e-21   
ref|XP_006661448.1|  PREDICTED: pentatricopeptide repeat-containi...  97.4    1e-21   
ref|XP_007211431.1|  hypothetical protein PRUPE_ppa007122mg           96.3    1e-21   
ref|XP_011081841.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    1e-21   
ref|XP_009375340.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    1e-21   
ref|XP_007204951.1|  hypothetical protein PRUPE_ppa000364mg           99.0    1e-21   
ref|XP_009352615.1|  PREDICTED: pentatricopeptide repeat-containi...  99.0    1e-21   
gb|KDO68372.1|  hypothetical protein CISIN_1g045672mg                 98.2    1e-21   
ref|XP_006422411.1|  hypothetical protein CICLE_v10028001mg           98.2    1e-21   
ref|XP_006486584.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    1e-21   
ref|XP_010501455.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    1e-21   
gb|KDO50719.1|  hypothetical protein CISIN_1g005265mg                 98.2    1e-21   
ref|XP_007043839.1|  Tetratricopeptide repeat-like superfamily pr...  98.6    1e-21   
emb|CDP20304.1|  unnamed protein product                              97.8    1e-21   
ref|XP_010480462.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    1e-21   
ref|XP_007034201.1|  Pentatricopeptide repeat (PPR) superfamily p...  97.8    1e-21   
ref|XP_002867196.1|  pentatricopeptide repeat-containing protein      98.6    1e-21   
ref|XP_009397744.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    1e-21   
ref|XP_011009779.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    1e-21   
ref|XP_006294030.1|  hypothetical protein CARUB_v10023022mg           97.4    1e-21   
emb|CDY28355.1|  BnaC01g35250D                                        97.1    1e-21   
ref|XP_004149535.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    1e-21   
ref|XP_008792938.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    1e-21   
ref|XP_009358895.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    2e-21   
ref|XP_002875235.1|  pentatricopeptide repeat-containing protein      97.8    2e-21   
ref|XP_007204168.1|  hypothetical protein PRUPE_ppa017537mg           97.8    2e-21   
ref|NP_001130403.1|  uncharacterized protein LOC100191499             97.8    2e-21   
ref|XP_008356070.1|  PREDICTED: pentatricopeptide repeat-containi...  97.4    2e-21   
ref|XP_010462690.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    2e-21   
ref|XP_008810930.1|  PREDICTED: pentatricopeptide repeat-containi...  97.8    2e-21   
ref|XP_004166371.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    2e-21   
gb|AEW07782.1|  hypothetical protein 0_11486_01                       92.8    2e-21   
dbj|BAJ87104.1|  predicted protein                                    97.8    2e-21   
ref|XP_010653710.1|  PREDICTED: pentatricopeptide repeat-containi...  97.4    2e-21   
ref|XP_010435237.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    2e-21   
gb|KGN54970.1|  hypothetical protein Csa_4G617370                     98.2    2e-21   
ref|XP_006575994.1|  PREDICTED: pentatricopeptide repeat-containi...  96.7    2e-21   
gb|KCW51859.1|  hypothetical protein EUGRSUZ_J01312                   97.8    2e-21   
ref|XP_010092960.1|  hypothetical protein L484_018897                 97.8    2e-21   
ref|XP_010916614.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    2e-21   
gb|AFG70126.1|  hypothetical protein 0_11486_01                       92.4    2e-21   
ref|XP_010663367.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    2e-21   
gb|KDP36856.1|  hypothetical protein JCGZ_08147                       97.8    2e-21   
ref|XP_002268980.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    2e-21   
emb|CBI22530.3|  unnamed protein product                              97.4    2e-21   
ref|XP_004162581.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  98.2    2e-21   
ref|XP_004137966.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    2e-21   
ref|XP_008790795.1|  PREDICTED: pentatricopeptide repeat-containi...  96.3    2e-21   
emb|CAN83542.1|  hypothetical protein VITISV_021357                   98.2    2e-21   
emb|CBI23560.3|  unnamed protein product                              97.1    2e-21   
ref|XP_006307006.1|  hypothetical protein CARUB_v10008584mg           97.8    2e-21   
emb|CBI32673.3|  unnamed protein product                              98.2    2e-21   
ref|XP_008451345.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    2e-21   
ref|XP_007147940.1|  hypothetical protein PHAVU_006G167300g           97.4    2e-21   
gb|KCW64695.1|  hypothetical protein EUGRSUZ_G022851                  95.1    2e-21   
gb|KDO44121.1|  hypothetical protein CISIN_1g009967mg                 97.1    2e-21   
ref|XP_003557509.1|  PREDICTED: pentatricopeptide repeat-containi...  97.4    2e-21   
ref|XP_008451343.1|  PREDICTED: pentatricopeptide repeat-containi...  98.2    2e-21   



>ref|XP_004236423.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Solanum lycopersicum]
Length=765

 Score =   160 bits (405),  Expect = 7e-44, Method: Composition-based stats.
 Identities = 72/87 (83%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY SGCYVGNALL+MYCKCGSI EA DVFE IAEKD VSWNTMIIGYARHGFGK+AL 
Sbjct  421  KAGYHSGCYVGNALLSMYCKCGSIDEAYDVFEEIAEKDAVSWNTMIIGYARHGFGKQALR  480

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F++MK+ GI+PDDVTMVGVLSAC HT
Sbjct  481  QFELMKEAGIRPDDVTMVGVLSACGHT  507


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I  A  +F+ +  +D +SW  +I GYA+ G  +EAL  F  MK  G +
Sbjct  331  NTMITGYAQIGDITHARSLFDCMPNRDCISWAAIIAGYAQSGNSEEALRMFVQMKRDGGR  390

Query  48   PDDVTMVGVLSACS  7
             +      VLS  +
Sbjct  391  INRSAFTCVLSTSA  404


 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N +L+ Y K  + G A  +F+ +  KDVVSWN ++ GYA++G+  +A   F MM
Sbjct  114  NIMLSGYIKNKNFGAARILFDQMPVKDVVSWNALLSGYAQNGYVDDARRIFIMM  167



>ref|XP_010275265.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Nelumbo nucifera]
 ref|XP_010275266.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Nelumbo nucifera]
Length=772

 Score =   159 bits (403),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 70/87 (80%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGYE+GCYVGNALLAMYCKCGSI EA DVF G+ EKD+V+WNT+I+GYARHGFGKEAL+
Sbjct  428  KAGYETGCYVGNALLAMYCKCGSIDEAYDVFHGMPEKDLVTWNTIIMGYARHGFGKEALK  487

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  M++ GIKPDDVTMVGVLSACSHT
Sbjct  488  VFDSMREMGIKPDDVTMVGVLSACSHT  514


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I  A  +F+ +   D +SW  +I GY+++G  +EAL  F  MK  G +
Sbjct  338  NTMITGYAQSGEIDHAQSLFDEMPRHDSISWAAIISGYSQNGLSEEALRLFIEMKRDGER  397

Query  48   PDDVTMVGVLSACS  7
             +  T    LS C+
Sbjct  398  MNRSTFTCALSTCA  411


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L+ + K  ++  A  +F+ + ++DVVSWNTM+ GYA++G+  EA E F  M +    
Sbjct  121  NVMLSGFVKNRNLSGARFLFDKMPKRDVVSWNTMLSGYAQNGYVDEAREIFDRMPN----  176

Query  48   PDDVTMVGVLSA  13
             + ++  G+L+A
Sbjct  177  KNSISWNGILAA  188


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            N+++A Y +   + +A ++F+ + E+D VSWNTMI GYA++G   EA + F+
Sbjct  214  NSMMAGYVRKKRLVDARNLFDRMPERDEVSWNTMITGYAQNGELSEAQKLFE  265


 Score = 47.0 bits (110),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 4/75 (5%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA++A Y +C  +  A ++FE +  +++ SWNTMI GYA+ G    A   F  M     +
Sbjct  307  NAMIAGYAQCKRMDLARELFEAMPCQNISSWNTMITGYAQSGEIDHAQSLFDEMP----R  362

Query  48   PDDVTMVGVLSACSH  4
             D ++   ++S  S 
Sbjct  363  HDSISWAAIISGYSQ  377



>ref|XP_009601536.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Nicotiana tomentosiformis]
Length=800

 Score =   159 bits (402),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 71/87 (82%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY +GCYVGNALLAMYCKCGSI E  DVFE I EKDVVSWNTMI+GYARHGFGK+AL+
Sbjct  456  KAGYHTGCYVGNALLAMYCKCGSIDEPYDVFEEIEEKDVVSWNTMIVGYARHGFGKQALQ  515

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             FK MK+ G KPDDVTMVGVLSAC HT
Sbjct  516  LFKSMKEAGFKPDDVTMVGVLSACGHT  542


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N +L+ Y K  + G A  +F  +  KDVVSWN ++ GYA++G+  +A   F MM
Sbjct  149  NIMLSGYIKSKNFGAAKMLFNQMLVKDVVSWNALLSGYAQNGYTADAKRIFDMM  202


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 25/76 (33%), Positives = 38/76 (50%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I  A  +F  +  +D +SW  +I GYA+ G  +EAL  F  MK  G +
Sbjct  366  NTMITGYAQNGDIVSARSLFHCMPCRDCISWAAIIAGYAQSGNSEEALRMFVEMKRDGGR  425

Query  48   PDDVTMVGVLSACSHT  1
             +       LS C+ T
Sbjct  426  INRSAFTCALSTCADT  441



>ref|XP_008374833.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Malus domestica]
Length=784

 Score =   159 bits (402),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGYE+GCYVGNALL MYCKCGSI EA DVF+GIAEKDVVSWNTMI GYARHGFG +AL+
Sbjct  440  KAGYETGCYVGNALLVMYCKCGSIEEAYDVFQGIAEKDVVSWNTMIYGYARHGFGLKALK  499

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  MK  GIKPDDVTMVGVLSACSHT
Sbjct  500  VFDSMKAVGIKPDDVTMVGVLSACSHT  526


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L+ Y +   +G A  +FE + EKDVVSWN M+ GYA++G+  EA   F+ M D    
Sbjct  133  NVMLSGYVRNRDLGAARALFERMPEKDVVSWNAMLSGYAQNGYVDEARTIFQRMPD----  188

Query  48   PDDVTMVGVLSA  13
             ++++  G+L+A
Sbjct  189  KNEISWNGLLAA  200


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G I  A ++F+ +  +D +SW  +I GYA++G+ +EAL+ F  MK  G +
Sbjct  350  NTILTGYAQSGDIVCAKEIFDSMPRRDSISWAAIIAGYAQNGYSEEALQLFVEMKRDGER  409

Query  48   PDDVTMVGVLSACS  7
                +    LS C+
Sbjct  410  LTRSSFTCALSTCA  423



>ref|XP_008240171.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Prunus mume]
Length=782

 Score =   159 bits (401),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGYE+GCYVGNALL MYCKCGSI EA DVF+GIAEKDVVSWNTMI GYARHGFG +AL 
Sbjct  438  KAGYETGCYVGNALLVMYCKCGSIEEAYDVFQGIAEKDVVSWNTMIYGYARHGFGSKALM  497

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  GIKPDDVTMVGVLSACSHT
Sbjct  498  VFESMKAAGIKPDDVTMVGVLSACSHT  524


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L+ Y +   +G A  +FE + EKDVVSWN M+ GYA++G+  EA + F+ M D    
Sbjct  131  NVMLSGYVRNRDLGAAHALFERMPEKDVVSWNAMLSGYAQNGYVDEARKVFERMPD----  186

Query  48   PDDVTMVGVLSA  13
             ++++  G+L+A
Sbjct  187  KNEISWNGLLAA  198


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G I  A  +F+ +  +D +SW  +I GYA++G+ +EAL  F  MK  G +
Sbjct  348  NTILTGYAQSGDIDSARKIFDSMPRRDSISWAAIIAGYAQNGYSEEALCLFVEMKRDGER  407

Query  48   PDDVTMVGVLSACS  7
                +    LS C+
Sbjct  408  LTRSSFTCALSTCA  421



>ref|XP_006341567.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Solanum tuberosum]
Length=765

 Score =   158 bits (399),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 71/87 (82%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY +GCYVGNALL+MYCKCGSI EA DVFE IAEKD VSWNTMIIGYARHGFGK+AL 
Sbjct  421  KAGYHTGCYVGNALLSMYCKCGSIDEAYDVFEEIAEKDAVSWNTMIIGYARHGFGKQALR  480

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK+ GI+PDDVTMVGVLSAC HT
Sbjct  481  QFESMKEVGIRPDDVTMVGVLSACGHT  507



>ref|XP_009356059.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Pyrus x bretschneideri]
Length=784

 Score =   157 bits (398),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 73/87 (84%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGYE+GCYVGNALL MYCKCGSI EA DVF+GIAEKDVVSWNTMI GYARHGFG +AL 
Sbjct  440  KAGYETGCYVGNALLVMYCKCGSIEEAYDVFQGIAEKDVVSWNTMIYGYARHGFGLKALT  499

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  MK  GIKPDDVTMVGVLSACSHT
Sbjct  500  VFDSMKAAGIKPDDVTMVGVLSACSHT  526


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L+ Y +   +G A  +FE + EKDVVSWN M+ GYA++G+  EA   F+ M D    
Sbjct  133  NVMLSGYVRNRDLGAARALFERMPEKDVVSWNAMLSGYAQNGYVDEARTIFQGMPD----  188

Query  48   PDDVTMVGVLSA  13
             ++++  G+L+A
Sbjct  189  KNEISWNGLLAA  200


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G I  A ++F+ +  +D +SW  +I GYA++G+ +EAL+ F  MK  G +
Sbjct  350  NTILTGYAQSGDIVRAKEIFDSMPRRDSISWAAIIAGYAQNGYSEEALQLFVEMKRDGER  409

Query  48   PDDVTMVGVLSACS  7
                +    LS C+
Sbjct  410  LTRSSFTCALSTCA  423



>ref|XP_009769078.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Nicotiana sylvestris]
 ref|XP_009769079.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Nicotiana sylvestris]
Length=774

 Score =   156 bits (395),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 70/87 (80%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY +GCYVGNALLAMYCKCGSI E  DVFE I EKD VSWNTMI+GYARHGFGK+AL+
Sbjct  430  KAGYHTGCYVGNALLAMYCKCGSIDEPYDVFEEIEEKDAVSWNTMIVGYARHGFGKQALQ  489

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             FK MK+ G KPDDVTMVGVLSAC HT
Sbjct  490  LFKSMKEAGFKPDDVTMVGVLSACGHT  516


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N +L+ Y K  + G A  +F+ +  KDVVSWN ++ GYA++G+  +A   F MM
Sbjct  123  NIMLSGYIKSKNFGSAKILFDQMPVKDVVSWNALLSGYAQNGYIADAKRIFDMM  176



>ref|XP_007210320.1| hypothetical protein PRUPE_ppa002162mg [Prunus persica]
 gb|EMJ11519.1| hypothetical protein PRUPE_ppa002162mg [Prunus persica]
Length=707

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGYE+GCYVGNALL MYCKCGSI EA DVF+GIAEKDVVSWNTMI GYARHGFG +AL 
Sbjct  363  KAGYETGCYVGNALLVMYCKCGSIEEAYDVFQGIAEKDVVSWNTMIYGYARHGFGSKALM  422

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  GIKPDDVTMVGVLSACSHT
Sbjct  423  VFESMKAAGIKPDDVTMVGVLSACSHT  449


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L+ Y +   +G A  +FE + EKDVVSWN M+ GYA++G+  EA + F+ M +    
Sbjct  56   NVMLSGYVRNRDLGAAHALFERMPEKDVVSWNAMLSGYAQNGYVDEARKVFERMPN----  111

Query  48   PDDVTMVGVLSA  13
             ++++  G+L+A
Sbjct  112  KNEISWNGLLAA  123


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G I  A  +F+ +  +D +SW  +I GYA++G+ +EAL  F  MK  G +
Sbjct  273  NTILTGYAQSGDIDNARKIFDSMPRRDSISWAAIIAGYAQNGYSEEALCLFVEMKRDGER  332

Query  48   PDDVTMVGVLSACS  7
                +    LS C+
Sbjct  333  LTRSSFTCTLSTCA  346



>ref|XP_011084409.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Sesamum indicum]
Length=772

 Score =   151 bits (382),  Expect = 2e-40, Method: Composition-based stats.
 Identities = 67/87 (77%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGYE GCYVGNALLAMYC+CGSI EA +VF+ I +KDVVSWNT+IIGYARHGFG+EAL+
Sbjct  428  KAGYEFGCYVGNALLAMYCRCGSINEAYEVFQRIEDKDVVSWNTIIIGYARHGFGEEALK  487

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F++MK   I+PD+VTMVGVLSACSHT
Sbjct  488  HFELMKQASIQPDEVTMVGVLSACSHT  514


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y   G I  A  +F  +  +D +SW ++I GYA+ G  +EAL  F  MK  G +
Sbjct  338  NTMITGYAHNGDIARARSLFNRMPHRDCISWASIIAGYAQTGESEEALRMFIEMKRDGER  397

Query  48   PDDVTMVGVLSACS  7
             +      VLS C+
Sbjct  398  LNRSAFTCVLSTCA  411


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ + K  ++G A  +F+ +  KDVVSWN ++ GYA++GF  EA   F  M +    
Sbjct  121  NIMISGHIKNKNLGAAKRLFDEMPVKDVVSWNAILSGYAQNGFLDEARRVFDEMPE----  176

Query  48   PDDVTMVGVLSA  13
             +++T  G+L+A
Sbjct  177  KNEITWNGILAA  188



>ref|XP_003634283.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Vitis vinifera]
Length=766

 Score =   150 bits (379),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 70/87 (80%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG ESGCYVGNALL MYCKCG+I +A  VFEGI EK+VVSWNTMI GYARHGFGKEAL 
Sbjct  422  KAGLESGCYVGNALLVMYCKCGNIDDAYIVFEGIEEKEVVSWNTMIAGYARHGFGKEALM  481

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  GI PDDVTMVGVLSACSHT
Sbjct  482  LFESMKKTGILPDDVTMVGVLSACSHT  508


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I +A + F+ + ++D +SW  +I GYA+ G+G+EAL  F  MK  G +
Sbjct  332  NTMITGYAQNGDIAQARNFFDRMPQRDSISWAAIIAGYAQSGYGEEALHLFVEMKRDGER  391

Query  48   PDDVTMVGVLSACS  7
             +  T    LS C+
Sbjct  392  LNRSTFTSTLSTCA  405



>emb|CBI15551.3| unnamed protein product [Vitis vinifera]
Length=685

 Score =   149 bits (377),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 70/87 (80%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG ESGCYVGNALL MYCKCG+I +A  VFEGI EK+VVSWNTMI GYARHGFGKEAL 
Sbjct  341  KAGLESGCYVGNALLVMYCKCGNIDDAYIVFEGIEEKEVVSWNTMIAGYARHGFGKEALM  400

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  GI PDDVTMVGVLSACSHT
Sbjct  401  LFESMKKTGILPDDVTMVGVLSACSHT  427


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I +A + F+ + ++D +SW  +I GYA+ G+G+EAL  F  MK  G +
Sbjct  251  NTMITGYAQNGDIAQARNFFDRMPQRDSISWAAIIAGYAQSGYGEEALHLFVEMKRDGER  310

Query  48   PDDVTMVGVLSACS  7
             +  T    LS C+
Sbjct  311  LNRSTFTSTLSTCA  324



>ref|XP_004503293.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Cicer arietinum]
Length=763

 Score =   150 bits (379),  Expect = 4e-40, Method: Composition-based stats.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+GC+VGNALLAMY KCGSI EA D+FEGI EKDVVSWNTM+ GYARHGFGK+AL 
Sbjct  419  KTGYETGCFVGNALLAMYFKCGSIDEANDIFEGIEEKDVVSWNTMLAGYARHGFGKQALM  478

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  G+KPD++TMVGVLSACSHT
Sbjct  479  IFESMKTAGVKPDEITMVGVLSACSHT  505


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 46/82 (56%), Gaps = 4/82 (5%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N +L  Y +   +G+A  +F+ + ++DVVSWN M+ GYA+HG+  +A E F  
Sbjct  105  ERDLFSWNVMLTGYVRNRRLGDARRLFDLMPDRDVVSWNAMLSGYAQHGYVDDAREVFDN  164

Query  69   MKDFGIKPDDVTMVGVLSACSH  4
            M       + ++  G+L+A  H
Sbjct  165  MP----HKNSISWNGLLAAYVH  182


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I +A  +F+ + ++D VSW  +I GYA+ G  +EAL  F  +K  G  
Sbjct  329  NTMITGYGQNGDIAQARKLFDMMPQRDCVSWAAIIAGYAQSGHYEEALNMFVEIKRDGES  388

Query  48   PDDVTMVGVLSACS  7
             +  T    LS C+
Sbjct  389  LNRSTFGCALSTCA  402



>ref|XP_004301257.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Fragaria vesca subsp. vesca]
Length=780

 Score =   149 bits (377),  Expect = 7e-40, Method: Composition-based stats.
 Identities = 69/87 (79%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+ESGCYVGNALL MYCKCG I EA DVF+ I+EKDVVSWNTMI GYARHGFG +AL 
Sbjct  436  KAGFESGCYVGNALLGMYCKCGCIEEAYDVFQEISEKDVVSWNTMIHGYARHGFGSKALM  495

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F +MK  GIKPD+VTMVGVLSACSHT
Sbjct  496  VFDLMKAAGIKPDEVTMVGVLSACSHT  522


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G I  A  VF+ + ++D +SW  +I G+A++GF +EAL  F  MK  G +
Sbjct  346  NTILTGYAQSGDIDGARKVFDSMPQRDSISWAAIIAGHAQNGFSEEALRLFVEMKRDGER  405

Query  48   PDDVTMVGVLSACS  7
                +    LS C+
Sbjct  406  LTRSSFSCALSTCA  419


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N +L+ + +   +G A  +FE + E+DVVSWN ++ GYA++G+  EA + F+MM
Sbjct  129  NVMLSGFVRNKDLGGARALFERMKERDVVSWNAILSGYAQNGYVDEARKVFEMM  182



>ref|XP_010533968.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Tarenaya hassleriana]
Length=774

 Score =   148 bits (374),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+GC+VGNALL MYCKCGSI EA D FE IAEKDVVSWNTMI GYARHGFG+EAL 
Sbjct  430  KVGYETGCFVGNALLLMYCKCGSIEEAYDAFEEIAEKDVVSWNTMIAGYARHGFGEEALR  489

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  G++PDD T+V VLSACSHT
Sbjct  490  VFESMKRQGLRPDDATLVAVLSACSHT  516


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +C +I EA ++F+ +  +D VSW  M+ GY++ G+ +EAL  F  M+  G +
Sbjct  340  NTMITGYAQCSNISEAKNLFDKMPRRDPVSWAAMVAGYSQCGYSEEALNLFVQMEREGGR  399

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  400  LNRSSFSSALSTCA  413


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ Y +  ++G A ++FE + EKD  SWNTM+ GYA++G   EA   F  M +    
Sbjct  123  NVIISGYVRNRNLGMARELFERMFEKDACSWNTMLSGYAQNGCVDEARRIFDRMPE----  178

Query  48   PDDVTMVGVLSA  13
             ++V+   +LSA
Sbjct  179  KNEVSWNALLSA  190



>ref|XP_006490750.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Citrus sinensis]
Length=778

 Score =   148 bits (374),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+E+GC+VGNALL MYCKCGS+ EA   FE I +KDV+SWNTMI GYARHGFGK+AL 
Sbjct  434  KVGFEAGCFVGNALLVMYCKCGSVEEAYHAFEEIVDKDVISWNTMIAGYARHGFGKDALM  493

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             FK MK  GIKPDD+TMVG+LSACSHT
Sbjct  494  LFKSMKTVGIKPDDITMVGILSACSHT  520


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/75 (31%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I  A ++F+ + + D +SW  +I GYA+ G+ +++L  F  MK +G +
Sbjct  344  NTMITGYAQSGEITHARNLFDRMPQHDCISWAAIIAGYAQSGYSEDSLRLFIEMKRYGER  403

Query  48   PDDVTMVGVLSACSH  4
             +      VLS C++
Sbjct  404  LNRSPFTSVLSTCAN  418


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ Y +  S+  A ++FE + ++DVVSWNTM+ GYA++G+   A   F  M    ++
Sbjct  127  NVMISGYVRNKSLSAARNLFEMMPKRDVVSWNTMLSGYAQNGYADAARRIFDRM----LE  182

Query  48   PDDVTMVGVLSA  13
             ++++  G+L+A
Sbjct  183  KNEISWNGLLAA  194



>ref|XP_008453471.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Cucumis melo]
Length=776

 Score =   147 bits (371),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 69/87 (79%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+E+G Y GNALLAMYCKCGSI EA DVFE I EKD+VSWNTMI GYARHGFGKEAL 
Sbjct  433  KAGFETGYYAGNALLAMYCKCGSIEEAFDVFEDITEKDIVSWNTMIAGYARHGFGKEALA  492

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK   IKPDDVT+VGVLSACSHT
Sbjct  493  LFESMK-MTIKPDDVTLVGVLSACSHT  518


 Score = 58.9 bits (141),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG+I +A  +F+ + ++D +SW  MI GYA+ G  +EAL  F  MK  G  
Sbjct  343  NTMVTGYAQCGNIDQAKILFDEMPQRDCISWAAMISGYAQSGQSEEALHLFIEMKRDGGI  402

Query  48   PDDVTMVGVLSACS  7
             +   +VG LS+C+
Sbjct  403  LNRSALVGALSSCA  416


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L+ Y K G++  A  +F  + EKDVVSWN M+ G+A++GF +EA + F  M    + 
Sbjct  126  NVMLSGYVKNGNLSAARALFNQMPEKDVVSWNAMLSGFAQNGFVEEARKIFDQM----LV  181

Query  48   PDDVTMVGVLSA  13
             ++++  G+LSA
Sbjct  182  KNEISWNGLLSA  193



>emb|CDO98371.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   147 bits (371),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KA +ESGCYVGNALLAMYCKCG I EA DVF+ I EKD++SWNTMI GYARHGFG EAL+
Sbjct  433  KARFESGCYVGNALLAMYCKCGCIEEAYDVFKEIEEKDLISWNTMINGYARHGFGFEALQ  492

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ M+  GI+PDDVTMVGVLSACSHT
Sbjct  493  LFEAMERAGIRPDDVTMVGVLSACSHT  519


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G +  A  +F+ +  +D +SW  +I GYA++G  +EAL  F  MK  G +
Sbjct  343  NTMITCYAQNGDVSRARSLFDRMPHRDCISWAAIIGGYAQNGDSEEALCMFVEMKRDGER  402

Query  48   PDDVTMVGVLSACS  7
             +  +   VLS C+
Sbjct  403  MNRSSFTCVLSTCA  416


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ Y K  ++G A  +F+ + E+DVVSWN ++ GYA++G+  EA   F  M      
Sbjct  126  NVMISGYIKNKNLGAAKMLFDQMPERDVVSWNAILSGYAQNGYVDEARRIFYEMP----V  181

Query  48   PDDVTMVGVLSA  13
             ++++  G+L+A
Sbjct  182  RNEISWNGILAA  193



>ref|XP_011039111.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Populus euphratica]
Length=771

 Score =   147 bits (370),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY++G YVGNALLAMYCKCGSI EA D FE I EKDVVSWNTMI GYARHGFG+EAL 
Sbjct  427  KAGYQTGWYVGNALLAMYCKCGSIDEARDAFEEILEKDVVSWNTMIHGYARHGFGEEALT  486

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             FK+MK  GI+PDD TMV VL+ACSH
Sbjct  487  IFKLMKTAGIRPDDATMVSVLAACSH  512


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G+I  A ++F+ + ++D +SW+ MI GY+++G+ +EAL FF  M+    +
Sbjct  337  NTMITGYAQSGNIAHARNLFDNMHQRDSISWSAMIAGYSQNGYSEEALHFFVEMQRDCER  396

Query  48   PDDVTMVGVLSACSH  4
             +  +    LS CS+
Sbjct  397  LNRSSFTCALSTCSN  411


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            NA++A Y KC  +  A ++FE +  +D  SWNTMI GYA+ G    A   F  M
Sbjct  306  NAMIAGYVKCKRMDMARELFEEMPSRDASSWNTMITGYAQSGNIAHARNLFDNM  359


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/61 (38%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N +L  Y +   +  A  +FE + E+D VSWN M+ GYA++GF  EA + F  
Sbjct  113  ERDLFSWNVMLTGYVRNRDLKTARALFERMPERDTVSWNAMLSGYAQNGFVDEARDIFDK  172

Query  69   M  67
            M
Sbjct  173  M  173



>gb|KDO62894.1| hypothetical protein CISIN_1g004024mg [Citrus sinensis]
Length=778

 Score =   147 bits (370),  Expect = 8e-39, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+E+GC+VGNALL MYCKCGS+ EA   FE I +KDV+SWNTMI GYARHGFGK+AL 
Sbjct  434  KVGFEAGCFVGNALLVMYCKCGSVEEAYHAFEEIVDKDVISWNTMIAGYARHGFGKDALM  493

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  GIKPDD+TMVG+LSACSHT
Sbjct  494  LFESMKTVGIKPDDITMVGILSACSHT  520


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/75 (31%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I  A ++F+ + + D +SW  +I GYA+ G+ +++L  F  MK +G +
Sbjct  344  NTMITGYAQSGEITHARNLFDRMPQHDCISWAAIIAGYAQSGYSEDSLRLFIEMKRYGER  403

Query  48   PDDVTMVGVLSACSH  4
             +      VLS C++
Sbjct  404  LNRSPFTSVLSTCAN  418


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ Y +  S+  A ++FE + ++DVVSWNTM+ GYA++G+   A   F  M    ++
Sbjct  127  NVMISGYVRNKSLSAARNLFEMMPKRDVVSWNTMLSGYAQNGYADAARRIFDRM----LE  182

Query  48   PDDVTMVGVLSA  13
             ++++  G+L+A
Sbjct  183  KNEISWNGLLAA  194



>ref|XP_008797547.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Phoenix dactylifera]
Length=778

 Score =   145 bits (367),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 66/86 (77%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY  GC+VGNALLAMYCKCGSI EA   F  +AE+DVVSWNTMI GYARHGFGKEALE
Sbjct  434  KAGYGMGCFVGNALLAMYCKCGSIDEAYKAFNEMAERDVVSWNTMIAGYARHGFGKEALE  493

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F MM+    KPDD+TMVGVLSACSH
Sbjct  494  IFDMMRATNTKPDDITMVGVLSACSH  519


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 4/75 (5%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA++A Y +C  + EA ++F  +  ++V SWNTMI GYA+ G  + A E F MM     +
Sbjct  313  NAMIAAYVQCRRMDEAEELFNSMPCRNVNSWNTMITGYAQAGMIERAREMFDMMP----Q  368

Query  48   PDDVTMVGVLSACSH  4
             D V+   +++ CS 
Sbjct  369  RDSVSWAAMIAGCSQ  383


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NA++A Y +   + EA  +F+ + ++DVVSWNTMI GYA+ G   EA   F
Sbjct  220  NAMIAGYAQRKRMAEARQLFDRMPQRDVVSWNTMISGYAQSGDMAEAKRLF  270


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I  A ++F+ + ++D VSW  MI G ++ GF +EAL  F  M     +
Sbjct  344  NTMITGYAQAGMIERAREMFDMMPQRDSVSWAAMIAGCSQGGFSEEALRLFVGMGRSRER  403

Query  48   PDDVTMVGVLSACS  7
             +  +   VLS C+
Sbjct  404  MNRSSFTCVLSTCA  417



>ref|XP_003524346.2| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Glycine max]
Length=769

 Score =   145 bits (367),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+E+GC+VGNALL MY KCGS  EA DVFEGI EKDVVSWNTMI GYARHGFG++AL 
Sbjct  425  KAGFETGCFVGNALLGMYFKCGSTDEANDVFEGIEEKDVVSWNTMIAGYARHGFGRQALV  484

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  G+KPD++TMVGVLSACSH+
Sbjct  485  LFESMKKAGVKPDEITMVGVLSACSHS  511


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 4/82 (5%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N +L  Y +   +GEA  +F+ + +KDVVSWN M+ GYA++GF  EA E F  
Sbjct  111  ERDLFSWNVMLTGYVRNRRLGEAHKLFDLMPKKDVVSWNAMLSGYAQNGFVDEAREVFNK  170

Query  69   MKDFGIKPDDVTMVGVLSACSH  4
            M       + ++  G+L+A  H
Sbjct  171  MP----HRNSISWNGLLAAYVH  188


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I +A  +F+ + ++D VSW  +I GYA++G  +EAL  F  MK  G  
Sbjct  335  NTMITGYGQNGGIAQARKLFDMMPQRDCVSWAAIISGYAQNGHYEEALNMFVEMKRDGES  394

Query  48   PDDVTMVGVLSACS  7
             +  T    LS C+
Sbjct  395  SNRSTFSCALSTCA  408



>ref|XP_007036762.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007036763.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 ref|XP_007036764.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY21263.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY21264.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY21265.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
Length=768

 Score =   145 bits (366),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 67/86 (78%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGYESG +VGNALL MYCKCG I EA   FE I EKDVVSWNTMI GYARHGFGKEAL+
Sbjct  424  KAGYESGSFVGNALLLMYCKCGGIEEACSAFEEIMEKDVVSWNTMIAGYARHGFGKEALK  483

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK  G+KPDD TMVGVLSACSH
Sbjct  484  VFESMKAAGVKPDDTTMVGVLSACSH  509


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I  A ++F+ +  +D VSW  MI GYA+ G+ +EAL  F  MK  G +
Sbjct  334  NTIITGYAQSGEIAHARELFDRMPRRDPVSWAAMIAGYAQSGYDEEALCLFVEMKRDGER  393

Query  48   PDDVTMVGVLSACSH  4
             +  +    LS C+H
Sbjct  394  LNRSSFACALSTCAH  408



>ref|XP_002872815.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH49074.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=776

 Score =   144 bits (364),  Expect = 5e-38, Method: Composition-based stats.
 Identities = 64/87 (74%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+GC+VGNALL MYCKCGSI EA D+F+ +A KD+VSWNTMI GY+RHGFG+EAL 
Sbjct  432  KGGYETGCFVGNALLLMYCKCGSIEEANDLFKEMAGKDIVSWNTMIAGYSRHGFGEEALR  491

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
            FF+ MK  G+KPDD TMV VLSACSHT
Sbjct  492  FFESMKREGLKPDDATMVAVLSACSHT  518


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG I EA ++F+ + ++D VSW  MI GY++ G   EAL  F +M+  G +
Sbjct  342  NTMITGYAQCGKISEAKNLFDKMPKRDPVSWAAMIAGYSQSGHSYEALRLFVLMEREGGR  401

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  402  LNRSSFSSALSTCA  415


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +  ++G+A ++FE + E+DV SWNT++ GYA++G   +A   F  M +    
Sbjct  125  NVMIKGYVRNRNLGKARELFERMPERDVCSWNTILSGYAQNGCVDDARRVFDRMPE----  180

Query  48   PDDVTMVGVLSA  13
             +DV+   +LSA
Sbjct  181  KNDVSWNALLSA  192



>ref|XP_002318526.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE96746.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=578

 Score =   142 bits (359),  Expect = 6e-38, Method: Composition-based stats.
 Identities = 65/86 (76%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY++G YVGNALLAMYCKCGSI EA D F+ I EKDVVSWNTMI GYARHGFG+EAL 
Sbjct  234  KAGYQTGWYVGNALLAMYCKCGSIDEARDAFQEILEKDVVSWNTMIHGYARHGFGEEALT  293

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F++MK  GI+PDD TMV VL+ACSH
Sbjct  294  VFELMKTTGIRPDDATMVSVLAACSH  319


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N +L  Y +   +  A  +FE + E+D+VSWN M+ GYA++GF  EA E F  
Sbjct  49   ERDLFSWNVMLTGYVRNRDLKTARALFERMPERDIVSWNAMLSGYAQNGFVDEAREIFDK  108

Query  69   M  67
            M
Sbjct  109  M  109



>gb|KHN21662.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=1526

 Score =   145 bits (367),  Expect = 7e-38, Method: Composition-based stats.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = -2

Query  261   KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
             KAG+E+GC+VGNALL MY KCGS  EA DVFEGI EKDVVSWNTMI GYARHGFG++AL 
Sbjct  1182  KAGFETGCFVGNALLGMYFKCGSTDEANDVFEGIEEKDVVSWNTMIAGYARHGFGRQALV  1241

Query  81    FFKMMKDFGIKPDDVTMVGVLSACSHT  1
              F+ MK  G+KPD++TMVGVLSACSH+
Sbjct  1242  LFESMKKAGVKPDEITMVGVLSACSHS  1268


 Score =   120 bits (301),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 50/78 (64%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + GYE GC VGNAL+ MYCKCG I EA DVF+G+  KD+VSWNTM+ GYARHGFG++AL 
Sbjct  406  RTGYEKGCLVGNALVGMYCKCGCIDEAYDVFQGVQHKDIVSWNTMLAGYARHGFGRQALT  465

Query  81   FFKMMKDFGIKPDDVTMV  28
             F+ M   G+KPD++TMV
Sbjct  466  VFESMITAGVKPDEITMV  483


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 4/82 (5%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N +L  Y +   +GEA  +F+ + +KDVVSWN M+ GYA++GF  EA E F  
Sbjct  868  ERDLFSWNVMLTGYVRNRRLGEAHKLFDLMPKKDVVSWNAMLSGYAQNGFVDEAREVFNK  927

Query  69   MKDFGIKPDDVTMVGVLSACSH  4
            M       + ++  G+L+A  H
Sbjct  928  MP----HRNSISWNGLLAAYVH  945


 Score = 53.9 bits (128),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ YC+ G + +A ++F+ + ++D VSW  +I GYA++G  +EA+     MK  G  
Sbjct  316  NIMISGYCQNGDLAQARNLFDMMPQRDSVSWAAIIAGYAQNGLYEEAMNMLVEMKRDGES  375

Query  48   PDDVTMVGVLSACS  7
             +  T    LSAC+
Sbjct  376  LNRSTFCCALSACA  389


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  228   NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
             N ++  Y + G I +A  +F+ + ++D VSW  +I GYA++G  +EAL  F  MK  G  
Sbjct  1092  NTMITGYGQNGGIAQARKLFDMMPQRDCVSWAAIISGYAQNGHYEEALNMFVEMKRDGES  1151

Query  48    PDDVTMVGVLSACS  7
              +  T    LS C+
Sbjct  1152  SNRSTFSCALSTCA  1165


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            NA+L+ Y + G + EA DVF+ +  K+ +SWN ++  Y R G  +EA   F+   D+
Sbjct  130  NAMLSGYVRSGHVDEARDVFDRMPHKNSISWNGLLAAYVRSGRLEEARRLFESKSDW  186



>ref|XP_009402626.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Musa acuminata subsp. malaccensis]
Length=772

 Score =   144 bits (362),  Expect = 8e-38, Method: Composition-based stats.
 Identities = 64/86 (74%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY  GC+VGNALLAMYCKCGSI EA + FE + EKDVVSWNTMI GYARHG+GKEAL+
Sbjct  428  KAGYRMGCFVGNALLAMYCKCGSIDEAYEAFEEMTEKDVVSWNTMIAGYARHGYGKEALK  487

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F +M+    +PDDVTMVGVLSACSH
Sbjct  488  VFNLMRMTDTRPDDVTMVGVLSACSH  513


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N+++  Y + G +  A  +F+ + ++D VSW  MI GY+  G  +EAL+ F  M  +G +
Sbjct  338  NSMITGYAQAGMVERARWIFDTMPQRDSVSWAAMIAGYSHEGSSEEALQLFIEMGRYGER  397

Query  48   PDDVTMVGVLSACS  7
             +  +   VLS C+
Sbjct  398  INRSSFTCVLSTCA  411


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NA++A Y +  S+ EAL +F+ + E+D+VSWNT+I GYA++G    A   F
Sbjct  214  NAMIAGYVQRRSLAEALQLFDRMPERDIVSWNTLISGYAQNGDMSVATRLF  264


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA++A Y +C  + +A ++F+ +  ++V SWN+MI GYA+ G  + A   F  M     +
Sbjct  307  NAMIAAYVQCQKMDQAKELFDVMPCRNVNSWNSMITGYAQAGMVERARWIFDTMP----Q  362

Query  48   PDDVTMVGVLSACSH  4
             D V+   +++  SH
Sbjct  363  RDSVSWAAMIAGYSH  377



>ref|XP_010087050.1| hypothetical protein L484_012294 [Morus notabilis]
 ref|XP_010113226.1| hypothetical protein L484_000356 [Morus notabilis]
 gb|EXB25868.1| hypothetical protein L484_012294 [Morus notabilis]
 gb|EXC75162.1| hypothetical protein L484_000356 [Morus notabilis]
Length=773

 Score =   144 bits (362),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+E+GCYVGNALL MY KCGSI EA +VF+ I  KD+VSWNTMI GYARHGFGKEAL 
Sbjct  429  KAGFETGCYVGNALLVMYSKCGSIEEAYNVFKDIEVKDIVSWNTMIAGYARHGFGKEALM  488

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  GI PDDVT+VGVLSACSHT
Sbjct  489  IFESMKAMGIIPDDVTLVGVLSACSHT  515


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKD  61
            N +L+ Y +   +G A  +F+ + E+DVVSWN+M+ GYA++G+  EA++ F+MM D
Sbjct  122  NVMLSGYVRNRKLGAARMLFDRMPERDVVSWNSMLSGYAQYGYVDEAMKIFEMMPD  177


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G I +A  +F+ + ++D +SW  +I GYA++G+G+EAL  F  MK  G +
Sbjct  339  NTMLTAYAQSGDIAQARFIFDRMPQRDSISWAAIIAGYAQNGYGEEALRLFMEMKKEGER  398

Query  48   PDDVTMVGVLSACS  7
                     LS C+
Sbjct  399  LTRSCYTCALSTCA  412



>ref|XP_010455917.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Camelina sativa]
Length=776

 Score =   142 bits (357),  Expect = 5e-37, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+GC+VGNALL MYCKCGSI EA D+F+ +  KD+VSWNTMI GY+RHGFG+EAL 
Sbjct  432  KGGYETGCFVGNALLLMYCKCGSIEEAYDLFKEMDGKDIVSWNTMIAGYSRHGFGEEALM  491

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
            FF+ MK  G+KPDD T+V VLSACSHT
Sbjct  492  FFEAMKREGMKPDDATLVAVLSACSHT  518


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG I EA   F+ + ++D VSW  MI GY++ G   EAL  F  M+  G +
Sbjct  342  NTMITRYAQCGKISEAKSFFDKMPKRDPVSWAAMIAGYSQSGHSYEALGLFVQMEREGGR  401

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  402  LNRSSFSSALSTCA  415


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +  ++G+A ++F+ + E+DV SWNTM+ GYA++G   +A + F  M +    
Sbjct  124  NVMIKGYVRNRNLGKARELFDRMPERDVCSWNTMLSGYAQNGCVDDARKVFDRMPE----  179

Query  48   PDDVTMVGVLSA  13
             +DV+   +LSA
Sbjct  180  KNDVSWNALLSA  191



>ref|XP_006451657.1| hypothetical protein CICLE_v10007619mg [Citrus clementina]
 gb|ESR64897.1| hypothetical protein CICLE_v10007619mg [Citrus clementina]
Length=707

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+E+GC+VGNALL MYCKCGS+ EA   FE I +KDV+SWNTMI GYARHGFGK+AL 
Sbjct  363  KVGFEAGCFVGNALLVMYCKCGSVEEAYHAFEEIVDKDVISWNTMIAGYARHGFGKDALM  422

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  GIKPDD+TMVG+LSACSHT
Sbjct  423  LFESMKTVGIKPDDITMVGILSACSHT  449


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I  A ++F+ + + D +SW  +I GYA+ G+ +++L  F  MK +G +
Sbjct  273  NTMITGYAQSGEITHARNLFDRMPQHDCISWAAIIAGYAQSGYSEDSLRLFIEMKRYGER  332

Query  48   PDDVTMVGVLSACSH  4
             +      VLS C++
Sbjct  333  LNRSPFTSVLSTCAN  347


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ Y +  S+  A ++FE + ++DVVSWNTM+ GYA++G+   A   F  M    ++
Sbjct  56   NVMISGYVRNKSLSAARNLFEMMPKRDVVSWNTMLSGYAQNGYADAARRIFDRM----LE  111

Query  48   PDDVTMVGVLSA  13
             ++++  G+L+A
Sbjct  112  KNEISWNGLLAA  123



>ref|NP_192184.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9SY02.1|PP301_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g02750 
[Arabidopsis thaliana]
 gb|AAD15348.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77760.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82224.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=781

 Score =   141 bits (355),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+GC+VGNALL MYCKCGSI EA D+F+ +A KD+VSWNTMI GY+RHGFG+ AL 
Sbjct  437  KGGYETGCFVGNALLLMYCKCGSIEEANDLFKEMAGKDIVSWNTMIAGYSRHGFGEVALR  496

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
            FF+ MK  G+KPDD TMV VLSACSHT
Sbjct  497  FFESMKREGLKPDDATMVAVLSACSHT  523


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG I EA ++F+ + ++D VSW  MI GY++ G   EAL  F  M+  G +
Sbjct  347  NTMITGYAQCGKISEAKNLFDKMPKRDPVSWAAMIAGYSQSGHSFEALRLFVQMEREGGR  406

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  407  LNRSSFSSALSTCA  420


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +  ++G+A ++FE + E+DV SWNTM+ GYA++G   +A   F  M +    
Sbjct  130  NVMIKGYVRNRNLGKARELFEIMPERDVCSWNTMLSGYAQNGCVDDARSVFDRMPE----  185

Query  48   PDDVTMVGVLSA  13
             +DV+   +LSA
Sbjct  186  KNDVSWNALLSA  197



>gb|ABE80149.1| Tetratricopeptide-like helical [Medicago truncatula]
 gb|AET05560.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=766

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY +GC+VGNALLAMY KCGSI EA D FEGI EKDVVSWNTM+ GYARHGFG++AL 
Sbjct  422  KMGYGTGCFVGNALLAMYFKCGSIDEANDTFEGIEEKDVVSWNTMLAGYARHGFGRQALT  481

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  G+KPD++TMVGVLSACSHT
Sbjct  482  VFESMKTAGVKPDEITMVGVLSACSHT  508


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N +L  Y +   +G+A  +F+ + EKDVVSWN+++ GYA++G+  EA E F  
Sbjct  108  ERDLFSWNVMLTGYVRNCRLGDARRLFDLMPEKDVVSWNSLLSGYAQNGYVDEAREVFDN  167

Query  69   MKDFGIKPDDVTMVGVLSACSHT  1
            M +     + ++  G+L+A  H 
Sbjct  168  MPE----KNSISWNGLLAAYVHN  186


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I +A   F+ + ++D VSW  +I GYA+ G  +EAL  F  +K  G  
Sbjct  332  NTMITGYGQIGDIAQARKFFDMMPQRDCVSWAAIIAGYAQSGHYEEALNMFVEIKQDGES  391

Query  48   PDDVTMVGVLSACS  7
             +  T    LS C+
Sbjct  392  LNRATFGCALSTCA  405



>ref|XP_006393385.1| hypothetical protein EUTSA_v10011302mg [Eutrema salsugineum]
 gb|ESQ30671.1| hypothetical protein EUTSA_v10011302mg [Eutrema salsugineum]
Length=650

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+GC+VGNALL MYCKCGSI EA D+FE +  KD+VSWNTMI GY+RHGFG+EAL 
Sbjct  306  KGGYETGCFVGNALLLMYCKCGSIEEAYDLFEEMTGKDIVSWNTMIAGYSRHGFGEEALR  365

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
            FF+ MK  G+KPDD T+V VLSACSHT
Sbjct  366  FFESMKREGLKPDDATLVAVLSACSHT  392


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG + EA  +F+ + ++D VSW  MI GY++ G G EAL  F  M+  G +
Sbjct  216  NTMITGYAQCGDVSEAKKLFDKMPKRDPVSWAAMIAGYSQCGHGYEALRLFVQMEREGGR  275

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  276  LNRSSFSSALSTCA  289


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 41/66 (62%), Gaps = 4/66 (6%)
 Frame = -2

Query  210  YCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTM  31
            Y +  ++G+A ++FE + E+DV SWNT++ GYA++G   EA   F  M +     ++V+ 
Sbjct  5    YVRNRNLGKARELFESMPERDVCSWNTILSGYAQNGCVDEARRVFDRMPE----KNEVSW  60

Query  30   VGVLSA  13
              +LSA
Sbjct  61   NALLSA  66



>ref|XP_010927442.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Elaeis guineensis]
Length=777

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY  GC+VGNALLAMYCKCGSI EA   F+ +AE+DVVSWNTMI GYARHGFGKEALE
Sbjct  433  KAGYGMGCFVGNALLAMYCKCGSIDEAYKAFKEMAERDVVSWNTMIAGYARHGFGKEALE  492

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  M+    KPDD+TMVGVLSACSH
Sbjct  493  IFDTMRTTDTKPDDITMVGVLSACSH  518


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 4/82 (5%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E      NA++A Y +C  + EA ++F  +  ++V SWNTMI GYA+ G  + A E F M
Sbjct  305  ERNSVSWNAMIAAYVQCRRMEEAEELFNSMPCRNVNSWNTMITGYAQAGMIERAHEMFDM  364

Query  69   MKDFGIKPDDVTMVGVLSACSH  4
            M     + D V+   +++  S 
Sbjct  365  MP----QRDSVSWAAMIAGLSQ  382


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I  A ++F+ + ++D VSW  MI G ++ GFG+EAL  F  M   G +
Sbjct  343  NTMITGYAQAGMIERAHEMFDMMPQRDSVSWAAMIAGLSQGGFGEEALRLFVEMGRSGER  402

Query  48   PDDVTMVGVLSACS  7
             +  +   VLS C+
Sbjct  403  MNRSSFTCVLSTCA  416


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NA++A Y +   + +A  +F+ + E+DVVSWNTMI GYA+ G   EA   F
Sbjct  219  NAMIAGYAQRKRMADARQLFDRMLERDVVSWNTMISGYAQSGDMAEAKRLF  269



>ref|XP_006290208.1| hypothetical protein CARUB_v10003899mg [Capsella rubella]
 gb|EOA23106.1| hypothetical protein CARUB_v10003899mg [Capsella rubella]
Length=756

 Score =   140 bits (352),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+GC+VGNALL MYCKCGSI EA D+F+ +  KD+VSWNT+I GY+RHGFG+EAL 
Sbjct  412  KGGYETGCFVGNALLLMYCKCGSIEEANDLFKEMNGKDIVSWNTLIAGYSRHGFGEEALR  471

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
            FF+ MK  G+KPDD T+V VLSACSHT
Sbjct  472  FFESMKREGLKPDDATLVAVLSACSHT  498


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  + +CG I EA ++F+ +  +D VSW  MI GY++ G   EAL  F  M+  G +
Sbjct  322  NTMITGFSQCGKISEAKNLFDKMPMRDPVSWAAMISGYSQSGHSYEALRLFVQMEREGGR  381

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  382  LNRSSFSSALSTCA  395


 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 27/77 (35%), Positives = 46/77 (60%), Gaps = 9/77 (12%)
 Frame = -2

Query  228  NALLAMYCKCG-----SIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMK  64
            NA+++ Y + G     ++G A ++FE + E+DV SWNTM+ GYA++G   +A   F  M 
Sbjct  100  NAMISGYLRNGYVRNRNLGIARELFERMPERDVCSWNTMLSGYAQNGCVDDARRIFDRMP  159

Query  63   DFGIKPDDVTMVGVLSA  13
            +     ++V+   +LSA
Sbjct  160  E----KNEVSWNALLSA  172



>ref|XP_010430241.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Camelina sativa]
Length=775

 Score =   140 bits (352),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+GC+VGNALL MYCKCGSI EA D+F+ +  KD VSWNTMI GY+RHGFG+EAL 
Sbjct  430  KGGYETGCFVGNALLLMYCKCGSIEEAYDLFKEMDGKDNVSWNTMIAGYSRHGFGEEALR  489

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
            FF+ MK  G+KPDD T+V VLSACSHT
Sbjct  490  FFEAMKREGLKPDDATLVAVLSACSHT  516


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG++ EA   F+ + ++D VSW  MI GY++ G   EAL  F  M+  G +
Sbjct  340  NTMITGYAQCGNVSEAKSFFDKMPKRDPVSWAAMIAGYSQSGHSYEALGLFVQMEREGGR  399

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  400  LNRSSFSSALSTCA  413


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +  ++G+A ++FE + EKDV SWNTM+ GYA++G   +A + F  M +    
Sbjct  122  NVMIKGYVRNRNLGKARELFERMPEKDVCSWNTMLSGYAQNGCVDDARKVFDRMPE----  177

Query  48   PDDVTMVGVLSA  13
             +DV+   +LSA
Sbjct  178  KNDVSWNALLSA  189



>ref|XP_009147955.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Brassica rapa]
Length=776

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYESGC+VGNALL MYCKCGSIG+A D+FE +  +D+VSWNTMI GY+RHGFG+EAL 
Sbjct  432  KGGYESGCFVGNALLLMYCKCGSIGDASDLFEEMTGRDIVSWNTMISGYSRHGFGEEALR  491

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  G+KPDD TMV VLSACSHT
Sbjct  492  LFESMKREGLKPDDATMVAVLSACSHT  518


 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG + EA  +F+ + ++D VSW  MI GY++ G G EAL  F  M+  G +
Sbjct  342  NTMITGYAQCGDVSEAKSLFDKMPKRDPVSWAAMIAGYSQSGHGHEALRLFVQMEREGGR  401

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  402  LNRSSFSSALSTCA  415


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +  S+G+A ++FE ++E+DV SWNTM+ GYA++G   EA   F  M +    
Sbjct  125  NVMIKGYVRNRSLGKARELFERMSERDVCSWNTMLSGYAQNGCVDEARRVFDRMPE----  180

Query  48   PDDVTMVGVLSA  13
             ++V+   +LSA
Sbjct  181  RNEVSWNALLSA  192


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            N LL  + K   I EA   F+G++ +DVVSWNT+I GYA+ G   EA + F
Sbjct  218  NCLLGGFVKKKKIVEARKFFDGMSVRDVVSWNTIITGYAQSGKIDEARKLF  268



>ref|XP_003524347.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Glycine max]
Length=750

 Score =   139 bits (351),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + GYE GC VGNAL+ MYCKCG I EA DVF+G+  KD+VSWNTM+ GYARHGFG++AL 
Sbjct  406  RTGYEKGCLVGNALVGMYCKCGCIDEAYDVFQGVQHKDIVSWNTMLAGYARHGFGRQALT  465

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ M   G+KPD++TMVGVLSACSHT
Sbjct  466  VFESMITAGVKPDEITMVGVLSACSHT  492


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ YC+ G + +A ++F+ + ++D VSW  +I GYA++G  +EA+     MK  G  
Sbjct  316  NIMISGYCQNGDLAQARNLFDMMPQRDSVSWAAIIAGYAQNGLYEEAMNMLVEMKRDGES  375

Query  48   PDDVTMVGVLSACS  7
             +  T    LSAC+
Sbjct  376  LNRSTFCCALSACA  389


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            NA+L+ Y + G + EA DVF+ +  K+ +SWN ++  Y R G  +EA   F+   D+
Sbjct  130  NAMLSGYVRSGHVDEARDVFDRMPHKNSISWNGLLAAYVRSGRLEEARRLFESKSDW  186



>ref|XP_003631084.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=980

 Score =   140 bits (353),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY +GC+VGNALLAMY KCGSI EA D FEGI EKDVVSWNTM+ GYARHGFG++AL 
Sbjct  422  KMGYGTGCFVGNALLAMYFKCGSIDEANDTFEGIEEKDVVSWNTMLAGYARHGFGRQALT  481

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  G+KPD++TMVGVLSACSHT
Sbjct  482  VFESMKTAGVKPDEITMVGVLSACSHT  508


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N +L  Y +   +G+A  +F+ + EKDVVSWN+++ GYA++G+  EA E F  
Sbjct  108  ERDLFSWNVMLTGYVRNCRLGDARRLFDLMPEKDVVSWNSLLSGYAQNGYVDEAREVFDN  167

Query  69   MKDFGIKPDDVTMVGVLSACSHT  1
            M +     + ++  G+L+A  H 
Sbjct  168  MPE----KNSISWNGLLAAYVHN  186


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G I +A   F+ + ++D VSW  +I GYA+ G  +EAL  F  +K  G  
Sbjct  332  NTMITGYGQIGDIAQARKFFDMMPQRDCVSWAAIIAGYAQSGHYEEALNMFVEIKQDGES  391

Query  48   PDDVTMVGVLSACS  7
             +  T    LS C+
Sbjct  392  LNRATFGCALSTCA  405



>ref|XP_010031274.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Eucalyptus grandis]
Length=779

 Score =   139 bits (351),  Expect = 3e-36, Method: Composition-based stats.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY S  +VGNA+L+MYCKCGSI EA D F+ I +KDVVSWNTMI GYARHGFGKEAL 
Sbjct  435  KAGYASRWFVGNAILSMYCKCGSIEEAYDAFQDIKDKDVVSWNTMIAGYARHGFGKEALA  494

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M+  GIKPDDVTMVG+LSAC+H
Sbjct  495  IFESMQAVGIKPDDVTMVGMLSACAH  520


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G+I +A  +F+ + ++D +SW  +I GYA+ G  +EAL  F  M   G +
Sbjct  345  NTMITCYAQSGNISQARSLFDEMPQRDCISWAAIIAGYAQTGHCEEALHQFVEMNRAGER  404

Query  48   PDDVTMVGVLSACS  7
             +       LSAC+
Sbjct  405  LNRSAFTCSLSACA  418


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 23/68 (34%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA+L+ Y + G + EA  +F  +  KD VSWN ++  Y ++G  +EA   F    D+ + 
Sbjct  159  NAMLSGYAQYGYVDEARHIFNEMPTKDAVSWNGLLAAYVQNGRLEEAQLLFNSKTDWEVV  218

Query  48   PDDVTMVG  25
            P +  M G
Sbjct  219  PWNCLMAG  226



>ref|XP_006580405.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X2 [Glycine max]
Length=718

 Score =   139 bits (350),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + GYE GC VGNAL+ MYCKCG I EA DVF+G+  KD+VSWNTM+ GYARHGFG++AL 
Sbjct  374  RTGYEKGCLVGNALVGMYCKCGCIDEAYDVFQGVQHKDIVSWNTMLAGYARHGFGRQALT  433

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ M   G+KPD++TMVGVLSACSHT
Sbjct  434  VFESMITAGVKPDEITMVGVLSACSHT  460


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ YC+ G + +A ++F+ + ++D VSW  +I GYA++G  +EA+     MK  G  
Sbjct  284  NIMISGYCQNGDLAQARNLFDMMPQRDSVSWAAIIAGYAQNGLYEEAMNMLVEMKRDGES  343

Query  48   PDDVTMVGVLSACS  7
             +  T    LSAC+
Sbjct  344  LNRSTFCCALSACA  357


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/57 (37%), Positives = 34/57 (60%), Gaps = 0/57 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            NA+L+ Y + G + EA DVF+ +  K+ +SWN ++  Y R G  +EA   F+   D+
Sbjct  130  NAMLSGYVRSGHVDEARDVFDRMPHKNSISWNGLLAAYVRSGRLEEARRLFESKSDW  186



>ref|XP_010422542.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
isoform X1 [Camelina sativa]
 ref|XP_010422543.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
isoform X2 [Camelina sativa]
Length=776

 Score =   139 bits (350),  Expect = 4e-36, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+GC+VGNALL MYCKCGSI EA D+F+ +  KD+VSWNTMI GY+RHGFG+EAL 
Sbjct  432  KGGYETGCFVGNALLLMYCKCGSIEEAYDLFKEMDGKDIVSWNTMIAGYSRHGFGEEALR  491

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
            FF+ MK   +KPDD T+V VLSACSHT
Sbjct  492  FFEAMKRERLKPDDATLVAVLSACSHT  518


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG + EA + F+ + ++D VSW  MI GY++ G   EAL  F  M+  G +
Sbjct  342  NTMITGYAQCGKLSEAKNFFDKMPKRDPVSWAAMIAGYSQSGHSYEALGLFVQMEREGGR  401

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  402  LNRSSFSSALSTCA  415


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +  ++G+A ++FE + E+DV SWNTM+ GYA++G   +A + F  M +    
Sbjct  124  NVMIKGYVRNRNLGKARELFERMPERDVCSWNTMLSGYAQNGCVDDARKVFDRMPE----  179

Query  48   PDDVTMVGVLSA  13
             +DV+   +LSA
Sbjct  180  KNDVSWNALLSA  191



>emb|CDY40596.1| BnaC06g02120D [Brassica napus]
Length=776

 Score =   139 bits (350),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYESGC+VGNALL MYCKCGSI +A D+FE +  +D+VSWNTMI GY+RHGFG+EAL 
Sbjct  432  KGGYESGCFVGNALLLMYCKCGSIEDANDLFEEMTGRDIVSWNTMISGYSRHGFGEEALR  491

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
            FF+ MK  G+KPDD TMV VLSACSHT
Sbjct  492  FFESMKREGLKPDDATMVAVLSACSHT  518


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG + EA  +F+ + ++D VSW  MI GY++ G G EAL  F  M+  G +
Sbjct  342  NTMITGYAQCGDLSEAKSLFDKMPKRDPVSWAAMIAGYSQSGHGHEALRLFVQMEREGGR  401

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  402  LNRSSFSSALSTCA  415


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +  S+G+A ++FE ++E+DV SWNTM+ GYA++G   EA   F  M +    
Sbjct  125  NVMIKGYVRNRSLGKARELFERMSERDVCSWNTMLSGYAQNGCVDEARRVFDRMPE----  180

Query  48   PDDVTMVGVLSA  13
             ++V+   +LSA
Sbjct  181  RNEVSWNALLSA  192



>emb|CDX93683.1| BnaA06g03650D [Brassica napus]
Length=776

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYESGC+VGNALL MYCKCGSIG+A D+FE +  +D+VSWNTMI GY+RHGFG+EAL 
Sbjct  432  KGGYESGCFVGNALLLMYCKCGSIGDASDLFEEMTGRDIVSWNTMISGYSRHGFGEEALR  491

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  G+ PDD TMV VLSACSHT
Sbjct  492  LFESMKREGLNPDDATMVAVLSACSHT  518


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG + EA  +F+ I ++D VSW  MI GY++ G G EAL  F  M+  G +
Sbjct  342  NTMITGYAQCGDVSEAKSLFDKIPKRDPVSWAAMIAGYSQSGHGHEALRLFVQMEREGGR  401

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  402  LNRSSFSSALSTCA  415


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +  S+G+A ++FE ++E+DV SWNTM+ GYA++G   EA   F  M +    
Sbjct  125  NVMIKGYVRNRSLGKARELFERMSERDVCSWNTMLSGYAQNGCVDEARRVFDRMPE----  180

Query  48   PDDVTMVGVLSA  13
             ++V+   +LSA
Sbjct  181  RNEVSWNALLSA  192


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            N LL  + K   I EA   F+G++ +DVVSWNT+I GYA+ G   EA + F
Sbjct  218  NCLLGGFVKKKKIVEARKFFDGMSVRDVVSWNTIITGYAQSGKIDEARKLF  268



>ref|XP_004160443.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Cucumis sativus]
 gb|KGN63866.1| hypothetical protein Csa_1G024980 [Cucumis sativus]
Length=776

 Score =   138 bits (347),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+++G   GNALLAMY KCGSI EA DVFE I EKD+VSWNTMI GYARHGFGKEAL 
Sbjct  433  KAGFQTGYIAGNALLAMYGKCGSIEEAFDVFEDITEKDIVSWNTMIAGYARHGFGKEALA  492

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK   IKPDDVT+VGVLSACSHT
Sbjct  493  LFESMK-MTIKPDDVTLVGVLSACSHT  518


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L+ Y K G++  A  +F  + EKDVVSWN M+ G+A++GF +EA + F  M    + 
Sbjct  126  NVMLSGYVKNGNLSAARALFNQMPEKDVVSWNAMLSGFAQNGFVEEARKIFDQM----LV  181

Query  48   PDDVTMVGVLSA  13
             ++++  G+LSA
Sbjct  182  KNEISWNGLLSA  193


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF-KMMKDFGI  52
            N ++  Y +CG+I +A  +F+ + ++D +SW  MI GYA+ G  +EAL  F KM +D GI
Sbjct  343  NTMVTGYAQCGNIDQAKILFDEMPQRDCISWAAMISGYAQSGQSEEALHLFIKMKRDGGI  402

Query  51   KPDDVTMVGVLSACS  7
              +   +   LS+C+
Sbjct  403  L-NRSALACALSSCA  416



>ref|XP_004137551.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Cucumis sativus]
Length=776

 Score =   137 bits (346),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 66/87 (76%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+++G   GNALLAMY KCGSI EA DVFE I EKD+VSWNTMI GYARHGFGKEAL 
Sbjct  433  KAGFQTGYIAGNALLAMYGKCGSIEEAFDVFEDITEKDIVSWNTMIAGYARHGFGKEALA  492

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK   IKPDDVT+VGVLSACSHT
Sbjct  493  LFESMK-MTIKPDDVTLVGVLSACSHT  518


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 46/72 (64%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L+ Y K G++  A  +F  + EKDVVSWN M+ G+A++GF +EA + F  M    + 
Sbjct  126  NVMLSGYVKNGNLSAARALFNQMPEKDVVSWNAMLSGFAQNGFVEEARKIFDQM----LV  181

Query  48   PDDVTMVGVLSA  13
             ++++  G+LSA
Sbjct  182  KNEISWNGLLSA  193


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF-KMMKDFGI  52
            N ++  Y +CG+I +A  +F+ + ++D +SW  MI GYA+ G  +EAL  F KM +D GI
Sbjct  343  NTMVTGYAQCGNIDQAKILFDEMPQRDCISWAAMISGYAQSGQSEEALHLFIKMKRDGGI  402

Query  51   KPDDVTMVGVLSACS  7
              +   +   LS+C+
Sbjct  403  L-NRSALACALSSCA  416



>gb|AET05556.2| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=787

 Score =   137 bits (346),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY++GC VGNALL MYCKCGSIGEA DVFE +  KD++SWNTM+ GYARHGFG++AL 
Sbjct  390  KTGYDNGCLVGNALLEMYCKCGSIGEAYDVFERMQLKDIISWNTMLAGYARHGFGRQALL  449

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  MK  G KPD++TMVGVL ACSHT
Sbjct  450  VFDSMKTAGFKPDEITMVGVLLACSHT  476



>ref|XP_004956593.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Setaria italica]
Length=752

 Score =   137 bits (344),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY  GC+VGNALLAMY KCG++ EA + FE + E+DVVSWNTMI GYARHGFGKEALE
Sbjct  408  KAGYGVGCFVGNALLAMYFKCGNMEEAHNAFEEMEERDVVSWNTMIAGYARHGFGKEALE  467

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
            FF  M+    KPDD+T+VGVL+ACSH+
Sbjct  468  FFDTMRKTSTKPDDITLVGVLAACSHS  494


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NAL+A Y + G + EA ++F  + ++DVVSWN M+ GYAR G   EA   F
Sbjct  194  NALMAGYVQWGKMAEAQEMFNRMPQRDVVSWNIMVSGYARRGDMMEARRLF  244


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G +  A  +F+ + +KD VSW  M+  Y++ GF +E L+ FK M   G  
Sbjct  318  NTMLTGYAQAGMLEAARAIFDMMPQKDAVSWAAMLAAYSQGGFSEETLQLFKEMGRCGEW  377

Query  48   PDDVTMVGVLSACS  7
             +      VLS C+
Sbjct  378  VNRSAFACVLSTCA  391


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA++A + +   + EA ++F+ +  ++V SWNTM+ GYA+ G  + A   F MM     +
Sbjct  287  NAMMAAFVQRKMMDEAKELFDAMPCRNVASWNTMLTGYAQAGMLEAARAIFDMMP----Q  342

Query  48   PDDVTMVGVLSACSH  4
             D V+   +L+A S 
Sbjct  343  KDAVSWAAMLAAYSQ  357



>tpg|DAA61049.1| TPA: hypothetical protein ZEAMMB73_995105 [Zea mays]
Length=824

 Score =   136 bits (343),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY  GC+VGNALLAMY KCGS+ EA   FE + E+DVVSWNTMI GYARHGFGKEALE
Sbjct  480  KAGYGVGCFVGNALLAMYFKCGSMEEAHSAFEEMEERDVVSWNTMIAGYARHGFGKEALE  539

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  M+    KPDD+T+VGVL+ACSH+
Sbjct  540  VFDTMRKTSTKPDDITLVGVLAACSHS  566


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G + EA  +F  + +KD VSW  M+  Y++ GF +E L+ FK M   G  
Sbjct  390  NTMLTGYAQAGMLDEARAIFGMMPQKDAVSWAAMLAAYSQIGFSEETLQLFKEMGRCGEW  449

Query  48   PDDVTMVGVLSACS  7
             +      VLS C+
Sbjct  450  VNRSAFACVLSTCA  463


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NAL+A Y +   I EA  +F  + ++DVVSWNTM+ GYAR G   EA   F
Sbjct  266  NALMAGYVQRSQIEEAQKMFNKMPQRDVVSWNTMVSGYARRGDMAEARRLF  316


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA++A Y +   + EA ++F+ +  ++V SWNTM+ GYA+ G   EA   F MM     +
Sbjct  359  NAMMAAYVQRRMMEEAKELFDAMPCRNVASWNTMLTGYAQAGMLDEARAIFGMMP----Q  414

Query  48   PDDVTMVGVLSACSH  4
             D V+   +L+A S 
Sbjct  415  KDAVSWAAMLAAYSQ  429



>ref|XP_007160511.1| hypothetical protein PHAVU_002G328000g [Phaseolus vulgaris]
 gb|ESW32505.1| hypothetical protein PHAVU_002G328000g [Phaseolus vulgaris]
Length=691

 Score =   135 bits (341),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+GC VGNAL+ MYCKCG I EA +VF+GI  KD+VSWNTM+ GYARHGFG+ AL 
Sbjct  347  KTGYENGCLVGNALVGMYCKCGCIDEAYEVFQGIQRKDIVSWNTMLSGYARHGFGRLALT  406

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G+KPD++TMVGVLSACSH
Sbjct  407  VFESMITAGVKPDEITMVGVLSACSH  432


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ YC+ G + +A ++F+ + ++D VSW  +I GYA++G  +EA+     MK  G  
Sbjct  257  NIMISCYCQEGDVAQARNLFDRMPQRDSVSWAAIIAGYAQNGHYEEAMNMLVEMKRDGEG  316

Query  48   PDDVTMVGVLSACSH  4
             +  T+   LS C+H
Sbjct  317  LNRSTLCCALSTCAH  331



>ref|XP_008652556.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652557.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652558.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652559.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652560.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652561.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652562.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652563.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652564.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
 ref|XP_008652565.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Zea mays]
Length=752

 Score =   136 bits (342),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 61/87 (70%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY  GC+VGNALLAMY KCGS+ EA   FE + E+DVVSWNTMI GYARHGFGKEALE
Sbjct  408  KAGYGVGCFVGNALLAMYFKCGSMEEAHSAFEEMEERDVVSWNTMIAGYARHGFGKEALE  467

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  M+    KPDD+T+VGVL+ACSH+
Sbjct  468  VFDTMRKTSTKPDDITLVGVLAACSHS  494


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G + EA  +F  + +KD VSW  M+  Y++ GF +E L+ FK M   G  
Sbjct  318  NTMLTGYAQAGMLDEARAIFGMMPQKDAVSWAAMLAAYSQIGFSEETLQLFKEMGRCGEW  377

Query  48   PDDVTMVGVLSACS  7
             +      VLS C+
Sbjct  378  VNRSAFACVLSTCA  391


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NAL+A Y +   I EA  +F  + ++DVVSWNTM+ GYAR G   EA   F
Sbjct  194  NALMAGYVQRSQIEEAQKMFNKMPQRDVVSWNTMVSGYARRGDMAEARRLF  244


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA++A Y +   + EA ++F+ +  ++V SWNTM+ GYA+ G   EA   F MM     +
Sbjct  287  NAMMAAYVQRRMMEEAKELFDAMPCRNVASWNTMLTGYAQAGMLDEARAIFGMMP----Q  342

Query  48   PDDVTMVGVLSACSH  4
             D V+   +L+A S 
Sbjct  343  KDAVSWAAMLAAYSQ  357



>gb|KCW50540.1| hypothetical protein EUGRSUZ_J00262 [Eucalyptus grandis]
Length=715

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY S  +VGNA+L+MYCKCGSI EA D F+ I +KDVVSWNTMI GYARHGFGKEAL 
Sbjct  371  KAGYASRWFVGNAILSMYCKCGSIEEAYDAFQDIKDKDVVSWNTMIAGYARHGFGKEALA  430

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ M+  GIKPDDVTMVG+LSAC+H 
Sbjct  431  IFESMQAVGIKPDDVTMVGMLSACAHN  457


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G+I +A  +F+ + ++D +SW  +I GYA+ G  +EAL  F  M   G +
Sbjct  281  NTMITCYAQSGNISQARSLFDEMPQRDCISWAAIIAGYAQTGHCEEALHQFVEMNRAGER  340

Query  48   PDDVTMVGVLSACS  7
             +       LSAC+
Sbjct  341  LNRSAFTCSLSACA  354


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 37/68 (54%), Gaps = 0/68 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA+L+ Y + G + EA  +F  +  KD VSWN ++  Y ++G  +EA   F    D+ + 
Sbjct  95   NAMLSGYAQYGYVDEARHIFNEMPTKDAVSWNGLLAAYVQNGRLEEAQLLFNSKTDWEVV  154

Query  48   PDDVTMVG  25
            P +  M G
Sbjct  155  PWNCLMAG  162



>ref|XP_006393386.1| hypothetical protein EUTSA_v10011306mg [Eutrema salsugineum]
 gb|ESQ30672.1| hypothetical protein EUTSA_v10011306mg [Eutrema salsugineum]
Length=647

 Score =   135 bits (339),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+ C+VGNALL+MYCKCGSI EA D+FE +  KD+ SWNTMI GY+RHGFG+EAL 
Sbjct  347  KGGYETRCFVGNALLSMYCKCGSIEEAYDLFEEMTGKDIFSWNTMIAGYSRHGFGEEALR  406

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
            FF+ MK  G+KPDD T+V VL+ACSHT
Sbjct  407  FFESMKREGLKPDDATLVAVLTACSHT  433


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG + EA  +F+ + ++D VSW  MI GY++ G G EAL  F  ++  G +
Sbjct  257  NTMITGYAQCGDVSEAKKLFDKMPKRDPVSWAAMIAGYSQCGHGYEALRLFVQVEREGGR  316

Query  48   PDDVTMVGVLSACS  7
             +  +    L  C+
Sbjct  317  LNRFSFSSALITCA  330



>ref|XP_007160512.1| hypothetical protein PHAVU_002G328100g [Phaseolus vulgaris]
 gb|ESW32506.1| hypothetical protein PHAVU_002G328100g [Phaseolus vulgaris]
Length=783

 Score =   135 bits (341),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+E+GC+VGNALL MY KCGS  EA  VFEGI EKDVVSWNTMI GYARHGFG +AL 
Sbjct  439  KAGFETGCFVGNALLGMYFKCGSTDEANKVFEGIEEKDVVSWNTMIAGYARHGFGGQALI  498

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK  G+KPD++TMVGVLSACSH
Sbjct  499  LFESMKKEGVKPDEITMVGVLSACSH  524


 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 4/83 (5%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N +L  Y +   +GEA  +F+ + EKDVVSWN M+ GYA++GF  EA E F  
Sbjct  125  ERDLFSWNVMLTGYVRNRRLGEARKLFDLMPEKDVVSWNAMLSGYAQNGFVDEAREVFNR  184

Query  69   MKDFGIKPDDVTMVGVLSACSHT  1
            M       + ++  G+L+A  H 
Sbjct  185  MP----HRNSISWNGLLAAYVHN  203


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  YC+ G I +A  +F+ + ++D VSW  +I GY ++   +EAL  F  MK  G  
Sbjct  349  NTMITGYCQNGGITQARKLFDVMPQRDCVSWAAIIAGYTQNEHFEEALNMFVEMKRDGEN  408

Query  48   PDDVTMVGVLSACS  7
             +  T    LS C+
Sbjct  409  SNRSTFSCALSTCA  422



>ref|NP_001062888.2| Os09g0327200 [Oryza sativa Japonica Group]
 dbj|BAF24802.2| Os09g0327200 [Oryza sativa Japonica Group]
Length=739

 Score =   135 bits (339),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            +AGY  GC+VGNALLAMY KCG++ +A + FE + E+DVVSWNTMI GYARHGFGKEALE
Sbjct  411  RAGYGVGCFVGNALLAMYFKCGNMEDARNAFEEMEERDVVSWNTMIAGYARHGFGKEALE  470

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F MM+    KPDD+T+VGVL+ACSH+
Sbjct  471  IFDMMRTTSTKPDDITLVGVLAACSHS  497


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NAL++ Y + G + EA ++F+ +  +DVVSWN M+ GYAR G   EA   F
Sbjct  197  NALMSGYVQWGKMSEARELFDRMPGRDVVSWNIMVSGYARRGDMVEARRLF  247


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G + EA  VF+ + +KD VSW  M+  Y++ G  +E L+ F  M   G  
Sbjct  321  NTMLTGYAQAGMLEEAKAVFDTMPQKDAVSWAAMLAAYSQGGCSEETLQLFIEMGRCGEW  380

Query  48   PDDVTMVGVLSACS  7
             +      VLS C+
Sbjct  381  VNRSAFACVLSTCA  394



>dbj|BAD23598.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza 
sativa Japonica Group]
Length=755

 Score =   135 bits (339),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            +AGY  GC+VGNALLAMY KCG++ +A + FE + E+DVVSWNTMI GYARHGFGKEALE
Sbjct  411  RAGYGVGCFVGNALLAMYFKCGNMEDARNAFEEMEERDVVSWNTMIAGYARHGFGKEALE  470

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F MM+    KPDD+T+VGVL+ACSH+
Sbjct  471  IFDMMRTTSTKPDDITLVGVLAACSHS  497


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NAL++ Y + G + EA ++F+ +  +DVVSWN M+ GYAR G   EA   F
Sbjct  197  NALMSGYVQWGKMSEARELFDRMPGRDVVSWNIMVSGYARRGDMVEARRLF  247


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G + EA  VF+ + +KD VSW  M+  Y++ G  +E L+ F  M   G  
Sbjct  321  NTMLTGYAQAGMLEEAKAVFDTMPQKDAVSWAAMLAAYSQGGCSEETLQLFIEMGRCGEW  380

Query  48   PDDVTMVGVLSACS  7
             +      VLS C+
Sbjct  381  VNRSAFACVLSTCA  394



>gb|EAZ08632.1| hypothetical protein OsI_30906 [Oryza sativa Indica Group]
Length=755

 Score =   135 bits (339),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            +AGY  GC+VGNALLAMY KCG++ +A + FE + E+DVVSWNTMI GYARHGFGKEALE
Sbjct  411  RAGYGVGCFVGNALLAMYFKCGNMEDARNAFEEMEERDVVSWNTMIAGYARHGFGKEALE  470

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F MM+    KPDD+T+VGVL+ACSH+
Sbjct  471  IFDMMRTTSTKPDDITLVGVLAACSHS  497


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NAL++ Y + G + EA ++F+ +  +DVVSWN M+ GYAR G   EA   F
Sbjct  197  NALMSGYVQWGKMSEARELFDRMPGRDVVSWNIMVSGYARRGDMVEARRLF  247


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G + EA  VF+ + +KD VSW  M+  Y++ G  +E L+ F  M   G  
Sbjct  321  NTMLTGYAQAGMLEEAKAVFDTMPQKDAVSWAAMLAAYSQGGCSEETLQLFIEMGRCGEW  380

Query  48   PDDVTMVGVLSACS  7
             +      VLS C+
Sbjct  381  VNRSAFACVLSTCA  394



>gb|KFK36081.1| hypothetical protein AALP_AA4G075000 [Arabis alpina]
Length=773

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYE+GC+VGNALL MYCKCGSI EA D+F+ +  KD+VSWNTMI GY+RHGFG+EAL 
Sbjct  429  KGGYETGCFVGNALLLMYCKCGSIEEANDLFQEMTGKDIVSWNTMITGYSRHGFGEEALS  488

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ +K  G+KPDD T+V VLSACSHT
Sbjct  489  LFESLKREGLKPDDATLVAVLSACSHT  515


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +CG +  A ++F+ + ++D VSW  MI GY++ G G EAL  F  M+  G +
Sbjct  339  NTMITGYAQCGDVSGAKNLFDKMPKRDPVSWAAMIAGYSQSGHGYEALRLFVQMEREGGR  398

Query  48   PDDVTMVGVLSACS  7
             +  +    LS C+
Sbjct  399  LNRSSFSSALSTCA  412


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 44/72 (61%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y +  ++G+A ++FE + E+DV SWNT++ GYA++G   EA   F  M +    
Sbjct  122  NVMIKGYVRNRNLGKARELFERMDERDVCSWNTILSGYAQNGCVDEARRVFDRMPE----  177

Query  48   PDDVTMVGVLSA  13
             ++V+   +LSA
Sbjct  178  KNEVSWNALLSA  189



>gb|EPS65029.1| tetratricopeptide-like helical [Genlisea aurea]
Length=759

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+E GCYVGNALL+MYC+CGSI EA  VF GI +KDVVSWNT+IIGYARHGF  EALE
Sbjct  415  KAGFEFGCYVGNALLSMYCRCGSIHEACAVFRGIEDKDVVSWNTIIIGYARHGFSDEALE  474

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK   +KPD+VTMVG+LSAC H+
Sbjct  475  CFESMKVARVKPDEVTMVGILSACGHS  501


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 43/72 (60%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ Y K G +G A  +F+ +  KDVVSWN ++ GYA+ G+  EA + F  M      
Sbjct  108  NVMISGYIKYGDLGGAKRLFDEMNVKDVVSWNALLSGYAQSGYVDEARKVFDSMP----H  163

Query  48   PDDVTMVGVLSA  13
             +D++  G+L+A
Sbjct  164  KNDISWNGILAA  175


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            N L+  Y K   + EA  VF+ +  +D VSWNTMI  YA++G   EAL+ FK
Sbjct  201  NCLIGGYLKKKKLSEARQVFDRMPIRDEVSWNTMITCYAQNGEMMEALKLFK  252



>ref|XP_006660540.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Oryza brachyantha]
Length=745

 Score =   132 bits (333),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY  GC+VGNALLAMY KCG++ +A +VFE + E+DVVSWNTMI GYARHGFGKEALE
Sbjct  401  KAGYGVGCFVGNALLAMYFKCGNMEDARNVFEEMEERDVVSWNTMIAGYARHGFGKEALE  460

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  M+    KPDD+T+VGVL+ACSH+
Sbjct  461  IFNTMRTTSTKPDDITLVGVLAACSHS  487


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NAL+A Y + G + EA D+F+ +  +DVVSWNTM+ GYAR G   EA   F
Sbjct  187  NALMAGYVQWGKMSEARDLFDRMPARDVVSWNTMVSGYARRGNMVEARRLF  237



>gb|EAZ44271.1| hypothetical protein OsJ_28890 [Oryza sativa Japonica Group]
Length=630

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            +AGY  GC+VGNALLAMY KCG++ +A + FE + E+DVVSWNTMI GYARHGFGKEALE
Sbjct  286  RAGYGVGCFVGNALLAMYFKCGNMEDARNAFEEMEERDVVSWNTMIAGYARHGFGKEALE  345

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F MM+    KPDD+T+VGVL+ACSH+
Sbjct  346  IFDMMRTTSTKPDDITLVGVLAACSHS  372


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NAL++ Y + G + EA ++F+ +  +DVVSWN M+ GYAR G   EA   F
Sbjct  72   NALMSGYVQWGKMSEARELFDRMPGRDVVSWNIMVSGYARRGDMVEARRLF  122


 Score = 46.6 bits (109),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 30/54 (56%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N +LA Y + G + EA  +F    E DV+SWN ++ GY + G   EA E F  M
Sbjct  41   NGMLAAYVRNGRVEEARGLFNSRTEWDVISWNALMSGYVQWGKMSEARELFDRM  94



>ref|XP_002534168.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF28217.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=513

 Score =   130 bits (326),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY++GCYVGNALLAMYCKCGSI EA D F  I +KD++SWNTMI GYARHGFGKEAL 
Sbjct  430  KVGYQTGCYVGNALLAMYCKCGSIDEADDAFHEITDKDLISWNTMIYGYARHGFGKEALI  489

Query  81   FFKMMKDFGIKPDDVTMVGV  22
             F+ MK  G+KPD+ TMV V
Sbjct  490  VFESMKTVGVKPDEATMVTV  509


 Score = 52.4 bits (124),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/74 (30%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G++  A ++F+ + ++D +SW+ MI GY ++G  +EA+  +  MK  G  
Sbjct  340  NTMITGYAQSGNVPHARNLFDRMPQRDSISWSAMIAGYVQNGCNEEAVHLYVEMKRDGES  399

Query  48   PDDVTMVGVLSACS  7
             +  +   VL+AC+
Sbjct  400  LNRSSFTSVLTACA  413


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N +L+ Y +  ++ +A  +FE +  +DVVSWN M+ GYA++GF  EA E F  
Sbjct  116  ERDLFTWNVMLSGYVRNKNLTDARGLFERMPRRDVVSWNAMLSGYAQNGFIAEAREIFDE  175

Query  69   M  67
            M
Sbjct  176  M  176


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            NA++A Y +C  +  A ++FE +  +++ SWNTMI GYA+ G    A   F  M
Sbjct  309  NAMIAGYVQCKRMDMAKELFEAMPFRNISSWNTMITGYAQSGNVPHARNLFDRM  362



>ref|XP_007151411.1| hypothetical protein PHAVU_004G044000g, partial [Phaseolus vulgaris]
 gb|ESW23405.1| hypothetical protein PHAVU_004G044000g, partial [Phaseolus vulgaris]
Length=951

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+E+GC+VGNALL MY KCGS  EA  VFEGI EKDVVSWNTMI GYARHG G +AL 
Sbjct  608  KAGFETGCFVGNALLGMYFKCGSTDEANKVFEGIEEKDVVSWNTMIAGYARHGLGGQALI  667

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK  G+KPD++TMV VLSACSH
Sbjct  668  LFESMKKEGVKPDEITMVSVLSACSH  693


 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 4/83 (5%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N +L  Y +   +GEA  +F+ + EKDVVSWN M+ GYA++GF  EA E F  
Sbjct  294  ERDLFSWNVMLTGYVRNRRLGEARKLFDLMPEKDVVSWNAMLSGYAQNGFVDEAREVFNK  353

Query  69   MKDFGIKPDDVTMVGVLSACSHT  1
            M       + ++  G+L+A  H 
Sbjct  354  MP----HRNSISWNGLLAAYVHN  372


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  YC+ G I +A  +F+ + ++D VSW  +I GY ++   +EAL  F  MK  G  
Sbjct  518  NTMITGYCQNGGITQARKLFDVMPQRDCVSWAAIIAGYTQNEHFEEALNMFLEMKRDGES  577

Query  48   PDDVTMVGVLSACS  7
             +  T    LS+C+
Sbjct  578  SNRSTFSCALSSCA  591



>ref|XP_010693152.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Beta vulgaris subsp. vulgaris]
Length=774

 Score =   129 bits (324),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GYES  Y+GNAL+AMYCKCG+I EA  VF+GI EKD +SWNTMI GYARHGFG++AL 
Sbjct  430  KVGYESATYIGNALVAMYCKCGTIDEANCVFKGIKEKDTISWNTMIAGYARHGFGRQALV  489

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M + G K DD TMV VLSAC+H
Sbjct  490  VFESMIEAGDKADDTTMVAVLSACAH  515


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/76 (32%), Positives = 38/76 (50%), Gaps = 0/76 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +++ Y   G I EA  +F  +  +D +SW+ MI GYA+    +EAL  F  M     +
Sbjct  340  NTMISGYAHNGDIAEARGLFNKMPLRDSISWSAMIAGYAQSSHNEEALHLFANMHRNRER  399

Query  48   PDDVTMVGVLSACSHT  1
             +      +LS C+ T
Sbjct  400  SNKSVFTCILSTCADT  415


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N++L  Y     +  A   FE + E+D+VSWNTM+ GYAR G+  +A E F  M
Sbjct  123  NSMLNGYILFLDLAAARRFFEEMPERDIVSWNTMLSGYARGGYVDDARELFDEM  176



>ref|XP_006829281.1| hypothetical protein AMTR_s00001p00272900 [Amborella trichopoda]
 gb|ERM96697.1| hypothetical protein AMTR_s00001p00272900 [Amborella trichopoda]
Length=762

 Score =   125 bits (314),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY +  +VGNALLAMYCKCGSI EA   F+ + EKD+V+WNTMI GYARHGFG  AL+
Sbjct  418  KSGYATCTFVGNALLAMYCKCGSIAEAYVAFKTMPEKDLVTWNTMIAGYARHGFGIRALQ  477

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ M++  I PD++TMV VLSACSHT
Sbjct  478  VFEAMREKHIGPDNITMVAVLSACSHT  504


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            NAL+A Y +   + EA  +F+ ++++DVVSWNTMI GYA++   +EA E F++
Sbjct  203  NALMAGYVRRKRLIEARHLFDKMSQRDVVSWNTMITGYAQNAQMQEAHELFRL  255


 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N +LA Y K   +  A  +F  + E+DVVSWNT++ GY + G+  +A + F  M
Sbjct  109  NVMLAAYVKNDDLRAARRLFTAMPERDVVSWNTLLSGYTQAGYIDDAKDLFDRM  162



>gb|EMT13464.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii]
Length=750

 Score =   124 bits (312),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY  G +VGNALLAMY KCG++ +A + FE + ++D VSWNT+I GYARHGFGKEALE
Sbjct  406  KAGYGLGRFVGNALLAMYFKCGNMEDARNAFEQMEDRDAVSWNTVIAGYARHGFGKEALE  465

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F MM+    KPDD+T+VGVL+ACSH+
Sbjct  466  VFDMMRATSTKPDDITLVGVLAACSHS  492


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            NAL+A Y + G + EA ++F+ + ++DVVSWNTM+ GYAR G   EA   F M
Sbjct  192  NALMAGYAQLGRMAEAQELFDRMPQRDVVSWNTMVSGYARGGDMVEARRMFDM  244


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G + EA  VF+ + +KD VSW  M+  YA+ GF +E L+ F  M   G  
Sbjct  316  NTMLTGYAQAGMLDEARAVFDMMPQKDAVSWAAMLAAYAQGGFSEETLQLFIKMGQCGEW  375

Query  48   PDDVTMVGVLSACS  7
             +      +LS C+
Sbjct  376  VNRSAFACLLSTCA  389


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N +LA Y + G + EA ++F    E D +SWN ++ GYA+ G   EA E F  M
Sbjct  161  NGMLAAYVRNGRVQEARELFNSRTEWDAISWNALMAGYAQLGRMAEAQELFDRM  214



>gb|ABP02616.1| Tetratricopeptide-like helical [Medicago truncatula]
Length=501

 Score =   121 bits (304),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY++GC VGNALL MYCKCGSIGEA DVFE +  KD++SWNTM+ GYARHGFG++AL 
Sbjct  369  KTGYDNGCLVGNALLEMYCKCGSIGEAYDVFERMQLKDIISWNTMLAGYARHGFGRQALL  428

Query  81   FFKMMKDFGIKPDDVTMV  28
             F  MK  G KPD++TM+
Sbjct  429  VFDSMKTAGFKPDEITML  446



>ref|XP_003631080.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
Length=873

 Score =   121 bits (304),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY++GC VGNALL MYCKCGSIGEA DVFE +  KD++SWNTM+ GYARHGFG++AL 
Sbjct  390  KTGYDNGCLVGNALLEMYCKCGSIGEAYDVFERMQLKDIISWNTMLAGYARHGFGRQALL  449

Query  81   FFKMMKDFGIKPDDVTMV  28
             F  MK  G KPD++TM+
Sbjct  450  VFDSMKTAGFKPDEITML  467



>ref|XP_010239337.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750 
[Brachypodium distachyon]
Length=750

 Score =   120 bits (301),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGY  G +VGNALLAMY KCG+  +A + FE + E+D VSWNT+I GYARHGFGK+ALE
Sbjct  406  KAGYGLGWFVGNALLAMYFKCGNTEDARNAFEEMEERDAVSWNTVIAGYARHGFGKDALE  465

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  M+    KPD++T+VGVL+ACSH+
Sbjct  466  VFDTMRTTSTKPDNITLVGVLAACSHS  492


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NAL+A Y + G + EA ++F+ + ++DVVSWNTM+ GYAR G+  EA   F
Sbjct  192  NALMAGYVQLGRMVEARELFDRMPQRDVVSWNTMVSGYARGGYMVEARRLF  242


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L  Y + G + EA  VF+G+ +KD VSW  M+  Y++ G  +E L+ F  M   G  
Sbjct  316  NTMLTGYAQAGMLDEARAVFDGMPQKDAVSWAAMLAAYSQGGLSEETLQLFIKMGRCGEW  375

Query  48   PDDVTMVGVLSACS  7
             +      VLS C+
Sbjct  376  VNRSAFACVLSTCA  389



>ref|XP_010274971.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720-like 
[Nelumbo nucifera]
 ref|XP_010274980.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720-like 
[Nelumbo nucifera]
Length=922

 Score =   113 bits (282),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+ES  +VG++++ MYCKCGSI +A+  F+G+   + VSW  MI GYA HGFGKEA+E
Sbjct  703  KTGFESNLHVGSSIIDMYCKCGSILDAVKFFDGMERHNTVSWTAMITGYAHHGFGKEAIE  762

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  MK+ G++PD VT +GVL+ACSH
Sbjct  763  LFNGMKEAGLEPDGVTFIGVLTACSH  788


 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 3/88 (3%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKC---GSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKE  91
            KAG+E   +VG+AL++MY        I +A  VF  + E+D+VSW+ +I  + +HG+G+E
Sbjct  599  KAGFELHSFVGSALISMYGMSPIKSDIYDASRVFSSMTERDIVSWSAIITAWEQHGYGEE  658

Query  90   ALEFFKMMKDFGIKPDDVTMVGVLSACS  7
            AL+ F   +   I  D+  +   L+AC+
Sbjct  659  ALKLFIEFQHTSIPVDESVLSSCLAACA  686


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+    ++G++L+ MY   G +  A   F  +  K+ + +N MI G   H    +ALE
Sbjct  393  KSGFALDSFIGSSLINMYVGTGMVCHAYKCFLEVRHKNEICFNAMIAGLTFHSEDGKALE  452

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  M++ G+ P   T+  VL AC++
Sbjct  453  LFCKMRELGLIPGHSTISYVLRACAN  478


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 43/83 (52%), Gaps = 0/83 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G ++  +VG AL+  Y K G + +A  VF+ + EKD V W++++ G+ + G  ++ L+ F
Sbjct  294  GLDNHSFVGGALVDTYSKLGFLEDAYKVFQELEEKDNVVWSSLLAGFHQSGVAEQGLQLF  353

Query  75   KMMKDFGIKPDDVTMVGVLSACS  7
                  G K D        S CS
Sbjct  354  GQFVSEGHKLDPFIFANAFSLCS  376


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/87 (29%), Positives = 44/87 (51%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G     +V N +L  Y  C  +  A  +F+ + E +++SW +MI  Y ++G+    L+
Sbjct  88   KSGLHRDVFVQNNILRFYAACEELMNARLLFDEMPEPNLISWTSMISAYVQYGYNDLGLQ  147

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F +M   G+ P++      L AC  T
Sbjct  148  LFSLMCRSGLWPNEFGYSVALKACGVT  174



>ref|XP_002310520.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
 gb|EEE90970.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa]
Length=710

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E   +VGN+L+ MY KCGS+ E L VFE + EKD VSWNTMIIGYA++G+G EALE
Sbjct  424  QSGEEPDIFVGNSLIDMYMKCGSVEEGLRVFENMVEKDHVSWNTMIIGYAQNGYGMEALE  483

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M + G KPD VTM+G L ACSH
Sbjct  484  LFQKMLESGEKPDHVTMIGTLCACSH  509


 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y    ++G+ L+  Y KCG +G A  VF+G+ EK+VVSWN +I  Y ++G   EALE
Sbjct  184  KSKYSLDVFMGSGLIDFYSKCGLVGCARRVFDGMEEKNVVSWNCLITCYEQNGPAIEALE  243

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M + G KPD+VT+  V+SAC+
Sbjct  244  AFGRMTELGFKPDEVTLASVVSACA  268


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 53/114 (46%), Gaps = 31/114 (27%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFE-------------------------------  166
            + +   +GNAL+ MY KCG + EA  VF+                               
Sbjct  289  FRNDLILGNALVDMYAKCGRVNEARCVFDRMPVRNAVSETTMVSGYAKSASVKAARSMFA  348

Query  165  GIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
             I +KD+VSWN +I GY ++G  +EAL  F+M+K   + P   T   +L+A ++
Sbjct  349  TIKQKDIVSWNALIAGYTQNGENEEALGLFRMLKRESVCPTHYTFGNLLNASAN  402


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N++++   + G + E+  +F  + EKD  SWN+MI G+A+H   +EAL++F  
Sbjct  87   ERNVFSFNSIISTLMRWGFVDESAWLFSLMPEKDQCSWNSMIAGFAQHDRFEEALDWFVR  146

Query  69   MKDFGIKPDDVTMVGVLSACSH  4
            M       +D +    LSACS 
Sbjct  147  MHRDDFVLNDYSFGSGLSACSR  168



>ref|XP_011022929.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
[Populus euphratica]
Length=710

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E   +VGN+L+ MY KCGS+ E L VFE + EKD VSWNTMIIGYA++G+G EALE
Sbjct  424  QSGEEPDIFVGNSLIDMYMKCGSVEEGLRVFENMVEKDHVSWNTMIIGYAQNGYGMEALE  483

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M + G KPD VTM+G L ACSH
Sbjct  484  LFQKMLESGEKPDHVTMIGTLCACSH  509


 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y    ++G+ L+  Y KCG +G A  VF+G+ EK+VVSWN +I  Y ++G   EALE
Sbjct  184  KSKYSLNVFMGSGLIDFYSKCGLVGCARRVFDGMEEKNVVSWNCLITCYEQNGPAIEALE  243

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M + G KPD+VT+  V+SAC+
Sbjct  244  AFGRMIEQGFKPDEVTLASVVSACA  268


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 53/114 (46%), Gaps = 31/114 (27%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFE-------------------------------  166
            + +   +GNAL+ MY KCG + EA  VF+                               
Sbjct  289  FRNDLILGNALVDMYAKCGRVNEARCVFDRMPVRNAVSETTMVSGYAKSASVKAARSMFA  348

Query  165  GIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
             I +KD+VSWN +I GY ++G  +EAL  F+M+K   + P   T   +L+A ++
Sbjct  349  TIKQKDIVSWNALIAGYTQNGENEEALGLFRMLKRESVCPTHYTFGNLLNASAN  402


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 45/82 (55%), Gaps = 0/82 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N++++   + G + E+  +F  + EKD  SWN+MI G+A+H   +EAL++F  
Sbjct  87   ERNVFSYNSIISTLMRWGFVDESAWLFSLMPEKDQCSWNSMIAGFAQHDRFEEALDWFVR  146

Query  69   MKDFGIKPDDVTMVGVLSACSH  4
            M       +D +    LSACS 
Sbjct  147  MHRDDFVLNDYSFGSGLSACSR  168



>ref|XP_009618316.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Nicotiana tomentosiformis]
Length=698

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S   VG+ L+ MY KCG +G+A  VF+ +  K++VSWNTM++GYA+HGFGKEALE
Sbjct  433  KPGFDSNVVVGSTLIDMYAKCGRLGDARRVFDILPMKNLVSWNTMLVGYAQHGFGKEALE  492

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             +  M++ GIKP+D+T +GVLSAC H
Sbjct  493  IYATMQNSGIKPNDITFLGVLSACGH  518


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +   Y+ N LL MY K     +A  + + + E++++SW T+I  Y++ G  ++AL 
Sbjct  28   KFGSKPDVYINNHLLVMYLKLNQFADAQQLLDRMPERNIISWTTLISTYSQKGMSEKALG  87

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACS  7
             F+ M+ + G  P+  T V  LSAC+
Sbjct  88   CFRSMVLEDGFAPNGYTYVAALSACT  113


 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S  +V NAL+ +Y K     E+L +F+ + E DVVSWNT+I G    G  ++A+ 
Sbjct  332  KLGFDSFSFVCNALMDLYSKSDLFDESLKLFQEMKEHDVVSWNTLIAGCVSSGRYEDAMR  391

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
            F K M   G +    T   +LS C
Sbjct  392  FLKEMLLEGFEASLYTYSSILSIC  415



>ref|XP_009780195.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Nicotiana sylvestris]
Length=698

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S   VG+ L+ MY KCG + EA  VF+ +  K++VSWNTM++GYA+HGFGKEALE
Sbjct  433  KPGFDSNVVVGSTLIDMYAKCGRLSEARRVFDILPTKNLVSWNTMLVGYAQHGFGKEALE  492

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             +  M++ G+KP+D+T +GVLSAC H
Sbjct  493  IYATMQNSGVKPNDITFLGVLSACGH  518


 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G ++  +  N LLAMY K     +A  +F+ + E++++SW T+I  Y++ G  ++AL+
Sbjct  28   KFGSKANVFTNNHLLAMYLKLNQFDDAQRLFDRMPERNIISWTTLISTYSQMGMSEKALD  87

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACS  7
             F+ M+ + G  P+  T V  LSAC+
Sbjct  88   CFRSMVLEDGFAPNGYTYVAALSACT  113


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S  +V NAL+  + K     E+L +F+ + E DVVSWNT+I      G  ++A+ 
Sbjct  332  KLGFDSFSFVCNALMDFFSKSDLFEESLKLFQEMKEHDVVSWNTLIAACVSSGRYEDAIR  391

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
            F K M   G +    T   +LS C
Sbjct  392  FLKEMLLEGFEASLYTYSSILSIC  415



>gb|KDP29043.1| hypothetical protein JCGZ_16432 [Jatropha curcas]
Length=512

 Score =   108 bits (270),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G +S  ++ NAL++MYCKCGS+ +AL +F+ +  KD+VSWN+MI GYA+HG   +A+E
Sbjct  249  QMGLDSHLHIANALISMYCKCGSVQDALFIFDNMYTKDIVSWNSMISGYAQHGLTVQAIE  308

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK  G KPD +T +GVLS+C H
Sbjct  309  LFEKMKKLGTKPDSITFLGVLSSCRH  334


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+++  YVG++L+ +YCKCG +  A  VF  +  ++VVSW  +I G+A+       LE F
Sbjct  150  GFDANAYVGSSLITLYCKCGELDNAYKVFYEMPVRNVVSWTAIISGFAQEWQIDVCLELF  209

Query  75   KMMKDFGIKPDDVTMVGVLSACS  7
              M++  + P+D T   +LSAC+
Sbjct  210  SAMRNSTLVPNDFTFTSLLSACT  232



>gb|KCW50538.1| hypothetical protein EUGRSUZ_J00260 [Eucalyptus grandis]
Length=508

 Score =   108 bits (270),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGYESGC+V NALLAMYCKCG+I +A  VF GIAEKD VS N M+ GYARHG  KEAL 
Sbjct  432  KAGYESGCFVANALLAMYCKCGNIEDAYGVFHGIAEKDSVSLNIMVAGYARHGLLKEALV  491

Query  81   FFKMMKDFGIKPDDV  37
             F+ MK   I+P+DV
Sbjct  492  IFESMKAAVIEPNDV  506


 Score = 52.8 bits (125),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/68 (34%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA+L+ Y + G + EA +VF+ +  K+ +SWN+M+  +  +G   EA  FF++  D+ + 
Sbjct  156  NAMLSGYARNGLVDEAREVFDEMPCKNNISWNSMLTAFVENGRMDEARRFFELKTDWEVI  215

Query  48   PDDVTMVG  25
            P +  M G
Sbjct  216  PSNYLMAG  223


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++A Y + G I +A  +F+ + ++D +SW  +I GY++ G  +EAL+    M  +G  
Sbjct  342  NTMIAGYARSGDISKARCMFDQMPQRDCISWAAIISGYSQTGHFEEALQLLLDMNRYGEW  401

Query  48   PDDVTMVGVLSACS  7
            P+   +   LS+C+
Sbjct  402  PNRSALTCSLSSCA  415


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N++++ Y + G +  A  +F  +  +DV SWN M+ GYAR+G   EA E F  M
Sbjct  125  NSMISGYMRNGDVSAARVLFHQMPARDVASWNAMLSGYARNGLVDEAREVFDEM  178


 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            NA++  Y + G  G A ++F+ + E+D+VSWN+MI GY R+G    A   F  M
Sbjct  94   NAMITGYWQNGRFGLAREMFDRMPERDLVSWNSMISGYMRNGDVSAARVLFHQM  147



>ref|XP_002462229.1| hypothetical protein SORBIDRAFT_02g022150 [Sorghum bicolor]
 gb|EER98750.1| hypothetical protein SORBIDRAFT_02g022150 [Sorghum bicolor]
Length=686

 Score =   109 bits (273),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -2

Query  216  AMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDV  37
            AMY KCG++ EA   FE + E+D+VSWNTMI GYARHGFGKEALE F  M+    KPDD+
Sbjct  375  AMYFKCGNMEEAHSAFEEMEERDIVSWNTMIAGYARHGFGKEALEVFDTMRKTSTKPDDI  434

Query  36   TMVGVLSACSHT  1
            T+VGVL+ACSH+
Sbjct  435  TLVGVLAACSHS  446


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            NAL+A Y +C  I EA  +F  + ++DVVSWNTM+ G+AR G   EA   F
Sbjct  194  NALMAGYVQCSQIEEAQKMFNRMPQRDVVSWNTMVSGHARRGDMAEARRLF  244


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 4/75 (5%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA++A Y +   + EA ++F+ +  ++V SWNTM+ GYA+ G   EA   F MM     +
Sbjct  287  NAMMAAYVQRRMMEEAKELFDAMPCRNVASWNTMLTGYAQAGMLDEARAIFDMMP----Q  342

Query  48   PDDVTMVGVLSACSH  4
             D V+   +L+A S 
Sbjct  343  KDAVSWAAMLAAYSQ  357



>ref|XP_010031273.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Eucalyptus grandis]
Length=502

 Score =   108 bits (269),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAGYESGC+V NALLAMYCKCG+I +A  VF GIAEKD VS N M+ GYARHG  KEAL 
Sbjct  426  KAGYESGCFVANALLAMYCKCGNIEDAYGVFHGIAEKDSVSLNIMVAGYARHGLLKEALV  485

Query  81   FFKMMKDFGIKPDDV  37
             F+ MK   I+P+DV
Sbjct  486  IFESMKAAVIEPNDV  500


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/68 (34%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA+L+ Y + G + EA +VF+ +  K+ +SWN+M+  +  +G   EA  FF++  D+ + 
Sbjct  150  NAMLSGYARNGLVDEAREVFDEMPCKNNISWNSMLTAFVENGRMDEARRFFELKTDWEVI  209

Query  48   PDDVTMVG  25
            P +  M G
Sbjct  210  PSNYLMAG  217


 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++A Y + G I +A  +F+ + ++D +SW  +I GY++ G  +EAL+    M  +G  
Sbjct  336  NTMIAGYARSGDISKARCMFDQMPQRDCISWAAIISGYSQTGHFEEALQLLLDMNRYGEW  395

Query  48   PDDVTMVGVLSACS  7
            P+   +   LS+C+
Sbjct  396  PNRSALTCSLSSCA  409


 Score = 47.4 bits (111),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N++++ Y + G +  A  +F  +  +DV SWN M+ GYAR+G   EA E F  M
Sbjct  119  NSMISGYMRNGDVSAARVLFHQMPARDVASWNAMLSGYARNGLVDEAREVFDEM  172


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            NA++  Y + G  G A ++F+ + E+D+VSWN+MI GY R+G    A   F  M
Sbjct  88   NAMITGYWQNGRFGLAREMFDRMPERDLVSWNSMISGYMRNGDVSAARVLFHQM  141



>ref|XP_007027165.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
 gb|EOY07667.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma 
cacao]
Length=516

 Score =   107 bits (267),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIA-EKDVVSWNTMIIGYARHGFGKEAL  85
            + G++S  Y+ NAL++MYCKCGS+ +A+ +F+ +A  KD+VSWN+MI GYA+HG   EA+
Sbjct  246  QMGFDSYSYICNALISMYCKCGSVEDAMFIFKKMAGNKDIVSWNSMIAGYAQHGLAMEAI  305

Query  84   EFFKMMKDFGIKPDDVTMVGVLSACSH  4
            + F+ MK+  IKPD +T +GVLS+C H
Sbjct  306  DLFEKMKEEKIKPDSITFLGVLSSCRH  332


 Score = 77.0 bits (188),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+    YVG++L+  Y KCG + EA  VF+ +  K+VVSW T+I G+A+       LE
Sbjct  145  KTGFFPNVYVGSSLVTSYGKCGELEEAYKVFDEMPVKNVVSWTTIIAGFAQEWQIDMCLE  204

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             + MMK+  +KP+D T+  +L AC+
Sbjct  205  LYNMMKNLTLKPNDFTLTSLLRACT  229



>ref|XP_010242606.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Nelumbo nucifera]
Length=697

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+++   VG++L+ MY KCG I +A  VF  +  K +VSWNTM++GYA+HGFG+EALE
Sbjct  432  KPGFDTNVVVGSSLVDMYAKCGRISDAQKVFNNLTSKSLVSWNTMLVGYAQHGFGREALE  491

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M+  GI P+D+T +GVLSAC H
Sbjct  492  IFEEMQREGISPNDITFLGVLSACGH  517


 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ S  +V N++L +Y KCG + E+  VFE I  KDVVSWN MI GY + G  KEA+E
Sbjct  331  KSGFNSVTFVVNSILDLYSKCGLLEESSKVFEEIKGKDVVSWNAMISGYIKQGKFKEAIE  390

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
                M   G+ P   T   +LS C
Sbjct  391  LLDKMVLEGLNPSPYTYSSILSIC  414


 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = -2

Query  258  AGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEF  79
            +G+    Y  N L++MY K G   +A  +   + ++++VSW  +I GY++  F +EAL+ 
Sbjct  29   SGFSLDVYTSNHLVSMYVKFGRFDDARRLLNQLPDRNLVSWTVLIAGYSQARFAEEALDC  88

Query  78   FKMMKDFGIKPDDVTMVGVLSACSHT  1
            F+ M   GI P+  T V  +SAC++T
Sbjct  89   FRSMVAEGINPNHYTYVSAISACANT  114


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            +   E   +V N L+ +Y KC  +  A  VF+ I E ++VSW +++ GY + G  +E L 
Sbjct  129  RTEQEPNSFVDNCLVNLYVKCRLMKSAQLVFDSILEPNLVSWTSLLSGYCQCGDNEEGLR  188

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F   +  G+K ++     VL AC+
Sbjct  189  IFLQCRRAGVKANEFISASVLGACA  213


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 41/81 (51%), Gaps = 0/81 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G  S  ++   ++ +Y KCG +  A   F  + +  + SW  +I G  + G  KEA++
Sbjct  230  KSGIGSDQFIVTGIIHLYAKCGKLQLARQAFLELEKPPLSSWTALIGGCTQQGEVKEAID  289

Query  81   FFKMMKDFGIKPDDVTMVGVL  19
             F+ +    IKP D T   +L
Sbjct  290  LFQKLHSLAIKPSDHTFSSIL  310



>gb|KDP37060.1| hypothetical protein JCGZ_06116 [Jatropha curcas]
Length=392

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            +AG +   +VGNAL+ MY KCGS+ E   VFE + E+D VSWN MI+GYA++G+G EALE
Sbjct  106  QAGEDPDVFVGNALIDMYMKCGSVEEGCRVFENMVERDYVSWNAMIVGYAQNGYGMEALE  165

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G KPD VTM+G L ACSH
Sbjct  166  LFRKMLGSGEKPDHVTMIGALCACSH  191


 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
             ++++ Y K  S   A  VF  + E++V+SWN +I GY ++G  +EAL  F+M+K   I 
Sbjct  10   TSMVSGYAKAASFKAARLVFTKMMERNVISWNALIAGYTQNGENEEALGLFRMLKREAIC  69

Query  48   PDDVTMVGVLSACSH  4
            P   T   +L+ACS+
Sbjct  70   PTHYTFGNLLNACSN  84



>gb|KHN25259.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=595

 Score =   107 bits (267),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G ES  +VGN+L+ MY KCG + +   VFE + E+DVVSWN MI+GYA++G+G  ALE
Sbjct  309  QSGEESDIFVGNSLIDMYMKCGMVEDGCLVFEHMVERDVVSWNAMIVGYAQNGYGTNALE  368

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G KPD VTM+GVLSACSH
Sbjct  369  IFRKMLVSGQKPDHVTMIGVLSACSH  394


 Score = 83.2 bits (204),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y    Y+G+AL+ MY KCG +  A   F+G+A +++VSWN++I  Y ++G   +ALE
Sbjct  69   KSRYLLDVYMGSALVDMYSKCGVVACAQRAFDGMAVRNIVSWNSLITCYEQNGPAGKALE  128

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F MM D G++PD++T+  V+SAC+
Sbjct  129  VFVMMMDNGVEPDEITLASVVSACA  153


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/114 (30%), Positives = 52/114 (46%), Gaps = 31/114 (27%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFE-------------------------------  166
            Y +   +GNAL+ MY KC  + EA  VF+                               
Sbjct  174  YRNDLVLGNALVDMYAKCRRVNEARLVFDRMPLRNVVSETSMVCGYARAASVKAARLMFS  233

Query  165  GIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
             + EK+VVSWN +I GY ++G  +EA+  F ++K   I P   T   +L+AC++
Sbjct  234  NMMEKNVVSWNALIAGYTQNGENEEAVRLFLLLKRESIWPTHYTFGNLLNACAN  287



>ref|XP_006436646.1| hypothetical protein CICLE_v10030857mg [Citrus clementina]
 ref|XP_006436647.1| hypothetical protein CICLE_v10030857mg [Citrus clementina]
 ref|XP_006492198.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Citrus sinensis]
 gb|ESR49886.1| hypothetical protein CICLE_v10030857mg [Citrus clementina]
 gb|ESR49887.1| hypothetical protein CICLE_v10030857mg [Citrus clementina]
Length=697

 Score =   107 bits (268),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S   +G+AL+ MY KCG + +A  VF+ ++ K++VSWNTM++GYA+HG G+EALE
Sbjct  432  KPGFDSNVVIGSALVDMYAKCGRLNDARKVFDHLSSKNLVSWNTMLVGYAQHGLGREALE  491

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             + MM++  IKP+D T +GVLSAC H
Sbjct  492  IYSMMQENKIKPNDNTFIGVLSACVH  517


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+ S  +V N +L  Y KC  + E+L  F+ + E DVVSWN +I G+       EA+E
Sbjct  331  KMGFSSFTFVANTVLDFYSKCELLEESLKTFDEMDEHDVVSWNALIAGHLASCHYGEAIE  390

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
              K M   G  P+  T   +L+  S
Sbjct  391  LLKDMLFEGHCPNLYTYSNILNISS  415


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E   +V N L+ MY KCG +  A  VF+   E++ +SW +++  Y + G     L+
Sbjct  129  RSGLELNSHVSNCLINMYGKCGLLSSAQFVFDASLERNSISWVSLLSSYCQCGEHVHGLK  188

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F + +  G+   + +   VL AC+
Sbjct  189  IFLLSRKSGVAISEFSCASVLGACA  213


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 42/83 (51%), Gaps = 0/83 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K   E   +V   L+ +Y KC  +  A  VF  I   D+ +W+ +I GYA+ G   EA++
Sbjct  230  KCALEFDKFVAMGLINLYAKCEKLDLASRVFSNIQLPDLTAWSALIGGYAQLGKACEAID  289

Query  81   FFKMMKDFGIKPDDVTMVGVLSA  13
             F  M   G+ P +VT   VL A
Sbjct  290  LFVKMFSSGLMPSEVTFSYVLGA  312



>gb|KDO42139.1| hypothetical protein CISIN_1g005881mg [Citrus sinensis]
Length=672

 Score =   107 bits (267),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S   +G+AL+ MY KCG + +A  VF+ ++ K++VSWNTM++GYA+HG G+EALE
Sbjct  407  KPGFDSNVVIGSALVDMYAKCGRLNDARKVFDHLSSKNLVSWNTMLVGYAQHGLGREALE  466

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             + MM++  IKP+D T +GVLSAC H
Sbjct  467  IYSMMQENKIKPNDNTFIGVLSACVH  492


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+ S  +V N +L  Y KC  + E+L  F+ + E DVVSWN +I G+       EA+E
Sbjct  306  KMGFSSFTFVANTVLDFYSKCELLEESLKTFDEMDEHDVVSWNALIAGHLASCHYGEAIE  365

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
              K M   G  P+  T   +L+  S
Sbjct  366  LLKDMLFEGHCPNLYTYSNILNISS  390


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E   +V N L+ MY KCG +  A  VF+   E++ +SW +++  Y + G     L+
Sbjct  104  RSGLELNSHVSNCLINMYGKCGLLSSAQFVFDASLERNSISWVSLLSSYCQCGEHVHGLK  163

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F + +  G+   + +   VL AC+
Sbjct  164  IFLLSRKSGVAISEFSCASVLGACA  188


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 42/83 (51%), Gaps = 0/83 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K   E   +V   L+ +Y KC  +  A  VF  I   D+ +W+ +I GYA+ G   EA++
Sbjct  205  KCALEFDKFVAMGLINLYAKCEKLDLASRVFSNIQLPDLTAWSALIGGYAQLGKACEAID  264

Query  81   FFKMMKDFGIKPDDVTMVGVLSA  13
             F  M   G+ P +VT   VL A
Sbjct  265  LFVKMFSSGLMPSEVTFSYVLGA  287



>ref|XP_003540710.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like 
[Glycine max]
Length=705

 Score =   107 bits (267),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G ES  +VGN+L+ MY KCG + +   VFE + E+DVVSWN MI+GYA++G+G  ALE
Sbjct  419  QSGEESDIFVGNSLIDMYMKCGMVEDGCLVFERMVERDVVSWNAMIVGYAQNGYGTNALE  478

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G KPD VTM+GVLSACSH
Sbjct  479  IFRKMLVSGQKPDHVTMIGVLSACSH  504


 Score = 83.2 bits (204),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/85 (44%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y    Y+G+AL+ MY KCG +  A   F+G+A +++VSWN++I  Y ++G   +ALE
Sbjct  179  KSRYLLDVYMGSALVDMYSKCGVVACAQRAFDGMAVRNIVSWNSLITCYEQNGPAGKALE  238

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F MM D G++PD++T+  V+SAC+
Sbjct  239  VFVMMMDNGVEPDEITLASVVSACA  263


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA+L++  K G + EA +VF+ + E D  SWN M+ G+A+H   +EAL FF  M      
Sbjct  89   NAVLSVLTKFGKLDEAFNVFKSMPEPDQCSWNAMVSGFAQHDRFEEALRFFVDMHSEDFV  148

Query  48   PDDVTMVGVLSACS  7
             ++ +    LSAC+
Sbjct  149  LNEYSFGSALSACA  162


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/114 (30%), Positives = 52/114 (46%), Gaps = 31/114 (27%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFE-------------------------------  166
            Y +   +GNAL+ MY KC  + EA  VF+                               
Sbjct  284  YRNDLVLGNALVDMYAKCRRVNEARLVFDRMPLRNVVSETSMVCGYARAASVKAARLMFS  343

Query  165  GIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
             + EK+VVSWN +I GY ++G  +EA+  F ++K   I P   T   +L+AC++
Sbjct  344  NMMEKNVVSWNALIAGYTQNGENEEAVRLFLLLKRESIWPTHYTFGNLLNACAN  397



>ref|XP_002525213.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF37179.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=501

 Score =   105 bits (262),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+ S  +V NAL++MYCK GS+ +A  +F  I  KD+VSWN+MI GYA+HG   +A++
Sbjct  235  QMGFHSYLHVANALISMYCKSGSVHDAFYIFNNIYSKDIVSWNSMISGYAQHGLAMQAID  294

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G+KPD +T +GVLSAC H
Sbjct  295  LFEKMTKLGVKPDSITFLGVLSACRH  320


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -2

Query  258  AGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEF  79
            +G+ S  YVG++L+ +Y KCG +  A  +F  +  ++VV+W  +I G+A+       LE 
Sbjct  135  SGFISNSYVGSSLITLYGKCGKLDNAHKLFHEMPVRNVVTWTAIISGFAQECQVDVCLEL  194

Query  78   FKMMKDFGIKPDDVTMVGVLSACS  7
            F +M++  +KP+D T   +LSAC+
Sbjct  195  FSVMRNSTLKPNDFTFTSLLSACT  218



>ref|XP_011102053.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like 
[Sesamum indicum]
Length=253

 Score =   102 bits (255),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S   VG+AL+ MY KCG + +A  VF  +  K++VSWN MI GYA+HGFG+EALE
Sbjct  38   KPGLDSNVVVGSALIDMYAKCGRLNDARKVFNILPGKNLVSWNVMITGYAQHGFGREALE  97

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             + +M   G+KP+D+T +G+LS+C H
Sbjct  98   IYDLMLRNGVKPNDITFIGILSSCGH  123



>gb|ADE76772.1| unknown [Picea sitchensis]
Length=232

 Score =   102 bits (254),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ES  +VG+ L+ MY KC SIG+A  VF+G++ ++VVSWN MI  YA HG GK+AL+
Sbjct  58   KSGFESDVFVGSTLIDMYAKCSSIGDASKVFDGMSTRNVVSWNAMIAAYAIHGCGKQALD  117

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK     P+ VT VGVLSAC H
Sbjct  118  LFEQMKHSDTSPNQVTFVGVLSACCH  143



>ref|XP_004250478.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Solanum lycopersicum]
Length=702

 Score =   106 bits (264),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+  +S   V +AL+ MY KCG +G A  VF+ +  K++VSWNTM++GYA+HGFGKEALE
Sbjct  434  KSRLDSNVVVDSALIDMYAKCGRLGYARRVFDILPAKNLVSWNTMVVGYAQHGFGKEALE  493

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             + MM+  G+KP+D+T +GVLSAC H
Sbjct  494  IYGMMQSSGVKPNDITFLGVLSACGH  519


 Score = 61.6 bits (148),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S  +V NALL  Y K     E+L +F+ + E+DVVSWNT+I G       +EAL 
Sbjct  333  KMGFDSFSFVCNALLDFYSKSDLFEESLKLFQEMKEQDVVSWNTLIAGCVSSSRYEEALR  392

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
            F + M   G +P   T   +LS C
Sbjct  393  FLREMLLEGFEPSLYTYSSILSIC  416


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMK-D  61
            +  N LL MY K     +A  +F+ + E++++SW T+I  Y + G  ++AL  F+ M  +
Sbjct  37   FTNNHLLTMYLKLNQFDDAQQLFDRMPERNIISWTTLISTYTQLGMYEKALGCFRSMNLE  96

Query  60   FGIKPDDVTMVGVLSACS  7
             G  P+  T V  LSACS
Sbjct  97   DGFGPNGYTYVAALSACS  114



>ref|XP_002264325.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
[Vitis vinifera]
Length=684

 Score =   106 bits (264),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G ES  +VGN+L+ MY KCGSI +   VFE + E+D VSWN +I+GYA++G+G EAL+
Sbjct  415  QSGAESDIFVGNSLIDMYMKCGSIEDGSRVFEKMKERDCVSWNAIIVGYAQNGYGAEALQ  474

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G KPD VTM+GVL ACSH
Sbjct  475  IFRKMLVCGEKPDHVTMIGVLCACSH  500


 Score = 89.4 bits (220),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y +  Y+G+AL+ MY KCGS+  A +VF G+ E+++V+WN++I  Y ++G   EALE
Sbjct  175  KSRYSTDVYMGSALIDMYSKCGSVACAEEVFSGMIERNLVTWNSLITCYEQNGPASEALE  234

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M D G++PD+VT+  V+SAC+
Sbjct  235  VFVRMMDSGLEPDEVTLASVVSACA  259


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/108 (31%), Positives = 52/108 (48%), Gaps = 31/108 (29%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIA-------------------------------EKD  148
            +GNAL+ MY KC  + EA  VF+ ++                               +++
Sbjct  286  LGNALVDMYAKCSKVNEARRVFDRMSIRNVVSETSMVSGYARAASVKAARFMFSKMTQRN  345

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
            VVSWN +I GY ++G  +EAL  F+++K   I P   T   +LSAC++
Sbjct  346  VVSWNALIAGYTQNGENEEALRLFRLLKRESIWPTHYTFGNLLSACAN  393


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +  N+L+++  K G + EA  +F  + E D  SWN+M+ G+A+H   +E+LE+F  M   
Sbjct  82   FTWNSLISVLTKSGFLDEAARLFGSMPEPDQCSWNSMVSGFAQHDRFEESLEYFVKMHRE  141

Query  57   GIKPDDVTMVGVLSACS  7
                ++ +    LSAC+
Sbjct  142  DFLLNEYSFGSALSACA  158



>gb|KHN21887.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=639

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G ES  +VGN+L+ MY KCG + E   VFE + E+DVVSWN MI+GYA++G+G +ALE
Sbjct  353  QSGEESDIFVGNSLIDMYMKCGMVEEGCLVFEHMVERDVVSWNAMIVGYAQNGYGTDALE  412

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ +   G KPD VTM+GVLSACSH
Sbjct  413  IFRKILVSGEKPDHVTMIGVLSACSH  438


 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            +G+AL+ MY KCG +  A   F+ +  +++VSWN++I  Y ++G   + LE F MM D  
Sbjct  157  MGSALVDMYSKCGVVACAQRAFDSMVVRNIVSWNSLITCYEQNGPAGKTLEVFVMMMDNV  216

Query  54   IKPDDVTMVGVLSACS  7
             +PD++T+  V+SAC+
Sbjct  217  DEPDEITLASVVSACA  232


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 47/83 (57%), Gaps = 4/83 (5%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            + +   +GNAL+ M     S+  A  +F  + EK+VV WN +I GY ++G  +EA+  F 
Sbjct  253  FRNDLVLGNALVDM----TSVKAARLMFSNMMEKNVVCWNVLIAGYTQNGENEEAVRLFL  308

Query  72   MMKDFGIKPDDVTMVGVLSACSH  4
            ++K   I P   T   +L+AC++
Sbjct  309  LLKRESIWPTHYTFGNLLNACAN  331


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 36/58 (62%), Gaps = 0/58 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            +   +  NA+L++  K G   EA +VF+ + + D  SWN M+ G+A+H   +EAL+FF
Sbjct  82   QRNTFSYNAILSVLTKLGKHDEAFNVFKSMPDPDQCSWNAMVSGFAQHDRFEEALKFF  139



>ref|XP_011015198.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like 
[Populus euphratica]
Length=526

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+ S  ++ NAL++MYCKCG++ +A  +FE +  KD+VSWN+MI GYA+HG   E +  F
Sbjct  259  GFVSYLHIANALVSMYCKCGNVEDAFHIFENMVGKDIVSWNSMIAGYAQHGLAVEGIGLF  318

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            + MK  G+KPD +T +GVLS+C H
Sbjct  319  ERMKSQGVKPDAITFLGVLSSCRH  342


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+ +  Y+G++L+  Y KCG +  A  VF+ +  ++VVSW  +I G+A+       L+ +
Sbjct  158  GFIANAYIGSSLVTFYGKCGELDNAYKVFKEMPVRNVVSWTAIISGFAQEWQVDMCLQLY  217

Query  75   KMMKDFGIKPDDVTMVGVLSACS  7
             +M++  +KP+D T   +LSAC+
Sbjct  218  CLMRNSTLKPNDFTFTSLLSACT  240



>ref|XP_011048447.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like 
[Populus euphratica]
Length=526

 Score =   105 bits (261),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+ S  ++ NAL++MYCKCG++ +A  +FE +  KD+VSWN+MI GYA+HG   E +  F
Sbjct  259  GFVSYLHIANALVSMYCKCGNVEDAFHIFENMVGKDIVSWNSMIAGYAQHGLAVEGIGLF  318

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            + MK  G+KPD +T +GVLS+C H
Sbjct  319  ERMKSQGVKPDAITFLGVLSSCRH  342


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+ +  Y+G++L+  Y KCG +  A  VF+ +  ++VVSW  +I G+A+       L+ +
Sbjct  158  GFIANAYIGSSLVTFYGKCGELDNAYKVFKEMPVRNVVSWTAIISGFAQEWQVDMCLQLY  217

Query  75   KMMKDFGIKPDDVTMVGVLSACS  7
             +M++  +KP+D T   +LSAC+
Sbjct  218  CLMRNSTLKPNDFTFTSLLSACT  240



>ref|XP_010270447.1| PREDICTED: uncharacterized protein LOC104606779 [Nelumbo nucifera]
Length=1399

 Score =   106 bits (265),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261   KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
             ++G ES  +VGN+L+ MY KCGSI + L VFE + E+D VSWN MI+GYA++G G EA+ 
Sbjct  1111  QSGPESDIFVGNSLVDMYTKCGSIEDGLYVFENMVERDRVSWNAMIVGYAQNGRGSEAVG  1170

Query  81    FFKMMKDFGIKPDDVTMVGVLSACSH  4
              FK M   G KPD VTM+GVL ACSH
Sbjct  1171  LFKKMLSSGEKPDHVTMIGVLCACSH  1196


 Score = 82.4 bits (202),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y S  Y+G+AL+ MY KCG++ ++  VF+ + E+++VSWN++I  Y ++G   EAL 
Sbjct  871  KSPYISDVYMGSALIDMYSKCGNVVDSQKVFDEMTERNIVSWNSLITCYEQNGPANEALR  930

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M   G++PD+VT+  V+SAC+
Sbjct  931  IFLRMMGSGVEPDEVTLASVVSACA  955


 Score = 80.9 bits (198),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S   V  +L+ MY K GS+  AL +F  ++ +D+V WN+MI+G+AR+G   EAL+
Sbjct  404  KMGLDSDAIVACSLMDMYSKSGSVHSALKIFPKMSTRDLVFWNSMIMGFARNGCEFEALK  463

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ + + G++PD++T  GVL ACS+
Sbjct  464  LFEELLESGLQPDEITFSGVLLACSN  489


 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = -2

Query  240  CYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKD  61
            C   N LL +  K G +  A D F  + E+DVVSWN+MI GYA +     ALE F+ M+ 
Sbjct  101  CITWNLLLMVLIKFGRLERAHDFFGIMPERDVVSWNSMISGYAANSLANSALEVFREMQR  160

Query  60   FGIKPDDVTMVGVLS  16
             G++P   T   VLS
Sbjct  161  VGVRPSGFTFSLVLS  175


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S   +GN+L+ MY +   +  A +VF  + E D++SWN+++ G  + G+   AL+ F +M
Sbjct  198  SNVVIGNSLIDMYGRFTLVRYAFNVFLSMKELDIISWNSLMSGLQKSGYRDWALDQFCLM  257

Query  66   KDFGIKPDDVTMVGVLSACSH  4
            +  G  PD  TM  V++ CS+
Sbjct  258  RSTGHCPDHFTMSMVITICSN  278


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            +   +  N +++ + K G + EAL+ F  + E D  SWN+M+ G+A+H   +E+LEFF  
Sbjct  774  QKNTFTWNTIISAFTKLGFVDEALNRFRTMPEPDQCSWNSMVSGFAQHDRFEESLEFFIN  833

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M       ++ +    LSACS
Sbjct  834  MHSEDFVLNEYSFASALSACS  854


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+ S   V +A++ M+ KC  + ++L VFE +   D    N+MI  YARHGF  +AL 
Sbjct  294  KMGFLSNSIVLSAIIDMFSKCNRLEDSLRVFEEVPRWDSSVCNSMISAYARHGFEDKALW  353

Query  81   FFKMMKDFGIKPDDVTMVGVLS  16
             F +     ++P + T+  VLS
Sbjct  354  LFVLTLRENLRPTEFTLSSVLS  375


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/83 (33%), Positives = 46/83 (55%), Gaps = 4/83 (5%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K  + S  ++ N L+  Y KCG I +A ++FE + +K+  +WNT+I  + + GF  EAL 
Sbjct  739  KTRFASEIFIQNRLIDAYAKCGCIDDAKNLFERMRQKNTFTWNTIISAFTKLGFVDEALN  798

Query  81   FFKMMKDFGIKPDDVTMVGVLSA  13
             F+ M +    PD  +   ++S 
Sbjct  799  RFRTMPE----PDQCSWNSMVSG  817


 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 31/108 (29%)
 Frame = -2

Query  234   VGNALLAMYCKCGSIGEALDVFEGIAEKDVVS----------------------------  139
             +GNAL+ MY KCG I EA  VF+ +  ++VVS                            
Sbjct  982   LGNALVDMYAKCGKINEARWVFDRMPIRNVVSETSLVSGYAKAASVKAARLMFTKMTVRN  1041

Query  138   ---WNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
                WN +I GY + G  +EAL  F ++K   + P   T   VL+AC++
Sbjct  1042  AVSWNALIAGYTQSGENEEALGLFCLLKRESVWPTHYTFGNVLNACAN  1089



>ref|XP_004502949.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like 
[Cicer arietinum]
Length=706

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G +S  +VGN+L+ MY KCG + +   VFE + E+D+VSWN MI+GYA++G+G EALE F
Sbjct  421  GEDSDIFVGNSLIDMYMKCGLVEDGRVVFEHMVERDIVSWNAMIVGYAQNGYGTEALEIF  480

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            + M+  G KPD VTM+GVLSACSH
Sbjct  481  RKMQVSGEKPDHVTMIGVLSACSH  504


 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y    Y+G+AL+ MY KCG +  A   F+ +  +++VSWN++I  Y ++G   +ALE
Sbjct  179  KSRYSFDVYIGSALVDMYSKCGVVASAQRAFDDMDVRNIVSWNSLITCYEQNGPAGKALE  238

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M +FGI+PD++T+  V+SAC+
Sbjct  239  VFVRMMNFGIEPDEITLASVVSACA  263


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  NA+L+   KCG++ EAL+VF+ + E D  SWN M+ G+A+    +EAL FF  
Sbjct  82   ERNIFSWNAVLSALTKCGALDEALNVFKCMPEPDQCSWNAMVSGFAQRDRFEEALRFFFD  141

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M       ++ +    LSAC+
Sbjct  142  MHGEDFVLNEYSFGSALSACA  162


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 52/114 (46%), Gaps = 31/114 (27%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFE-------------------------------  166
            + +   +GNAL+ MY KC  + EA  VF+                               
Sbjct  284  FRNDLVLGNALVDMYAKCKRVNEARLVFDRMPLRDVVSETSMVSGYAKVASVKAARLMFS  343

Query  165  GIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
             + E++VVSWN +I GY ++G  +EA+  F ++K   I P   T   +L+AC++
Sbjct  344  NMTERNVVSWNALIAGYTQNGENEEAVRLFLLLKRESIWPTHYTFGNLLNACAN  397


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 44/82 (54%), Gaps = 4/82 (5%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K  + S  ++ N L+ +Y KCG + +A  VF+ + E+++ SWN ++    + G   EAL 
Sbjct  47   KTQFSSEIFIQNRLVDVYGKCGCLEDARKVFDHMPERNIFSWNAVLSALTKCGALDEALN  106

Query  81   FFKMMKDFGIKPDDVTMVGVLS  16
             FK M +    PD  +   ++S
Sbjct  107  VFKCMPE----PDQCSWNAMVS  124



>ref|XP_010109634.1| hypothetical protein L484_015589 [Morus notabilis]
 gb|EXC23679.1| hypothetical protein L484_015589 [Morus notabilis]
Length=652

 Score =   105 bits (261),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            +AG E   +VGN+L+ MY KCGSIG+   VFE +AE+D VSWN MI+GYA++G+G EAL 
Sbjct  364  QAGEEPDIFVGNSLVDMYMKCGSIGDGCRVFENMAERDHVSWNAMIVGYAQNGYGAEALG  423

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  M   G +PD VTM+GVL ACSH
Sbjct  424  IFSRMLASGEQPDHVTMIGVLCACSH  449


 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y S  Y+G+AL+ MY KCGS+  A  VF+ + E++ VSWN++I  Y ++G   EA++
Sbjct  124  KSRYSSNVYMGSALIDMYSKCGSVTCAQRVFDWMEERNRVSWNSLISCYEQNGPASEAID  183

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F+ M D G++PD+VT+  V+SAC+
Sbjct  184  VFRRMMDSGVEPDEVTLASVVSACA  208


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 31/108 (29%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFE-------------------------------GIAEKD  148
            +GNAL+ MY KCG I EA  VF+                                + E++
Sbjct  235  LGNALVDMYAKCGRIDEARWVFDRMPIRNVVSETSMISGYAKAAGVKAARLMFTKMTERN  294

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
            VVSWN +I GY + G  +EAL  F ++K   + P   T   +L+AC++
Sbjct  295  VVSWNALISGYTQIGENEEALSLFLLLKRESVWPTHYTFGNLLNACAN  342


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   + GN+++ +  K G + EA+ +FE + + D  +WN+++ G+A+H +  +ALE    
Sbjct  27   ERNTFSGNSIICVLMKAGLLDEAMQIFEMMPDHDQCTWNSLVAGFAQHNWHGDALECLVK  86

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M       +D +    LSAC+
Sbjct  87   MHGENFMLNDYSFGSALSACA  107



>ref|XP_007010243.1| Pentatricopeptide repeat-containing protein [Theobroma cacao]
 gb|EOY19053.1| Pentatricopeptide repeat-containing protein [Theobroma cacao]
Length=671

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K  ++S   VG+AL+ MY KCG +  A  VF+ +  K++VSWNTM++GYA+HGF +EALE
Sbjct  433  KPAFDSNVVVGSALIDMYAKCGVLNAARKVFDYLTSKNLVSWNTMLVGYAQHGFAREALE  492

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             + MM+   +KP+DVT VGVLSAC+H
Sbjct  493  IYCMMQRDDVKPNDVTFVGVLSACAH  518


 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY S  YVGNA+L  Y KCG + EAL  FE +   D+VSWN++I G+   G  ++A+E
Sbjct  332  KMGYVSFIYVGNAVLDFYSKCGLLQEALRTFEDMDGHDMVSWNSLISGHVGSGQYEDAIE  391

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
              K M   G KP+  T   +L+ CS
Sbjct  392  LLKEMLFQGYKPNLYTYSSILNICS  416


 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            Y  N LLAMY K   I +A  VF+G+ E++V+SW  +I GY++ G  ++AL+   +M   
Sbjct  37   YTNNHLLAMYVKFNRIVDARKVFDGMPERNVISWTALISGYSQMGMAEKALDCLSLMVSD  96

Query  57   GIKPDDVTMVGVLSACS  7
             ++P+  T V  +SAC+
Sbjct  97   DLEPNYYTFVSAVSACA  113


 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G E   +V   L++ Y KCG +  A  VF  + + +V +W ++I GY + G  +EA++
Sbjct  231  KCGLEFDKFVETGLISFYTKCGELILAGQVFLEVNQSNVAAWTSLIGGYVQQGRREEAID  290

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  +   GI+P + T   VL AC+
Sbjct  291  LFLKLHSSGIRPSERTFSSVLGACA  315


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G +    V N+L+ MY KCG +  A  VF+ + E +++SW +++  Y + G   E+L+
Sbjct  130  RSGVDFSTPVCNSLINMYGKCGLLKSAQLVFDAMLEPNLISWTSLLSCYCQQGENMESLK  189

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F   +  G++ ++ T   VLS C+
Sbjct  190  IFVQSRRVGVRVNEFTCASVLSVCA  214



>ref|XP_011100928.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, 
chloroplastic [Sesamum indicum]
 ref|XP_011100929.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, 
chloroplastic [Sesamum indicum]
Length=894

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G E    +G++L+ MY KCGSIG+   VF+ I   D+VSW TMI  YA HG G EAL+
Sbjct  678  KKGIELEASIGSSLIMMYSKCGSIGDCSKVFQQIKYPDLVSWTTMITSYAHHGKGLEALQ  737

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F +MK  GI+PDDVT VGVLSACSHT
Sbjct  738  LFDLMKKSGIEPDDVTFVGVLSACSHT  764


 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G  S   VG+++  MY KCG + E+L  FE +  KD +SW +MI G A HG   +A++
Sbjct  475  KVGMVSEVSVGSSIFTMYSKCGDLEESLKAFEQLETKDNISWTSMIAGLAEHGCADKAVQ  534

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F+ M+   + PD+  +  +L++CS
Sbjct  535  MFRQMEFENLVPDEKILATILNSCS  559


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+     + +AL+ MY KCG +  A  VF  +  KD VSW+++I G+A+ G+ +EAL+
Sbjct  576  RCGFAKHTIIDDALVNMYSKCGDLNSAKIVFHAMPFKDQVSWSSLISGFAQRGYIEEALQ  635

Query  81   FFKMMKDFG-IKPDDVTMVGVLSACS  7
             F  M   G I  D  T+  VL A +
Sbjct  636  LFHDMLLSGIITVDAFTISSVLGALA  661


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G  +  +VG A++ +Y K G++ +A+  F  +  ++VVSW ++I G+ + G    AL 
Sbjct  275  KGGAGADVFVGTAVVDLYAKSGAMSDAIKQFRLMPVRNVVSWTSIISGFVQKGDSASALG  334

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
              K M+  G + + +T+  VL+AC++
Sbjct  335  VLKDMRKTGEEINTLTVSSVLAACAN  360


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S  Y  N LL  Y +   +  A  +FE I  ++VV+WN MI+G  ++    +A + +  M
Sbjct  77   SDIYAANNLLDAYSEFCHMDYAFKLFEEIPLRNVVTWNLMILGCNKNFLFDDAWQVYCRM  136

Query  66   KDFGIKPDDVTMVGVLSAC  10
               G+  D+ T   VLSAC
Sbjct  137  HKMGVGMDEFTYGSVLSAC  155



>ref|XP_010930665.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
[Elaeis guineensis]
Length=690

 Score =   105 bits (261),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G ES  +VGN+L+ MY KCGSI +   VFE +A +D VSWN +I+GYA++G G+EAL 
Sbjct  422  ESGPESDIFVGNSLVDMYLKCGSIDDGGKVFEKMAGRDRVSWNAVIVGYAQNGHGEEALN  481

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G  PDDVTM+GVLSACSH
Sbjct  482  LFRRMLLSGETPDDVTMIGVLSACSH  507


 Score = 77.4 bits (189),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            Y+G+AL+ MY KC    +A  VFEG+ +++VVSWN++I  Y ++G   EAL  F  M D 
Sbjct  190  YMGSALVDMYSKCRRPLDARRVFEGMPDRNVVSWNSLITCYEQNGPVNEALLLFVTMMDS  249

Query  57   GIKPDDVTMVGVLSACS  7
            G++PD+VT+  V+SAC+
Sbjct  250  GLEPDEVTLASVVSACA  266


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 4/76 (5%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM--KDFG  55
            N+L+  + K G   EA  +F  I E D  SW++M+ G+A+HG  +EAL+FF  M  +DF 
Sbjct  92   NSLIGAFTKSGCFDEAKQLFLSIPESDQCSWSSMVSGFAQHGRFEEALDFFVAMHAEDFV  151

Query  54   IKPDDVTMVGVLSACS  7
            +     +    LSAC+
Sbjct  152  LNAHSFS--SALSACA  165


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            ++++ Y K  S+ +A  +F  + E+++V+WN +I GY ++G  +EAL  F  +K   + P
Sbjct  327  SMISGYAKSASVKDARLMFLRMRERNIVAWNALIAGYTQNGEDEEALRLFLRLKRESVWP  386

Query  45   DDVTMVGVLSACSH  4
               T   +L+AC++
Sbjct  387  THYTFGNILNACAN  400



>ref|XP_007137795.1| hypothetical protein PHAVU_009G156000g [Phaseolus vulgaris]
 gb|ESW09789.1| hypothetical protein PHAVU_009G156000g [Phaseolus vulgaris]
Length=705

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G ES  +VGN+L+ MY KCG + +   +FE + E+D+VSWN MI+GYA++G+G +ALE
Sbjct  419  QSGEESDIFVGNSLIDMYMKCGMVEDGCLIFEHMVERDIVSWNAMIVGYAQNGYGTDALE  478

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G KPD VTM+GVLSACSH
Sbjct  479  IFRKMLLSGEKPDHVTMIGVLSACSH  504


 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K  Y    Y+G+AL+ MY KCG +  A   F+ +  +++VSWN++I  Y ++G  ++ALE
Sbjct  179  KCRYLLDVYMGSALVDMYSKCGVVTCAQRAFDEMVVRNIVSWNSLITCYEQNGPAQKALE  238

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M D  ++PD++TM  V+SAC+
Sbjct  239  IFVRMMDNRVEPDEITMASVVSACA  263


 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA+L+++ K G + EAL VF+ + E D  SWN M+ G+A+H   +EAL+FF  M      
Sbjct  89   NAILSVFTKFGKLDEALSVFKSMPEPDQCSWNAMVSGFAQHDRFEEALKFFLDMHSEDFV  148

Query  48   PDDVTMVGVLSACS  7
             ++ +    LSAC+
Sbjct  149  VNEYSFGSALSACA  162


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 31/117 (26%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIA-------------------------  157
            +  + +   +GNAL+ MY KC  + EA  VF+ +                          
Sbjct  281  RDKFRNDLVLGNALVDMYAKCKRVREARLVFDRMPVRDVVSETSMVSGYARAASVKAARL  340

Query  156  ------EKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
                  E++VVSWN +I GY ++G  +EA+  F ++K   + P   T   +L+AC++
Sbjct  341  MFSKMMERNVVSWNALIAGYTQNGENEEAVRLFLLLKRDSLWPTHYTFGNLLNACAN  397



>ref|XP_003602631.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES72882.1| PPR containing plant-like protein [Medicago truncatula]
Length=705

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G +S  +VGN+L+ MY KCG + +   VFE + E+D VSWN MI+GYA++G+G EALE
Sbjct  419  KSGEDSDIFVGNSLIDMYMKCGLVEDGRLVFERMLERDNVSWNAMIVGYAQNGYGTEALE  478

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G +PD VTM+GVLSACSH
Sbjct  479  IFREMLVSGERPDHVTMIGVLSACSH  504


 Score = 72.8 bits (177),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y    Y+G+AL+ MY KC  +  A   F+ +  +++VSWN++I  Y ++G   +ALE
Sbjct  179  KSRYSLDVYMGSALVDMYSKCRVVASAQRAFDDMDVRNIVSWNSLITCYEQNGPAGKALE  238

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M + GI+PD++T+  V SAC+
Sbjct  239  VFVRMMNCGIEPDEITLASVASACA  263


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 33/114 (29%), Positives = 52/114 (46%), Gaps = 31/114 (27%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFE-------------------------------  166
            Y +   +GNAL+ MY KC  + EA  VF+                               
Sbjct  284  YRNDLVLGNALVDMYAKCRRVNEARLVFDRMPLRDVVSETSMVSGYAKASSVKAARLMFS  343

Query  165  GIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
             + E++VVSWN +I GY ++G  +EA+  F ++K   I P   T   +L+AC++
Sbjct  344  NMMERNVVSWNALIAGYTQNGENEEAVRLFLLLKRESIWPTHYTFGNLLNACAN  397


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA+L    K G++ EAL++F+ + E+D  SWN M+ G+A+    +EAL F   M      
Sbjct  89   NAVLGALTKFGALDEALNLFKCMPERDQCSWNAMVSGFAQRDRFEEALRFVVDMHSEDFV  148

Query  48   PDDVTMVGVLSACS  7
             ++ +    LSAC+
Sbjct  149  LNEYSFGSALSACA  162



>ref|XP_006361496.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Solanum tuberosum]
Length=702

 Score =   104 bits (260),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ ++S   V +AL+ MY KCG +G A  VF+ +  K+++SWNTM++GYA+HGFGKEALE
Sbjct  434  KSRFDSNVVVDSALIDMYAKCGRLGYARRVFDILPAKNLISWNTMVVGYAQHGFGKEALE  493

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             + MM+   +KP+D+T +GVLSAC H
Sbjct  494  IYGMMQSSEVKPNDITFLGVLSACGH  519


 Score = 61.6 bits (148),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S  +V NALL  Y K     ++L +F+ + E DVVSWNT+I G    G  +EAL 
Sbjct  333  KQGFDSFSFVCNALLDFYSKSELFEKSLKLFQEMKEHDVVSWNTLIAGCVSSGRYEEALR  392

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
            F + M   G +P   T   +LS C
Sbjct  393  FLREMLLEGFEPSLYTYSSILSIC  416


 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMK-D  61
            +  N LL MY K   + +A  +F+ + E++++SW T+I  Y++ G  ++AL  F+ M  +
Sbjct  37   FTNNHLLTMYLKLNQLDDAQQLFDRMPERNIISWTTLISTYSQLGMSEKALGCFRSMNLE  96

Query  60   FGIKPDDVTMVGVLSACS  7
            +G  P+  T V   SACS
Sbjct  97   YGFGPNGYTYVAAFSACS  114


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 0/75 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +V   L+  Y KCG +  A   F+   E ++ +W  +I G  + G G+EA+E F  +   
Sbjct  240  FVVTGLINFYAKCGRLELARQAFDEADEPELHAWTAIIGGCVQLGSGREAIELFCKLLSS  299

Query  57   GIKPDDVTMVGVLSA  13
            G+KP + T   V+ A
Sbjct  300  GLKPSERTFSSVIGA  314



>ref|XP_002323442.1| hypothetical protein POPTR_0016s08300g [Populus trichocarpa]
 gb|EEF05203.1| hypothetical protein POPTR_0016s08300g [Populus trichocarpa]
Length=526

 Score =   103 bits (257),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+ S  ++ NAL++MYCKCG++ +A  +FE +  KD+VSWN+MI GYA+HG   + +  F
Sbjct  259  GFVSYLHIANALVSMYCKCGNVEDAFHIFENMVGKDIVSWNSMIAGYAQHGLAVQGIGLF  318

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            + MK  G+KPD +T +GVLS+C H
Sbjct  319  ERMKSQGVKPDAITFLGVLSSCRH  342


 Score = 67.4 bits (163),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/84 (35%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -2

Query  258  AGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEF  79
            AG+ +  Y+G++L+  Y KCG +  A  VF+ +  ++VVSW  +I G+A+       L+ 
Sbjct  157  AGFIANAYIGSSLVTFYGKCGELDNAYKVFKEMPVRNVVSWTAIISGFAQDWQVDMCLQL  216

Query  78   FKMMKDFGIKPDDVTMVGVLSACS  7
            + +M++  +KP+D T   +LSAC+
Sbjct  217  YCLMRNSTLKPNDFTFTSLLSACT  240



>emb|CDO99888.1| unnamed protein product [Coffea canephora]
Length=637

 Score =   104 bits (259),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S   VG+AL+ MY KCG +  A  VF+    ++++SWNTM++GYA++GF KEALE
Sbjct  372  KPGFDSNVVVGSALIDMYAKCGHMDAARKVFDTFPSRNLISWNTMLVGYAQNGFAKEALE  431

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             + MM+  G+KP+D+T +GVLSAC H
Sbjct  432  IYDMMQMNGVKPNDITFIGVLSACGH  457


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S   V N  LA Y K G + EAL  F  + E D+V+WN MI G+   G  + A++
Sbjct  271  KLGFDSFTVVCNTTLAFYIKRGLVEEALKTFYEMDEYDIVTWNAMITGFVGSGHYEGAIQ  330

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
            F + M   G  P+  T   +LS C
Sbjct  331  FLRDMLFEGFDPNLYTYSSLLSIC  354



>ref|XP_008808493.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At2g13600-like [Phoenix dactylifera]
Length=690

 Score =   104 bits (259),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            +AG ES  +VGN+L+ MY KCGSI +   VFE +A +D VSWN MI+GYA++G G+EAL 
Sbjct  422  EAGPESDIFVGNSLVDMYLKCGSIDDGGKVFEKMAGRDRVSWNAMIVGYAQNGRGEEALN  481

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G  PD VTM+GVLSACSH
Sbjct  482  LFRRMLLSGETPDHVTMIGVLSACSH  507


 Score = 75.1 bits (183),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/77 (47%), Positives = 53/77 (69%), Gaps = 0/77 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            Y+G+AL+ MY KC    +A  VFEG+ E++VVSWN++I  Y ++G   EAL  F  M   
Sbjct  190  YMGSALVDMYSKCRRPLDAHRVFEGMPERNVVSWNSLITCYEQNGPVNEALLLFVAMMVT  249

Query  57   GIKPDDVTMVGVLSACS  7
            G++PD+VT+  V+SAC+
Sbjct  250  GVEPDEVTLASVVSACA  266


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 29/76 (38%), Positives = 44/76 (58%), Gaps = 4/76 (5%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM--KDFG  55
            N+L+  + K G   EA  +F  I E D  SW++M+ G+A+HG  +EAL+FF  M  +DF 
Sbjct  92   NSLIGAFMKSGYSDEAKQLFLSIPESDQCSWSSMVSGFAQHGRFEEALDFFVAMHAEDFV  151

Query  54   IKPDDVTMVGVLSACS  7
            +     +    LSAC+
Sbjct  152  LNAHSFS--SALSACA  165


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            ++++ Y K  S+ +A  +F  + EK++V+WN ++ GY ++G  +EAL  F  +K   + P
Sbjct  327  SMISGYAKSASVKDARLMFLRMTEKNIVAWNALVAGYTQNGEDEEALRLFLQLKRESVWP  386

Query  45   DDVTMVGVLSACSH  4
               T   +L+AC++
Sbjct  387  THYTFGNLLNACAN  400



>ref|XP_010671740.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010671742.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010671743.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010671744.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010671745.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010671746.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010671747.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010671748.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010671749.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Beta vulgaris subsp. vulgaris]
Length=527

 Score =   103 bits (257),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  258  AGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEF  79
            +G+++  +V NAL++MYCKCG + +A  VFE + +KD+VSWN+MI GYA HG    A++ 
Sbjct  267  SGFDTYVHVANALISMYCKCGDVEDAFCVFEAMHDKDIVSWNSMITGYALHGLAWRAVDL  326

Query  78   FKMMKDFGIKPDDVTMVGVLSACSH  4
            F+ M+   IKPD +T +GVLS+C H
Sbjct  327  FEEMRQQKIKPDSITFLGVLSSCRH  351


 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 28/82 (34%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+    Y+G++L++MY K G +  A  VFE +  +++VSW ++I G+A+    +  L+ +
Sbjct  167  GFSVNVYIGSSLISMYSKSGDLRSAFMVFEEMPVRNIVSWTSLISGFAQRYQVEICLDLY  226

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
              M+   +KP+D T+  +LSAC
Sbjct  227  NQMRHSTLKPNDFTLTSLLSAC  248



>ref|XP_009630538.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630539.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630540.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630541.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana tomentosiformis]
 ref|XP_009630542.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana tomentosiformis]
Length=659

 Score =   104 bits (259),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            ++    + NALL MYCKCG++ +A  +F  + EKDV+SW+TMIIGYA++GF ++ALE FK
Sbjct  318  FQRDLILNNALLDMYCKCGNLEDAHKIFTRMVEKDVISWSTMIIGYAQNGFSRKALELFK  377

Query  72   MMKDFGIKPDDVTMVGVLSACSH  4
             MK  GIKP+ +T++GVL ACSH
Sbjct  378  EMKVSGIKPNYITVLGVLFACSH  400


 Score = 67.4 bits (163),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G ES  +V +AL+ +Y K G +  AL  F  +   D+V WN++I G+A++  G EAL 
Sbjct  216  KVGLESDVFVRSALIDVYSKMGQLECALCTFNEMVTGDLVVWNSIIGGFAQNSDGDEALT  275

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             FK MK  G   D  T+  VL AC+
Sbjct  276  LFKRMKRAGFSSDQSTLTSVLRACT  300


 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GYE   ++ N L+ MY K   + EA  +F+ +++++VVSW TMI  Y+      +ALEF 
Sbjct  120  GYEPKTFLINTLINMYVKFNMLDEAQALFDQMSDRNVVSWTTMIAAYSSAKINNKALEFL  179

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
             +M   G++P+  T   VL +C
Sbjct  180  ILMLRDGVRPNMFTYSSVLRSC  201



>ref|XP_008363910.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like 
[Malus domestica]
Length=497

 Score =   103 bits (256),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S  ++ NAL++MYCKCG + +AL +FE +  +D V+WN+MI GYA+HG   +A++
Sbjct  236  RTGFDSYIHIANALISMYCKCGDVKDALSIFENLDGRDNVTWNSMIAGYAQHGLALQAID  295

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK   +KPD +T++GVLS+C H
Sbjct  296  LFEEMKRQRVKPDAITLLGVLSSCRH  321


 Score = 64.3 bits (155),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/85 (32%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+ +  Y+G++L+++Y +CG +  A  +F+ +  ++VVSW  +I G+A+       L+
Sbjct  136  RIGFIANIYIGSSLVSLYSRCGELQSAYKLFDEMPVRNVVSWTAIISGFAQAWQVDVCLQ  195

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M++F ++P+D T   +LSAC+
Sbjct  196  LFSEMRNF-LEPNDFTYASILSACT  219



>gb|ADG37869.1| AT1G13410-like protein [Neslia paniculata]
Length=185

 Score = 99.4 bits (246),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            V NAL+ MY KCG+I  A++VF+GI  +D++SWNTMI G+A HG G EAL+ F  MK+ G
Sbjct  3    VKNALIDMYAKCGAIEIAMEVFKGIKRRDLISWNTMINGFAAHGHGTEALDLFHEMKNCG  62

Query  54   IKPDDVTMVGVLSACSH  4
            I+PD VT VGVL AC H
Sbjct  63   IRPDKVTFVGVLCACKH  79



>ref|XP_010228458.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic [Brachypodium distachyon]
Length=633

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            VG AL+ MYCKCGS+G+A+DVF GI +KD+V WN MI GYA HG  ++ALE F   ++ G
Sbjct  298  VGTALIDMYCKCGSLGDAVDVFHGIGDKDIVVWNAMINGYAMHGDSRKALEMFVQSREQG  357

Query  54   IKPDDVTMVGVLSACSHT  1
            + P D+T +G+L+ACSH+
Sbjct  358  LWPTDITFIGLLNACSHS  375


 Score = 70.5 bits (171),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            A+L  Y   G++ +A  +F+G+  KD V WN MI GY +HG   EAL  F+ M   G++P
Sbjct  199  AMLTCYADMGALDDARSLFDGLPTKDFVCWNAMIDGYTQHGRPNEALRLFRRMLGSGVEP  258

Query  45   DDVTMVGVLSACSH  4
            D+VT+V VLSA + 
Sbjct  259  DEVTVVLVLSAVAQ  272



>ref|XP_006342434.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial-like isoform X1 [Solanum tuberosum]
Length=654

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NALL MYCKCG++ +A  +F  + EKDV+SW+TMIIGYA++GF ++ALE FK MK  GI+
Sbjct  321  NALLDMYCKCGNLEDAHQIFSQMVEKDVISWSTMIIGYAQNGFSRKALELFKEMKVSGIR  380

Query  48   PDDVTMVGVLSACSH  4
            P+ +T++GVL ACSH
Sbjct  381  PNYITVLGVLFACSH  395


 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GYE   ++ N L+ MY K   + EA  +F+ +++++VVSW TMI  Y+      +ALEF 
Sbjct  115  GYEPKTFLVNTLMNMYVKFNMLDEAQALFDQMSDRNVVSWTTMIAAYSSAKINNKALEFL  174

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
             +M   G++P+  T   VL AC
Sbjct  175  ILMMRDGVRPNMFTFSSVLRAC  196


 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G ES  +V +AL+ +Y K G +  A+  F  +   D+V WN++I G+A++  G EAL 
Sbjct  211  KVGLESDVFVRSALIDVYSKMGQLKCAMCTFNEMVTGDLVVWNSIIGGFAQNSDGDEALT  270

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             FK MK  G   D  T+   L AC+
Sbjct  271  LFKRMKRAGFSADQSTLTSALRACT  295



>ref|XP_009341886.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Pyrus x bretschneideri]
Length=482

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S  ++ NAL++MYCKCG + +AL +FE +  +D VSWN+MI GYA+HG   +A++
Sbjct  236  RTGFDSYIHIANALISMYCKCGDVKDALYIFENLDGRDNVSWNSMIAGYAQHGLALQAVD  295

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK   +KPD +T++GVLS+C H
Sbjct  296  LFEEMKRQRVKPDAITLLGVLSSCRH  321


 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/85 (33%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+ S  Y+G++L++ Y +CG +  A  +F+ +  ++VVSW  +I G+A+       L+
Sbjct  136  RIGFISNVYIGSSLVSFYGRCGELQSAYKLFDEMPVRNVVSWTAIISGFAQTWQVDVCLQ  195

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M++F ++P+D T   +LSAC+
Sbjct  196  LFSEMRNF-LEPNDFTYASILSACT  219



>gb|KDP30336.1| hypothetical protein JCGZ_17483 [Jatropha curcas]
Length=672

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 48/86 (56%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY +  +V NAL+ MY KCG I ++  VF+GI   D VSWN+MIIGYA +G+G+EAL+
Sbjct  413  KSGYVNDLFVCNALITMYSKCGRISDSELVFKGIDHADTVSWNSMIIGYALNGYGREALK  472

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   GI PD VT VG+LS+CSH
Sbjct  473  LFQEMALKGIVPDQVTFVGLLSSCSH  498


 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G + +AL +F+ + E+++VSWN++I G+  +G   +AL FF +M+  G K
Sbjct  323  NTMIVAYARVGKMDDALKIFKEMGERNIVSWNSLISGFMLNGLYLDALRFFVLMQHEGKK  382

Query  48   PDDVTMVGVLSACS  7
            PD  T    LS+C+
Sbjct  383  PDQSTFACGLSSCA  396



>ref|XP_008239469.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial [Prunus mume]
Length=759

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G      + N L+ MY KCGS+G A ++F  +   DVVSW+++I+GYA+ G+G+EALE
Sbjct  501  KSGLVLDVTITNGLIDMYTKCGSLGSAQNLFGFMENPDVVSWSSLIVGYAQFGYGEEALE  560

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             FK MK  GIKP++VTMVGVL+ACSH
Sbjct  561  LFKTMKGLGIKPNEVTMVGVLTACSH  586


 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G     + G +L  MY K G +  A  VF  I   D+VSWN +I G++  G   EA+ 
Sbjct  298  KFGLGRDIFAGCSLCDMYAKYGYLESARTVFYQIERPDLVSWNAIISGFSNGGDANEAIS  357

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
            FF  M+  G+ PD+++++ +LSAC+
Sbjct  358  FFSQMRHKGLVPDEISVLSILSACT  382


 Score = 64.7 bits (156),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK-MMKDFGI  52
            NAL +MY K G I +A DVF  +  KD++SW +MI G+++ G+ KE+L  FK M+ +   
Sbjct  207  NALTSMYTKFGLIADAFDVFSHVQRKDLISWGSMIAGFSQLGYDKESLGHFKEMLCEGAY  266

Query  51   KPDDVTMVGVLSACS  7
            +P++       SACS
Sbjct  267  QPNEFIFGSAFSACS  281


 Score = 63.2 bits (152),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIA-EKDVVSWNTMIIGYARHGFGKEAL  85
            K  ++    V NALL MY KC ++ +A  VFE I    D VSWN +I    +H    E  
Sbjct  399  KRAFDGIVIVCNALLTMYAKCSNLYDAFIVFEDIRNHTDSVSWNAIITACMQHNQAGEVF  458

Query  84   EFFKMMKDFGIKPDDVTMVGVLSACSH  4
               K+M+   IKPD +T+  V+ AC++
Sbjct  459  RLLKLMRSSEIKPDYITLKNVIGACAN  485


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L MY KCGS+ +A  VF+ + E++VVSW ++I G++++    +A+E +  M   G +
Sbjct  106  NHVLNMYGKCGSVKDAGKVFDAMPERNVVSWTSLISGHSQNKQEDKAIELYFEMLRSGCR  165

Query  48   PDDVTMVGVLSACS  7
            PD  T   ++ ACS
Sbjct  166  PDHFTFGSIIKACS  179



>ref|XP_002883803.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH60062.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=697

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E   +VGN+L+ MY KCG + E   VF  + E+D VSWN MIIG+A++G+G EALE
Sbjct  420  QSGEEDDIFVGNSLIDMYVKCGCVEEGYLVFRKMMERDCVSWNAMIIGFAQNGYGNEALE  479

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M D G KPD +TM+GVLSAC H
Sbjct  480  LFREMLDSGEKPDHITMIGVLSACGH  505


 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S  Y+G+AL+ MY KCG++ +A  VF+ + +++VVSWN++I  Y ++G   EAL+ F++M
Sbjct  185  SDVYIGSALVDMYSKCGNVNDAQQVFDEMGDRNVVSWNSLITCYEQNGPAVEALKVFQVM  244

Query  66   KDFGIKPDDVTMVGVLSACS  7
             +  ++PD+VT+  V+SAC+
Sbjct  245  LESWVEPDEVTLASVISACA  264


 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            +   +  N+++    K G + EA  +F  + E+D  +WN+M+ G+A+H   +EAL +F M
Sbjct  83   QRNVFTWNSVVTGLTKLGFLDEADSLFRSMPERDQCTWNSMVSGFAQHDRCEEALYYFAM  142

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G   ++ T    LSACS
Sbjct  143  MHKEGFVLNEYTFASGLSACS  163


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 47/107 (44%), Gaps = 31/107 (29%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGI-------------------------------AEKD  148
            + NA + MY KC  I EA  +F+ +                               AE++
Sbjct  291  LSNAFVDMYAKCSRIKEARFIFDSMPIRNVIAETSMVSGYAMAASTKAARLMFTKMAERN  350

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACS  7
            VVSWN +I GY ++G  +EAL  F ++K   + P   T   +L AC+
Sbjct  351  VVSWNALIAGYTQNGENEEALSLFCLLKRESVCPTHYTFANILKACA  397



>ref|NP_190904.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9LFI1.1|PP280_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB67643.1| putative protein [Arabidopsis thaliana]
 gb|AEE79075.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=768

 Score =   104 bits (259),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G     ++ N L+ MY KCGS+G+A  +F+ +  +DVVSW+T+I+GYA+ GFG+EAL 
Sbjct  501  KTGLAPEQFIKNGLIDMYAKCGSLGQARRIFDSMDNRDVVSWSTLIVGYAQSGFGEEALI  560

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             FK MK  GI+P+ VT VGVL+ACSH
Sbjct  561  LFKEMKSAGIEPNHVTFVGVLTACSH  586


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGI-  52
            NAL+AMY +   + +A  VF GI  KD++SW+++I G+++ GF  EAL   K M  FG+ 
Sbjct  207  NALIAMYVRFNQMSDASRVFYGIPMKDLISWSSIIAGFSQLGFEFEALSHLKEMLSFGVF  266

Query  51   KPDDVTMVGVLSACS  7
             P++      L ACS
Sbjct  267  HPNEYIFGSSLKACS  281


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/78 (33%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            + N +L+MY KCGS+ +A +VF+ + E+++VS+ ++I GY+++G G EA+  +  M    
Sbjct  104  LNNHILSMYGKCGSLRDAREVFDFMPERNLVSYTSVITGYSQNGQGAEAIRLYLKMLQED  163

Query  54   IKPDDVTMVGVLSACSHT  1
            + PD      ++ AC+ +
Sbjct  164  LVPDQFAFGSIIKACASS  181


 Score = 59.7 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = -2

Query  231  GNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGI  52
            G +L  MY +CG +  A  VF+ I   D  SWN +I G A +G+  EA+  F  M+  G 
Sbjct  308  GCSLCDMYARCGFLNSARRVFDQIERPDTASWNVIIAGLANNGYADEAVSVFSQMRSSGF  367

Query  51   KPDDVTMVGVLSA  13
             PD +++  +L A
Sbjct  368  IPDAISLRSLLCA  380


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 42/85 (49%), Gaps = 1/85 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEK-DVVSWNTMIIGYARHGFGKEAL  85
            K G+ +   V N+LL MY  C  +    ++FE      D VSWNT++    +H    E L
Sbjct  399  KWGFLADLTVCNSLLTMYTFCSDLYCCFNLFEDFRNNADSVSWNTILTACLQHEQPVEML  458

Query  84   EFFKMMKDFGIKPDDVTMVGVLSAC  10
              FK+M     +PD +TM  +L  C
Sbjct  459  RLFKLMLVSECEPDHITMGNLLRGC  483



>ref|XP_006409682.1| hypothetical protein EUTSA_v10022582mg [Eutrema salsugineum]
 gb|ESQ51135.1| hypothetical protein EUTSA_v10022582mg [Eutrema salsugineum]
Length=687

 Score =   103 bits (258),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E+  +VGN+L+ MY KCG + E   VF  + E+D VSWN MIIG+A++G+G EALE
Sbjct  420  QSGEEADIFVGNSLIDMYVKCGCVEEGYLVFRKMMERDCVSWNAMIIGFAQNGYGNEALE  479

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M D G +PD +TM+GVLSAC H
Sbjct  480  LFRKMLDSGEQPDHITMIGVLSACGH  505


 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+   S  ++G+AL+ MY KCG++ +A  VF+ + +++VV+WN++I  Y ++G   EAL+
Sbjct  180  KSPRLSDVHIGSALVDMYSKCGNVNDAQQVFDEMGDRNVVTWNSLITCYEQNGPAAEALK  239

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F +M    ++PD++T+  V+SAC+
Sbjct  240  VFHVMLRASVEPDEITLASVISACA  264


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            +   Y  N+L+    K G + EA  +F  + E+D  +WN+M+ G+A+H   +EAL +F +
Sbjct  83   DRNVYTWNSLVTALAKLGLLDEADSLFMSMPERDQCTWNSMVSGFAQHDRCEEALNYFAL  142

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G   ++ T    LSACS
Sbjct  143  MHKEGFVLNEYTFASGLSACS  163


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (44%), Gaps = 31/107 (29%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGI-------------------------------AEKD  148
            + NA + MY KCG I EA  +F+ +                                E++
Sbjct  291  LSNAFVDMYAKCGMIKEARFIFDSMPIRNVIAETSMISGYAMAASTKAARLMFTKMTERN  350

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACS  7
            +VSWN +I GY ++G  +EAL  F ++K   + P   T   +L AC+
Sbjct  351  IVSWNALISGYTQNGENEEALSLFCLLKRESVCPTHYTFANILKACA  397



>gb|KFK39938.1| hypothetical protein AALP_AA3G309500 [Arabis alpina]
Length=512

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E+  +VGN+L+ MY KCG + +   VF  + E+D VSWN MIIG+A++G+G EALE
Sbjct  235  QSGEEADIFVGNSLIDMYVKCGCVEDGYLVFRKMMERDCVSWNAMIIGFAQNGYGNEALE  294

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M D G KPD +TM+GVLSAC H
Sbjct  295  LFREMLDSGEKPDHITMIGVLSACGH  320


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N+ +    K G + EA  +F  + E+D  +WN+M+ G+A+H   +EAL++F +
Sbjct  3    ERNVFTWNSFVTALAKLGFLDEADSLFRSMPERDQCTWNSMVSGFAQHDRCEEALQYFGL  62

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G K ++ T    LSACS
Sbjct  63   MHKEGFKANEYTFASGLSACS  83


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = -2

Query  210  YCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTM  31
            Y    S   A  +F  + E+++VSWN +I GY ++G  +EAL  F+++K   + P   T 
Sbjct  145  YAMAASTKAARLMFTKMKERNIVSWNALISGYTQNGENEEALNLFRLLKRESVCPTHYTF  204

Query  30   VGVLSACS  7
              VL AC+
Sbjct  205  ANVLKACA  212



>ref|XP_004253182.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Solanum lycopersicum]
Length=654

 Score =   103 bits (258),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NALL MYCKCG++ +A  +F  + EKDV+SW+TMIIGYA++GF ++ALE FK MK  GI+
Sbjct  321  NALLDMYCKCGNLEDAHQIFSQMVEKDVISWSTMIIGYAQNGFSRKALELFKEMKVSGIR  380

Query  48   PDDVTMVGVLSACSH  4
            P+ +T++GVL ACSH
Sbjct  381  PNYITVLGVLFACSH  395


 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GYE   ++ N L+ MY K   + EA  +F+ ++E++VVSW TMI  Y+      +ALEF 
Sbjct  115  GYEPKTFLVNTLMNMYVKFNMLEEAQALFDQMSERNVVSWTTMIAAYSSAKINNKALEFL  174

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
              M   G+KP+  T   VL AC
Sbjct  175  IFMMRDGVKPNMFTYSSVLRAC  196


 Score = 65.1 bits (157),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G ES  +V +AL+ +Y K G +  A+  F  +   D+V WN++I G+A++  G EAL 
Sbjct  211  KVGLESDVFVRSALIDVYSKMGQLECAMCTFNEMVTGDLVVWNSIIGGFAQNSDGDEALT  270

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             FK MK  G   D  T+   L AC+
Sbjct  271  LFKRMKRAGFSADQSTLTSALRACT  295



>ref|XP_007209027.1| hypothetical protein PRUPE_ppa023983mg, partial [Prunus persica]
 gb|EMJ10226.1| hypothetical protein PRUPE_ppa023983mg, partial [Prunus persica]
Length=697

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++ G +V +A++ +YCKCGSIG+A  VF  ++  ++ SWN M++GYA+HGF  E  E
Sbjct  481  KTGFDQGSFVESAIIDVYCKCGSIGDAEKVFRHVSTNNLASWNAMVMGYAQHGFHDEVSE  540

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  M  FG+KPD +T +GVL++C H
Sbjct  541  LFNKMSKFGVKPDHITYLGVLTSCCH  566


 Score = 73.6 bits (179),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY     VGN L++MY KC  IG+A  +F+ +  +D VSWN++I GY+ +G   +ALE
Sbjct  279  KLGYLWVVSVGNVLISMYGKCEQIGDARSIFDDMVCRDSVSWNSLIAGYSENGLVTQALE  338

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
              + M+D  ++P+  T+  +L   S+
Sbjct  339  VLRCMRDISLQPNGYTVASLLEVASN  364


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -2

Query  231  GNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGI  52
            GNA++ MY +CG+   A  VF+ I + DVVSW T  IG A  G   EALE FK++    +
Sbjct  191  GNAIMNMYSRCGNKQNAAKVFDEITDPDVVSW-TERIGAASDGV--EALELFKILHSGDL  247

Query  51   KPDDVTMVGVLSA  13
            K ++ T++ VLSA
Sbjct  248  KVNEYTIINVLSA  260


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+    ++ +A+++ + K G    AL       + D VS+N +I G AR G      +
Sbjct  46   KSGHRLDPFLASAVISQFAKLGLFYHALQFLNDTPDPDTVSYNALIAGLARSGPPGPVFD  105

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
             F  ++  G++PD  T+  ++ AC
Sbjct  106  LFDRLRHVGLRPDAFTLSSLVKAC  129



>ref|XP_002466303.1| hypothetical protein SORBIDRAFT_01g005310 [Sorghum bicolor]
 gb|EER93301.1| hypothetical protein SORBIDRAFT_01g005310 [Sorghum bicolor]
Length=606

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G  S   V  AL+ MY KCGS+ +A+DVF+G+  KD  +W+ MI+ YA HG+G+EA+ 
Sbjct  262  KIGLGSLVKVSTALIDMYAKCGSLEDAIDVFQGMESKDRQAWSVMIVAYANHGYGREAIS  321

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  G+KPDD+T +GVL ACSH+
Sbjct  322  LFEEMKKEGMKPDDITFLGVLYACSHS  348


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G     YV   L+ MY +CG    A  +F G     VVS+N MI    R     EAL 
Sbjct  161  KLGAADHDYVRPTLINMYAECGDARAARVMFGGTDGGCVVSYNAMIAAAVRSSRPGEALV  220

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F+ M+  G+KP  VT++ VLSAC+
Sbjct  221  LFREMQGKGLKPTSVTVISVLSACA  245



>ref|XP_002517667.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF44831.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=628

 Score =   103 bits (257),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G ES  +VGNAL+ MY KCGS+ E   +FE + E+D VSWN MI+GYA++G+G EAL  F
Sbjct  421  GEESDVFVGNALIDMYMKCGSVEEGCRIFENMVERDYVSWNAMIVGYAQNGYGMEALGLF  480

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            + M   G KPD VTM+G L ACSH
Sbjct  481  RKMLASGEKPDHVTMIGALCACSH  504


 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ +    Y+G+AL+ +Y KCG +  A  VF+G+ E++VVSWN++I  Y ++G  +EALE
Sbjct  179  KSQFLLDVYMGSALIDIYSKCGFVDCAQRVFDGMMERNVVSWNSLITCYEQNGPSREALE  238

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M + G +PD+VT+  V+SAC+
Sbjct  239  IFMRMMESGFEPDEVTLASVVSACA  263


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 51/108 (47%), Gaps = 31/108 (29%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIA-------------------------------EKD  148
            + NAL+ MY KCG I EA  VF+ +                                E++
Sbjct  290  LSNALVDMYAKCGRINEARCVFDRMPIRNVVSETSMVSGYAKTASVKAARLLFTKMIERN  349

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
            VVSWN +I GY ++G  +EAL  F+M+K   I P   T   +L+AC++
Sbjct  350  VVSWNALIAGYTQNGENEEALRLFRMLKREAICPTHYTFGNLLNACAN  397


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  NA+++   K G + E   +F  + E D  SWN++I G+A+H   +EAL +F  
Sbjct  82   EKNVFSWNAIVSTLVKSGFLDEGARLFVSMPEPDQCSWNSLIAGFAQHDRFEEALNYFVK  141

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G   ++ T    LSAC+
Sbjct  142  MHRKGFVLNEYTFGSGLSACA  162



>gb|KFK39939.1| hypothetical protein AALP_AA3G309500 [Arabis alpina]
Length=558

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E+  +VGN+L+ MY KCG + +   VF  + E+D VSWN MIIG+A++G+G EALE
Sbjct  281  QSGEEADIFVGNSLIDMYVKCGCVEDGYLVFRKMMERDCVSWNAMIIGFAQNGYGNEALE  340

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M D G KPD +TM+GVLSAC H
Sbjct  341  LFREMLDSGEKPDHITMIGVLSACGH  366


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            + SG    +AL+ MY KCG++ +A  VF+ +  ++VVSWN++I  Y ++G   EAL+ F 
Sbjct  75   FASGLSACSALVDMYSKCGNVSDAQQVFDEMGSRNVVSWNSLITCYEQNGPAVEALKVFH  134

Query  72   MMKDFGIKPDDVTMVGVLSACS  7
             M    ++PD+VT   V+SAC+
Sbjct  135  EMLKSNVEPDEVTFASVVSACA  156


 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N+ +    K G + EA  +F  + E+D  +WN+M+ G+A+H   +EAL++F +
Sbjct  3    ERNVFTWNSFVTALAKLGFLDEADSLFRSMPERDQCTWNSMVSGFAQHDRCEEALQYFGL  62

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G K ++ T    LSACS
Sbjct  63   MHKEGFKANEYTFASGLSACS  83


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (56%), Gaps = 0/68 (0%)
 Frame = -2

Query  210  YCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTM  31
            Y    S   A  +F  + E+++VSWN +I GY ++G  +EAL  F+++K   + P   T 
Sbjct  191  YAMAASTKAARLMFTKMKERNIVSWNALISGYTQNGENEEALNLFRLLKRESVCPTHYTF  250

Query  30   VGVLSACS  7
              VL AC+
Sbjct  251  ANVLKACA  258



>ref|XP_006384866.1| hypothetical protein POPTR_0004s21780g [Populus trichocarpa]
 gb|ERP62663.1| hypothetical protein POPTR_0004s21780g [Populus trichocarpa]
Length=571

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            Y+    + NALL MYCKCGS+ +A  VF  + EKDV+SW+TMI G A++G+ KEAL+ F+
Sbjct  230  YDQDLILNNALLDMYCKCGSLEDANAVFVRMVEKDVISWSTMIAGLAQNGYSKEALKLFE  289

Query  72   MMKDFGIKPDDVTMVGVLSACSH  4
             MK  GIKP+ VT+VGVL ACSH
Sbjct  290  SMKVLGIKPNYVTIVGVLFACSH  312


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S  +V +AL+ +Y + G +  AL VF+ +   D+V W+++I G+A++  G EAL 
Sbjct  128  KIGLDSDVFVRSALIDVYSRWGELENALRVFDEMVTGDLVVWSSIIAGFAQNSDGDEALR  187

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             FK MK  G      T+  VL AC+
Sbjct  188  LFKRMKRAGFLAQQTTLTSVLRACT  212


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+    ++ N L+ MY K G + +A DVF+ + +++VVSW TMI  Y+      +ALEF 
Sbjct  32   GHVPKTFLINILINMYVKFGLLHDAQDVFDKMPDRNVVSWTTMISAYSAAKLNDKALEFL  91

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
             +M   G++P+  T   VL AC
Sbjct  92   VLMLREGVRPNMFTYSSVLRAC  113



>ref|XP_010424322.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like 
[Camelina sativa]
Length=577

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E+  +VGN+L+ MY KCG + +   VF  + E+D VSWN MIIG+A++G+G EALE
Sbjct  419  QSGEEADIFVGNSLIDMYVKCGCVEDGYLVFRKMMERDRVSWNAMIIGFAQNGYGNEALE  478

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M D G KPD +TM+GVLSAC H
Sbjct  479  LFREMLDSGEKPDHITMIGVLSACGH  504


 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S  Y+G+AL+ MY KCG++ +A  VF+ + +++VVSWN++I  Y ++G   EAL+ F++M
Sbjct  184  SDVYIGSALVDMYSKCGNVDDAQRVFDEMGDRNVVSWNSLITCYEQNGPALEALKVFQVM  243

Query  66   KDFGIKPDDVTMVGVLSACS  7
             +  ++PD+VT+  V+SAC+
Sbjct  244  LESRVEPDEVTLASVISACA  263


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   Y  N+++    K G + EA  +F  + E+D  +WN+M+ G+A+H   ++AL +F M
Sbjct  82   ERNVYTWNSVVTGLTKLGFLDEAASLFRSMPERDQCTWNSMVSGFAQHDRCEDALFYFGM  141

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G   ++ T    LSACS
Sbjct  142  MHKEGFVLNEYTFASGLSACS  162


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ +  ++ N L+  Y KCGS+  +  +F+ + E++V +WN+++ G  + GF  EA  
Sbjct  47   KSGFSNEVFIQNRLIDAYAKCGSLNNSRQLFDEMPERNVYTWNSVVTGLTKLGFLDEAAS  106

Query  81   FFKMMKD  61
             F+ M +
Sbjct  107  LFRSMPE  113


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            ++++ Y    S   A  +F  +AE+++VSWN +I GY ++G  +EAL  F ++K   + P
Sbjct  324  SMISGYAMAASTKAARLMFTKMAERNIVSWNALIAGYTQNGENEEALSLFCLLKRESVSP  383

Query  45   DDVTMVGVLSACS  7
               T   +L AC+
Sbjct  384  THYTFANILKACA  396



>emb|CDY18453.1| BnaA04g21340D [Brassica napus]
Length=498

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S  ++ NAL+ MYCKCG + +A  +F+    KDVVSWN+MI GYA+HG   +A+E
Sbjct  247  QMGFKSYLHISNALITMYCKCGDLNDAFRIFDHFENKDVVSWNSMIAGYAQHGLATQAIE  306

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ MM   GIKPD +T +GVLS+C H
Sbjct  307  MFEVMMTKSGIKPDAITYLGVLSSCRH  333


 Score = 58.2 bits (139),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G  S  YVG++L+ +Y   G +  A  VF  + E++VVSW  +I G+A+       L+
Sbjct  146  KSGLISDVYVGSSLVVLYRDSGEVDNAHKVFVEMPERNVVSWTAIISGFAQEWRVDMCLK  205

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M++    P++ T  G+LSAC+
Sbjct  206  LYSEMRNSTSDPNNYTFTGLLSACT  230



>ref|XP_009141647.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like 
[Brassica rapa]
Length=517

 Score =   102 bits (255),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S  ++ NAL++MYCKCG + +A  +F+    KDVVSWN+MI GYA+HG   +A+E
Sbjct  266  QMGFKSYLHITNALISMYCKCGDLNDAFRIFDHFENKDVVSWNSMIAGYAQHGLATQAIE  325

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ MM   GIKPD +T +GVLS+C H
Sbjct  326  MFEVMMTKSGIKPDAITYLGVLSSCRH  352


 Score = 58.5 bits (140),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G  S  YVG++L+ +Y   G +  A  VF  + E++VVSW  +I G+A+       L+
Sbjct  165  KSGLISDVYVGSSLVVLYRDSGEVDNAHKVFVEMPERNVVSWTAIISGFAQEWRVDMCLK  224

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M++    P++ T  G+LSAC+
Sbjct  225  LYSEMRNSTSDPNNYTFTGLLSACT  249



>ref|XP_008464730.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
[Cucumis melo]
Length=686

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G +S  +VGN+L+ MY KCGS+     VF+ + E+D VSWN MI+GYA++GFG +ALE F
Sbjct  421  GEDSDVFVGNSLIDMYMKCGSVENGCRVFQHMLERDCVSWNAMIVGYAQNGFGNKALEVF  480

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
              M + G  PD VTM+GVLSACSH
Sbjct  481  SKMLESGEGPDHVTMIGVLSACSH  504


 Score = 73.2 bits (178),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 55/85 (65%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++ Y S  Y+G+AL+ MY KCG +  A   F+ +  +  VSWN++I  Y ++G   EAL+
Sbjct  179  RSNYLSDVYMGSALVDMYSKCGRVEYAQSAFDEMTVRSRVSWNSLITCYEQNGPVDEALK  238

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M + G++PD+VT+  V+SAC+
Sbjct  239  IFVEMIECGVEPDEVTLASVVSACA  263


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N+++  + K G + +A+ +FE + E D  SWN+MI G+ +HG   EAL +F  
Sbjct  82   ERNIFSWNSIICAFTKSGFLDDAVHIFEKMPEVDQCSWNSMISGFEQHGRFYEALVYFAQ  141

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G   ++ +    LSAC+
Sbjct  142  MHGHGFLVNEYSFGSALSACA  162


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 51/108 (47%), Gaps = 31/108 (29%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFE---------------GIAE----------------KD  148
            +GNALL MY KC  I EA  +F+               G A+                KD
Sbjct  290  LGNALLDMYAKCNRINEARIIFDMMPIRSVVSETSMVSGYAKASKVKVARSMFSNMMVKD  349

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
            V++WN +I G  ++G  +EAL  F+++K   I P   T   +L+AC++
Sbjct  350  VITWNALIAGCTQNGENEEALILFRLLKRESIWPTHYTFGNLLNACAN  397


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/67 (30%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ + S  ++ N L+ +Y KCG +  A  +F+ + E+++ SWN++I  + + GF  +A+ 
Sbjct  47   KSPFASETFIQNRLIDVYGKCGCVDVARKLFDRMLERNIFSWNSIICAFTKSGFLDDAVH  106

Query  81   FFKMMKD  61
             F+ M +
Sbjct  107  IFEKMPE  113



>gb|EYU44151.1| hypothetical protein MIMGU_mgv1a003236mg [Erythranthe guttata]
Length=598

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K  Y+    V NAL+ MYCKCGS+  A  +F  I  KD++SWN MI G A HG GK AL+
Sbjct  338  KTSYKCSTLVNNALVDMYCKCGSLNRAWSIFNSIERKDLISWNAMIHGLAMHGHGKNALQ  397

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  MK  G +PD VT V VLSACSH+
Sbjct  398  LFDRMKREGFEPDKVTFVAVLSACSHS  424


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 0/70 (0%)
 Frame = -2

Query  210  YCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTM  31
            Y K G I  A  +F+ +  K++V+W  MI  YA  G GKEA+  +  M+   ++PDD + 
Sbjct  254  YAKAGDIDMAKVLFDSMPAKNLVTWTIMISSYAEKGNGKEAVGLYHRMEGEKLRPDDTSF  313

Query  30   VGVLSACSHT  1
            V +LSA + +
Sbjct  314  VSILSASAES  323


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+   +  +V   L++    C  +  A++VF+ + E +   WNT+I  Y ++    +A E
Sbjct  44   KSNLHNHPFVAPKLVSALSLCRQMALAVNVFDQVEEPNSHLWNTLIKAYVQNSRPDKAFE  103

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M+  G+ PD+ T + +L ACS
Sbjct  104  VFCEMRCSGVSPDNYTYLFLLKACS  128


 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIG--EALDVFEGIAEKDVVSWNTMIIGYARHGFGKEA  88
            K  + S  +V N+L+  Y KCG  G  E+  +F  ++E+D+V++N+MI G  + G  KEA
Sbjct  142  KCNFYSDLFVPNSLIDAYSKCGLTGLEESKTLFGVMSERDLVTYNSMISGLVKAGELKEA  201

Query  87   LEFFKMMKD  61
             + F  M +
Sbjct  202  RKLFDEMPE  210



>gb|AFG58310.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
Length=151

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G +S   V N+LL MY KCGS+ +A  VF  +  +DVVSWN MI+GYA HG GKEAL+
Sbjct  35   RSGLQSYVTVENSLLDMYAKCGSLEDARKVFNRMTTRDVVSWNAMIVGYAIHGCGKEALQ  94

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK  G  PD VT +GVLSA  H
Sbjct  95   LFEQMKHTGTGPDHVTFIGVLSATCH  120



>gb|AFG58299.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58300.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58301.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58302.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58303.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58304.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58305.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58306.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58308.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58309.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58311.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58312.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
Length=151

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G +S   V N+LL MY KCGS+ +A  VF  +  +DVVSWN MI+GYA HG GKEAL+
Sbjct  35   RSGLQSYVTVENSLLDMYAKCGSLEDARKVFNRMTTRDVVSWNAMIVGYAIHGCGKEALQ  94

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK  G  PD VT +GVLSA  H
Sbjct  95   LFEQMKHTGTGPDHVTFIGVLSATCH  120



>ref|XP_010489866.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 
[Camelina sativa]
Length=591

 Score =   102 bits (255),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GY +   + NAL+ MY KCG +  A+ +F+ + ++D+VSWNTM+ G+  HG GKEAL  F
Sbjct  376  GYSANTSICNALMDMYTKCGKLDVAMRIFDTMHKRDIVSWNTMLFGFGIHGLGKEALSLF  435

Query  75   KMMKDFGIKPDDVTMVGVLSACSHT  1
            K M+D G+ PD+VT + +LSACSH+
Sbjct  436  KSMRDTGVNPDEVTFLAILSACSHS  460


 Score = 73.2 bits (178),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+     VGN +++ Y K GS+ +A   F  I  KDV+S+N++I G   +   +E+L 
Sbjct  273  KAGFILDLTVGNTIISFYAKYGSLCDAFKQFSEIGLKDVISYNSLISGCVENCRPEESLR  332

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  MK  GI+PD  T++GVL+ACSH
Sbjct  333  LFHDMKSSGIRPDITTLLGVLNACSH  358


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            + +  YV  AL+  Y KCG +  AL VF+ + ++D+VSWN MI G++ H      +  F 
Sbjct  134  FTTDMYVCTALVDFYAKCGELDMALQVFDKMPKRDIVSWNAMISGFSLHCSLTVVIGLFL  193

Query  72   MMK--DFGIKPDDVTMVGVLSA  13
             M+    G++P+  T+VG+  A
Sbjct  194  DMRRSSDGLRPNLSTIVGMFPA  215



>ref|XP_008387621.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Malus domestica]
Length=758

 Score =   103 bits (257),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G      V N L+ MY KCGSIG A  +F  + + DVVSW+++I+GYA+ G+G+EAL+
Sbjct  500  KSGIVLDVTVSNGLIDMYTKCGSIGSAQKLFGWMEDPDVVSWSSLIVGYAQFGYGEEALD  559

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             FK M + GIKP++VT+VGVL+ACSH
Sbjct  560  LFKRMXELGIKPNEVTLVGVLTACSH  585


 Score = 71.6 bits (174),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G     + G +L  MY KCG +  A  VF  I   D+VSWN +I G++  G   EAL 
Sbjct  297  KFGLGRDIFAGCSLCDMYAKCGQLESARTVFYQIDRPDLVSWNAIISGFSNAGDSNEALX  356

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
            FF  M+  G+ PD+V+++ +L+AC+
Sbjct  357  FFSQMRHKGLIPDEVSVLPILTACT  381


 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = -2

Query  258  AGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEF  79
            + Y+      N +L MY KCGS+ +A  VF+ + E++VVSW ++I GY+++    +A+E 
Sbjct  95   SNYQPDIVFQNHVLNMYGKCGSLADARKVFDAMPERNVVSWTSLISGYSQNSQEDKAIEL  154

Query  78   FKMMKDFGIKPDDVTMVGVLSACS  7
            +  M   G  PD  T   VL ACS
Sbjct  155  YFQMLRAGCVPDHFTFGSVLKACS  178


 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK-MMKDFGI  52
            NAL +MY K G I +A DVF  +  KD++SW +MI G+++ G+ KEAL+ FK M+     
Sbjct  206  NALTSMYTKFGLIADAFDVFSRVPTKDLISWGSMIAGFSQLGYEKEALDHFKEMLFQGAY  265

Query  51   KPDDVTMVGVLSAC  10
            +P++       SAC
Sbjct  266  QPNEFIFGSAFSAC  279


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIA-EKDVVSWNTMIIGYARHGFGKEAL  85
            K  ++    V N+LL MY KC ++ +A  VFE I  + D+V+WN +I    +H    E  
Sbjct  398  KRAFDFTVIVCNSLLTMYAKCSNLYDAFLVFEDIRNDADLVTWNAIISACMQHNQAGEVF  457

Query  84   EFFKMMKDFGIKPDDVTMVGVLSACSH  4
                +M+     PD +T+  ++ AC++
Sbjct  458  RLLNLMRXSETTPDHITLGNLIGACAN  484



>ref|XP_010467188.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like 
[Camelina sativa]
Length=692

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E+  +VGN+L+ MY KCG + +   VF  + E+D VSWN MIIG+A++G+G EALE
Sbjct  419  QSGEEADIFVGNSLIDMYVKCGCVEDGYLVFRKMMERDRVSWNAMIIGFAQNGYGNEALE  478

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M D G KPD +TM+GVLSAC H
Sbjct  479  LFREMLDSGEKPDHITMIGVLSACGH  504


 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S  Y+G+AL+ MY KCG++ +A  VF+ + +++VVSWN++I  Y ++G   EAL+ F++M
Sbjct  184  SDVYIGSALVDMYSKCGNVNDAQRVFDEMGDRNVVSWNSLITCYEQNGPALEALKVFQVM  243

Query  66   KDFGIKPDDVTMVGVLSACS  7
             +  ++PD+VT+  V+SAC+
Sbjct  244  LESRVEPDEVTLASVISACA  263


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ +  ++ N L+  Y KCGS+  +  +F+ + E++V +WN+++ G  + GF  EA  
Sbjct  47   KSGFSNEVFIQNRLIDAYAKCGSLNNSRQLFDEMPERNVYTWNSVVTGLTKLGFLDEADS  106

Query  81   FFKMMKD  61
             F+ M +
Sbjct  107  LFRSMPE  113


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            ++++ Y    S   A  +F  +AE+++VSWN +I GY ++G  +EAL  F ++K   + P
Sbjct  324  SMISGYAMAASTKAARLMFTKMAERNIVSWNALIAGYTQNGENEEALSLFCLLKRESVSP  383

Query  45   DDVTMVGVLSACS  7
               T   +L AC+
Sbjct  384  THYTFANILKACA  396


 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   Y  N+++    K G + EA  +F  + E+D  +WN+M+ G+A+H   + AL +F M
Sbjct  82   ERNVYTWNSVVTGLTKLGFLDEADSLFRSMPERDQCTWNSMVSGFAQHDRCEGALFYFGM  141

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G   ++ T    LSACS
Sbjct  142  MHKEGFVLNEYTFASGLSACS  162



>ref|XP_008804169.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like 
[Phoenix dactylifera]
Length=425

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G E   ++ N+L+ MY KCGSI  A+ VF  ++E+D+ SW T+I G A HGFGKEAL+
Sbjct  174  KVGLEGDVFIRNSLIDMYAKCGSIARAVQVFHSMSERDLHSWTTLITGLASHGFGKEALD  233

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  M+  G+ PD  T V VLSACSH
Sbjct  234  VFSQMQSMGVMPDATTFVVVLSACSH  259


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +V  A++ MY  CG +G A   F+G+  +DVV+W  MI G    G   EALE    M+  
Sbjct  79   FVQTAIVRMYLSCGCLGHARKAFDGMPHRDVVAWTAMISGLIDQGCHWEALEVLNEMRFS  138

Query  57   GI--KPDDVTMVGVLSACSHT  1
            G+   P+  TMV  +SAC++ 
Sbjct  139  GLDASPNVATMVSAMSACANV  159



>ref|XP_003550640.2| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like 
[Glycine max]
Length=511

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+ S  ++ NAL++MY KCG+I +AL +FE +  +DVV+WNTMI GYA+HG  +EA+ 
Sbjct  246  RMGFHSYLHIENALISMYSKCGAIDDALHIFENMVSRDVVTWNTMISGYAQHGLAQEAIN  305

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G+ PD VT +GVLS+C H
Sbjct  306  LFEEMIKQGVNPDAVTYLGVLSSCRH  331


 Score = 67.0 bits (162),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+ +  YVG++L+++Y +C  +G+A  VFE +  ++VVSW  +I G+A+       LE F
Sbjct  147  GFVASVYVGSSLISLYSRCAFLGDACRVFEEMPVRNVVSWTAIIAGFAQEWHVDMCLELF  206

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
            + M+   ++P+  T   +LSAC
Sbjct  207  QQMRGSDLRPNYFTYTSLLSAC  228



>ref|XP_011040829.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Populus euphratica]
Length=644

 Score =   103 bits (256),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            Y+    + NALL MYCKCGS+ +A  VF  + EKDV+SW+TMI G A++G+ KEAL+ F+
Sbjct  303  YDQDLILNNALLDMYCKCGSLEDANAVFVRMVEKDVISWSTMIAGLAQNGYSKEALKLFE  362

Query  72   MMKDFGIKPDDVTMVGVLSACSH  4
             MK  GIKP+ VT+VGVL ACSH
Sbjct  363  SMKVLGIKPNYVTIVGVLFACSH  385


 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S  +V +AL+ +Y + G +  AL VF+ +   D+V W+++I G+A++  G EAL 
Sbjct  201  KIGLDSDVFVRSALIDVYSRWGELENALRVFDEMVTGDLVVWSSIIAGFAQNSDGDEALR  260

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             FK MK  G      T+  VL AC+
Sbjct  261  LFKRMKRAGFLAQQTTLTSVLRACT  285


 Score = 64.3 bits (155),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+    ++ N L++MY K G + +A DVF+ + +++VVSW TMI  Y+      +ALEF 
Sbjct  105  GHVPKTFLINILISMYVKFGLLHDAQDVFDKMPDRNVVSWTTMISAYSAAKLNDKALEFL  164

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
             +M   G++P+  T   VL AC
Sbjct  165  VLMLREGVRPNMFTYSSVLRAC  186



>gb|AFG58313.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
 gb|AFG58314.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
Length=151

 Score = 97.4 bits (241),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G +S   V N+LL MY KCGS+ +A  VF  +  +DVVSWN MI+GYA HG GKEAL+
Sbjct  35   RSGLQSCVTVENSLLDMYAKCGSLEDARKVFNRMTTRDVVSWNAMIVGYAIHGCGKEALQ  94

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK  G  PD VT +GVLSA  H
Sbjct  95   LFEQMKHTGTGPDHVTFIGVLSATCH  120



>ref|XP_011102135.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like 
[Sesamum indicum]
Length=588

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S   VG+AL+ MY KCG + +A  VF  +  K++VSWN MI GYA+HGFG+EALE
Sbjct  373  KPGLDSNVVVGSALIDMYAKCGRLNDARKVFNILPGKNLVSWNVMITGYAQHGFGREALE  432

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             + +M   G+KP+D+T +G+LS+C H 
Sbjct  433  IYDLMLRNGVKPNDITFIGILSSCGHV  459


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+ES  +V NA L  Y K   + E+  +F G+   D+VSWN +I GY   G  + A+ 
Sbjct  272  KMGFESFTFVCNAALDFYAKIDCLDESFKIFCGMDVNDIVSWNALIAGYVNSGHYEAAIG  331

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
            F + M   G  PD  T   +LS C
Sbjct  332  FIRSMLLQGFHPDIYTYSILLSVC  355


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = -2

Query  153  KDVVSWNTMIIGYARHGFGKEALEFFKMM-KDFGIKPDDVTMVGVLSACSHT  1
            +++V+W  +I  Y++ G  ++AL +F++M  D GI P+D T V  +SAC+  
Sbjct  4    RNLVTWTALISAYSQMGLSEKALNYFRLMVLDDGITPNDYTYVAAISACARV  55


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +V N+L+ +Y KCG +  A  VF+ I E + VS  ++I  Y + G  +E L  F      
Sbjct  78   FVNNSLVNLYGKCGLLKSARLVFDAIPEINAVSCVSLITSYMQCGENEEGLRIFLRSLRR  137

Query  57   GIKPDDVTMVGVLSACSH  4
            G+K ++ +   +L AC++
Sbjct  138  GVKVNEFSYGSILGACAN  155



>ref|XP_010488859.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
[Camelina sativa]
Length=693

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E+  +VGN+L+ MY KCG + +   VF  + E+D VSWN MIIG+A++G+G EALE
Sbjct  419  QSGEEADIFVGNSLIDMYVKCGCVEDGYLVFRKMMERDRVSWNAMIIGFAQNGYGNEALE  478

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M D G KPD +TM+GVLSAC H
Sbjct  479  LFREMLDSGEKPDHITMIGVLSACGH  504


 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S  Y+G+AL+ MY KCG++ +A  VF+ + +++VVSWN++I  Y ++G   EAL+ F++M
Sbjct  184  SDVYIGSALVDMYSKCGNVNDAQRVFDEMGDRNVVSWNSLITCYEQNGPALEALKVFQVM  243

Query  66   KDFGIKPDDVTMVGVLSACS  7
             +  ++PD+VT+  V+SAC+
Sbjct  244  LESRVEPDEVTLASVISACA  263


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   Y  N+++    K G + EA  +F  + E+D  +WN+M+ G+A+H   ++AL +F M
Sbjct  82   ERNVYTWNSVVTGLTKLGFLDEADSLFRSMPERDQCTWNSMVSGFAQHDRCEDALFYFGM  141

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G   ++ T    LSACS
Sbjct  142  MHKEGFVLNEYTFASGLSACS  162


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ +  ++ N L+  Y KCGS+  +  +F+ + E++V +WN+++ G  + GF  EA  
Sbjct  47   KSGFSNEVFIQNRLIDAYAKCGSLNNSRQLFDEMPERNVYTWNSVVTGLTKLGFLDEADS  106

Query  81   FFKMMKD  61
             F+ M +
Sbjct  107  LFRSMPE  113


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            ++++ Y    S   A  +F  +AE+++VSWN +I GY ++G  +EAL  F ++K   I P
Sbjct  324  SMISGYAMAASTKAARLMFTKMAERNIVSWNALIAGYTQNGENEEALSLFCLLKRESISP  383

Query  45   DDVTMVGVLSACS  7
               T   +L AC+
Sbjct  384  THYTFANILKACA  396



>ref|XP_006412384.1| hypothetical protein EUTSA_v10027494mg [Eutrema salsugineum]
 gb|ESQ53837.1| hypothetical protein EUTSA_v10027494mg [Eutrema salsugineum]
Length=993

 Score =   103 bits (258),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +VG +L+ MY KCGSI +A  +F  I  +++ +WN M++G A+HG GKEAL+ FK MK  
Sbjct  657  FVGTSLVDMYAKCGSIDDAYSLFTRIEMRNIAAWNAMLVGLAQHGEGKEALQLFKQMKSL  716

Query  57   GIKPDDVTMVGVLSACSHT  1
            GIKPD VT +GVLSACSH+
Sbjct  717  GIKPDKVTFIGVLSACSHS  735


 Score = 67.8 bits (164),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++    V N+L+ MYCK   IG A  VF  ++E+D+VSWN++I G  + G   EA+ 
Sbjct  346  KLGFDLMLTVANSLINMYCKQRKIGFARTVFHSMSERDLVSWNSIIDGLTQSGLEMEAVC  405

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  +   G+ PD  TM  VL A S
Sbjct  406  MFMELLRRGLTPDQYTMTSVLKATS  430


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/85 (33%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY+   +V + +L MY KCG +  A   F  I   D V+W +MI G   +G  + A  
Sbjct  548  KSGYDLDLWVSSGILDMYVKCGDMRAAHFAFNSIPVPDDVAWTSMISGCIENGEEERAFH  607

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M+  G+ PD+ T+  +  A S
Sbjct  608  VYSQMRLMGVLPDEFTIATLAKASS  632


 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/84 (31%), Positives = 49/84 (58%), Gaps = 5/84 (6%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFG-----KEALEFFK  73
            ++ N L++MY KCGS+  A  VF+ + E+D+VSWN+++  YA+   G     +E    F+
Sbjct  81   FLVNNLISMYSKCGSLSYARRVFDKMPERDLVSWNSILAAYAQSSEGVVENIEEGFFLFR  140

Query  72   MMKDFGIKPDDVTMVGVLSACSHT  1
            +++   +    +T+  +L  C H+
Sbjct  141  ILRQSVVFTSRMTLAPLLKLCLHS  164


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/77 (34%), Positives = 42/77 (55%), Gaps = 0/77 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G ES  +V   L+ +Y K G + E   +FE +  +DVV WN M+  Y   GF +EA++
Sbjct  179  KIGLESDEFVAGFLVNIYLKFGKVKEGRVLFEEMPYRDVVLWNLMLKAYLDMGFKEEAVD  238

Query  81   FFKMMKDFGIKPDDVTM  31
                    G+ P+++T+
Sbjct  239  LSSAFHRSGLHPNEITL  255


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 40/76 (53%), Gaps = 1/76 (1%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            YV  AL+  Y +   + EA  +FE     D V+WN M+ GYA+   G + L+ F +M   
Sbjct  456  YVSTALIDAYSRNSCMQEAEVLFER-NSFDPVAWNAMMSGYAQSHDGHKTLKLFALMHKQ  514

Query  57   GIKPDDVTMVGVLSAC  10
            G + DD T+  VL  C
Sbjct  515  GERSDDFTLATVLKTC  530



>gb|KHN17644.1| Pentatricopeptide repeat-containing protein [Glycine soja]
Length=434

 Score =   101 bits (251),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+ S  ++ NAL++MY KCG+I +AL +FE +  +DVV+WNTMI GYA+HG  +EA+ 
Sbjct  169  RMGFHSYLHIDNALISMYSKCGAIDDALHIFENMVSRDVVTWNTMISGYAQHGLAQEAIN  228

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G+ PD VT +GVLS+C H
Sbjct  229  LFEEMIKQGVNPDAVTYLGVLSSCRH  254


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+ +  YVG++L+++Y +C  +G+A  VFE +  ++VVSW  +I G+A+       LE F
Sbjct  70   GFVASVYVGSSLISLYSRCAFLGDACRVFEEMPVRNVVSWTAIIAGFAQEWHVDMCLELF  129

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
            + M+   ++P+  T   +LSAC
Sbjct  130  QQMRGSDLRPNYFTYTSLLSAC  151



>ref|XP_010504479.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 
[Camelina sativa]
 ref|XP_010504488.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 
[Camelina sativa]
Length=445

 Score =   101 bits (251),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GY +   + NAL+ MY KCG +  A+ +F+ + ++D+VSWNTM+ G+  HG GKEAL  F
Sbjct  230  GYSANTSICNALMDMYTKCGKLDVAMRIFDTMHKRDIVSWNTMLFGFGIHGLGKEALSLF  289

Query  75   KMMKDFGIKPDDVTMVGVLSACSHT  1
            K M+D G+ PD+VT + +LSACSH+
Sbjct  290  KSMRDTGVNPDEVTFLAILSACSHS  314


 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+     VGN +++ Y K GS+ +A   F  I  KDV+S+N++I G   +   +E+L 
Sbjct  127  KAGFILDLTVGNTIISFYAKYGSLCDAFKQFSEIGLKDVISYNSLIYGCVENCRPEESLR  186

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  MK  G++PD  T++GVL+ACSH
Sbjct  187  LFHDMKSSGVRPDITTLLGVLNACSH  212



>ref|XP_006655184.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400-like 
[Oryza brachyantha]
Length=617

 Score =   102 bits (255),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -2

Query  258  AGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEF  79
            AG E+   VG+ALL MY KCG I EA  VF+ I +KDVV+WN MI GYA++G   EA+  
Sbjct  256  AGMETESLVGSALLGMYEKCGEISEARRVFDSITDKDVVAWNAMITGYAQNGMSNEAIAL  315

Query  78   FKMMKDFGIKPDDVTMVGVLSACS  7
            F  M+  G++PD +T+ GVLSACS
Sbjct  316  FHSMRKAGVRPDKITLAGVLSACS  339


 Score = 92.4 bits (228),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G  S  YVG AL+ MY KCG + +A+ VF  +  K+V SWN +I G A +G G EA++ F
Sbjct  358  GLYSNVYVGTALVDMYAKCGDLDKAIKVFRKMPCKNVASWNALICGLAFNGQGDEAIQHF  417

Query  75   KMMK-DFGIKPDDVTMVGVLSACSH  4
            K+M+ + G+KPDD+T +GVLSAC H
Sbjct  418  KLMRNEEGLKPDDITFIGVLSACVH  442



>ref|XP_003621264.1| Pentatricopeptide repeat-containing protein [Medicago truncatula]
 gb|AES77482.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula]
Length=519

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            +GNAL+ MY KCG+I E+LDVF  I +KDV+SWN++I+G A HG GKE+L  FKMM+   
Sbjct  309  LGNALIDMYAKCGNIKESLDVFWSITDKDVISWNSVIVGMALHGHGKESLSLFKMMQRTK  368

Query  54   IKPDDVTMVGVLSACSH  4
            I P+++T VGVL ACSH
Sbjct  369  ICPNEITFVGVLVACSH  385


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y K G +  A  +F+    KDVVSWN MI GY   G  K+ALE F  M   G+ 
Sbjct  209  NVMITGYVKQGEMESARMLFDEAPVKDVVSWNAMIAGYVVCGLSKQALELFNEMCRAGVF  268

Query  48   PDDVTMVGVLSACS  7
            PD+VT++ +LSAC+
Sbjct  269  PDEVTLLSLLSACA  282


 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+ S   V N LL  + KCG +  A  +F+   + DVV+W+++I GYAR G  K A +
Sbjct  136  RLGFGSNAVVRNTLLVFHAKCGDLNVATSLFDDSCKGDVVAWSSLIAGYARRGDLKVARK  195

Query  81   FFKMMKDFGIKPDDVTMVG  25
             F  M +  +   +V + G
Sbjct  196  LFNEMPERDLVSWNVMITG  214



>ref|XP_010045615.1| PREDICTED: pentatricopeptide repeat-containing protein At1g74600, 
chloroplastic-like [Eucalyptus grandis]
Length=833

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S   VG++L+AMY K G I E +  ++ I   D++ W TMI+ YARHG G+EAL+
Sbjct  440  KVGLDSNAAVGSSLVAMYSKFGGINECVKAYDQIDAPDLIGWTTMIMSYARHGIGEEALK  499

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
            FFK+MK   ++PD VT VGVLSACSH+
Sbjct  500  FFKLMKREKMRPDPVTFVGVLSACSHS  526


 Score = 62.0 bits (149),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 1/86 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G      V ++L   Y KC S+ E+ ++F  I EKD VSW +MI G  ++    EA+ 
Sbjct  238  KSGLVFDVSVASSLFTTYSKCDSLEESYEIFGQICEKDNVSWTSMIAGLGKNNLPDEAVR  297

Query  81   FFKMMKDFGIKPDDVTMVGVLSA-CS  7
             F+ M   G  PD  T + +L+A CS
Sbjct  298  LFRNMLLEGNSPDQSTFIAILTAICS  323



>ref|XP_009143508.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like 
isoform X2 [Brassica rapa]
Length=452

 Score =   101 bits (251),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S  ++ NAL++MYCKCG + +A  VF+   +KDVVSWN+MI GYA+HG   +A+E
Sbjct  230  KTGFKSCLHISNALISMYCKCGDLKDAFRVFDQFIDKDVVSWNSMIAGYAQHGLATQAIE  289

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ +M   G KPD +T +GVLS+C H
Sbjct  290  LFEVVMPKSGTKPDAITYLGVLSSCRH  316


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ S  YVG++L+ +Y   G +  A  VF  + EK+VVSW  MI G+A+       L+
Sbjct  128  KSGFTSDVYVGSSLVVLYRDSGEVDNARKVFVEMPEKNVVSWTAMISGFAQEWRVDICLK  187

Query  81   FF-KMMKDFGIKPDDVTMVGVLSACS  7
             + KM      +P+D T   +L+AC+
Sbjct  188  LYSKMRNSTSEQPNDYTFTALLNACT  213



>gb|KFK36618.1| hypothetical protein AALP_AA4G147200 [Arabis alpina]
Length=457

 Score =   101 bits (251),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S  ++ NAL++MYCKCG + +A  +F+    KDVVSWN+MI GYA+HG   +A+E
Sbjct  241  QMGFKSYLHISNALISMYCKCGDLKDAFRIFDQFLNKDVVSWNSMIAGYAQHGLATQAIE  300

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ MM   G KPD +T +GVLS+C H
Sbjct  301  LFEVMMPKSGTKPDAITYLGVLSSCRH  327


 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ S  YVG++L+ +Y   G +  A  VF+ + E++VVSW  MI G+A+       L+
Sbjct  140  KSGFVSDVYVGSSLVVLYRDSGDLDNAHKVFDEMPERNVVSWTAMISGFAQEWRVDICLK  199

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M++    P+D T   +LSAC+
Sbjct  200  LYSKMRNSTSDPNDYTFTALLSACT  224



>ref|XP_006297108.1| hypothetical protein CARUB_v10013108mg [Capsella rubella]
 gb|EOA30006.1| hypothetical protein CARUB_v10013108mg [Capsella rubella]
Length=691

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E+  +VGN+L+ MY KCG + +   VF  + E+D VSWN MI+G+A++G+G EALE
Sbjct  420  QSGEEADIFVGNSLIDMYVKCGCVEDGYLVFRKMMERDCVSWNAMIVGFAQNGYGNEALE  479

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M D G KPD VTM+GVLSAC H
Sbjct  480  LFREMLDSGEKPDHVTMIGVLSACGH  505


 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S  Y+G+AL+ MY KCG + +A  VF+ + +++VVSWN++I  Y ++G   EAL+ F++M
Sbjct  185  SDVYIGSALVDMYSKCGDVDDAQRVFDEMGDRNVVSWNSLITCYEQNGPAVEALKVFQVM  244

Query  66   KDFGIKPDDVTMVGVLSACS  7
             +  ++PD+VT+  V+SAC+
Sbjct  245  LESWVEPDEVTLASVISACA  264


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   Y  N++L    K G + EA  +F  + E+D  +WN+M+ G+A+H   +EAL +F M
Sbjct  83   ERNVYTWNSVLTALTKLGFLDEADSLFWLVPERDQCTWNSMVSGFAQHDRCEEALCYFGM  142

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G   ++ +    LSACS
Sbjct  143  MHKEGFVLNEYSFASGLSACS  163


 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (44%), Gaps = 31/107 (29%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGI-------------------------------AEKD  148
            + NA + MY KC  I EA  +F+ +                               AE++
Sbjct  291  LTNAFVDMYAKCSKISEARFIFDSMPIRNVIAETSMISGYAMAASTKAARLMFTKMAERN  350

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACS  7
            +VSWN +I GY ++G  +EAL  F ++K   + P   T   +L AC+
Sbjct  351  IVSWNALISGYTQNGENEEALSLFCLLKRESVCPTHYTFANILKACA  397



>ref|XP_006297107.1| hypothetical protein CARUB_v10013108mg [Capsella rubella]
 gb|EOA30005.1| hypothetical protein CARUB_v10013108mg [Capsella rubella]
Length=690

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E+  +VGN+L+ MY KCG + +   VF  + E+D VSWN MI+G+A++G+G EALE
Sbjct  420  QSGEEADIFVGNSLIDMYVKCGCVEDGYLVFRKMMERDCVSWNAMIVGFAQNGYGNEALE  479

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M D G KPD VTM+GVLSAC H
Sbjct  480  LFREMLDSGEKPDHVTMIGVLSACGH  505


 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S  Y+G+AL+ MY KCG + +A  VF+ + +++VVSWN++I  Y ++G   EAL+ F++M
Sbjct  185  SDVYIGSALVDMYSKCGDVDDAQRVFDEMGDRNVVSWNSLITCYEQNGPAVEALKVFQVM  244

Query  66   KDFGIKPDDVTMVGVLSACS  7
             +  ++PD+VT+  V+SAC+
Sbjct  245  LESWVEPDEVTLASVISACA  264


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   Y  N++L    K G + EA  +F  + E+D  +WN+M+ G+A+H   +EAL +F M
Sbjct  83   ERNVYTWNSVLTALTKLGFLDEADSLFWLVPERDQCTWNSMVSGFAQHDRCEEALCYFGM  142

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G   ++ +    LSACS
Sbjct  143  MHKEGFVLNEYSFASGLSACS  163


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (44%), Gaps = 31/107 (29%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGI-------------------------------AEKD  148
            + NA + MY KC  I EA  +F+ +                               AE++
Sbjct  291  LTNAFVDMYAKCSKISEARFIFDSMPIRNVIAETSMISGYAMAASTKAARLMFTKMAERN  350

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACS  7
            +VSWN +I GY ++G  +EAL  F ++K   + P   T   +L AC+
Sbjct  351  IVSWNALISGYTQNGENEEALSLFCLLKRESVCPTHYTFANILKACA  397



>ref|XP_011099721.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
[Sesamum indicum]
Length=703

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G E   +VGNAL+ MY KCGS+ +   VF  + E+D VS+N MI+GYA++G G EAL+
Sbjct  418  QHGPEPDVFVGNALIDMYMKCGSVEDGSRVFRNMIERDGVSFNAMIVGYAQNGQGTEALQ  477

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             FK M DFG KPD VTM+GVL ACSH
Sbjct  478  LFKEMLDFGEKPDHVTMIGVLCACSH  503


 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ + S  Y+G+AL+ MY KCG +  A   F+G+  ++ VSWN+MI  Y ++G   EAL+
Sbjct  178  KSRFSSDVYMGSALIDMYAKCGDVDCAQRAFDGMTVRNTVSWNSMITCYEQNGPASEALQ  237

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M + G+KPD++T+  V+SAC+
Sbjct  238  VFVKMIECGVKPDEMTLASVVSACA  262


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            ++++ Y K  S+  A  +F  + E++VVSWN +I GY ++G  +EAL  F ++K   + P
Sbjct  323  SMVSGYAKVASVETARTMFSKMVERNVVSWNALISGYTQNGDNEEALGLFLLLKRESVWP  382

Query  45   DDVTMVGVLSACSH  4
               T   +L+AC++
Sbjct  383  THYTFGNLLNACAN  396



>emb|CBI33742.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   102 bits (254),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G +   +VG AL+ MY KCGS+ +A  VF+ I +KDVV+WN+MI+GYA HGF +EAL+ F
Sbjct  220  GIQFNVHVGTALVDMYSKCGSLEDARLVFDKIDDKDVVAWNSMIVGYAMHGFSQEALQLF  279

Query  75   KMMKDFGIKPDDVTMVGVLSACSHT  1
            K M   G+ P ++T +G+LSAC H+
Sbjct  280  KSMCRMGLHPTNITFIGILSACGHS  304


 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            A+L  Y K G +  A  +F+G+ E+D V WN MI GY ++G   EAL  F+ M     KP
Sbjct  129  AMLTCYAKHGELDAARVLFDGMEERDGVCWNVMIDGYTQNGMPNEALVLFRRMLKAKAKP  188

Query  45   DDVTMVGVLSACSH  4
            ++VT++ VLSAC  
Sbjct  189  NEVTVLSVLSACGQ  202



>ref|XP_004492962.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like 
[Cicer arietinum]
Length=512

 Score =   102 bits (253),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+    +V NAL+AMY KCG+I +AL +FE +  +DVV+WN+MI+GYA HG  +EA+ 
Sbjct  246  QTGFHCYLHVYNALIAMYSKCGAIDDALYIFENMVNRDVVTWNSMIVGYAHHGLAQEAIS  305

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G+ PD VT +G+LS+C H
Sbjct  306  LFEEMTKQGVNPDAVTFLGILSSCRH  331


 Score = 75.5 bits (184),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+ +  YVG +L+++Y +CG +G+A  VF+ ++E++VVSW  +I G+A+       LE F
Sbjct  147  GFIANVYVGTSLISLYSRCGLLGDAYRVFDEMSERNVVSWTAIIAGFAQEWRADMCLELF  206

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
              M+D  +KP+  T   +LSAC
Sbjct  207  HKMRDLELKPNYFTYTSLLSAC  228



>gb|EMT26142.1| hypothetical protein F775_09158 [Aegilops tauschii]
Length=700

 Score =   102 bits (255),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++GY S  + GNAL++ Y KCG I EA  VF+ +A +D+VSWN +I GYA +G G EA+ 
Sbjct  484  RSGYISDSFAGNALISAYAKCGRILEARQVFDEMAGQDIVSWNALIDGYASNGRGTEAIS  543

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M+  G++PD+VT VGVLSACSH
Sbjct  544  VFREMEANGVRPDEVTFVGVLSACSH  569


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N L+A Y + G + +A+ +F  + +++VVSWN++I G+ ++G   EAL++F +M+     
Sbjct  394  NTLIAGYAQDGQMRKAVGIFRKMNQRNVVSWNSVISGFVQNGLCLEALQYFLLMRRDAKM  453

Query  48   PDDVTMVGVLSACS  7
             D  T    LSAC+
Sbjct  454  ADWSTYACCLSACA  467


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  222  LLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKD  61
            LL  YC+ G IGEA ++F+ + E++VVSWN M+ GY R     EA   F  M D
Sbjct  241  LLNGYCRAGRIGEARELFDRMPERNVVSWNVMLGGYLRLSQMDEAYRLFSEMPD  294


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N +++ Y  CG + +A+ +F+ +  KD+VSWNT+I GYA+ G  ++A+  F+ M
Sbjct  363  NTMISGYVHCGMLDKAMVLFQQMPNKDMVSWNTLIAGYAQDGQMRKAVGIFRKM  416



>ref|XP_009343153.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53360, 
mitochondrial-like [Pyrus x bretschneideri]
Length=758

 Score =   103 bits (256),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G      V N L+ MY KCGSIG A  +F  + + DVVSW+++I+GYA+ G+G+EAL+
Sbjct  500  KSGIVLDVTVSNGLIDMYTKCGSIGSAQKLFGWMEDPDVVSWSSLIVGYAQFGYGEEALD  559

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             FK M + GIKP++VT+VGVL+ACSH
Sbjct  560  LFKRMMELGIKPNEVTLVGVLTACSH  585


 Score = 71.6 bits (174),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G     + G +L  MY KCG +  A  VF  I   D+VSWN +I G++  G   EAL 
Sbjct  297  KFGLGRDIFAGCSLCDMYAKCGQLESARTVFYQIDRPDLVSWNAIISGFSNAGDSNEALS  356

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
            FF  M+  G+ PD+V+++ +L+AC+
Sbjct  357  FFSQMRHKGLIPDEVSVLPILTACT  381


 Score = 67.4 bits (163),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -2

Query  258  AGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEF  79
            + Y+      N +L MY KCGS  EA  VF+ + E++VVSW ++I GY+++    +A+E 
Sbjct  95   SNYQPDIVFQNHVLNMYGKCGSFAEARKVFDAMPERNVVSWTSLISGYSQNSQEDKAIEL  154

Query  78   FKMMKDFGIKPDDVTMVGVLSACS  7
            +  M   G  PD  T   VL ACS
Sbjct  155  YFQMLRAGCVPDHFTFGSVLKACS  178


 Score = 65.5 bits (158),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK-MMKDFGI  52
            NAL +MY K G I +A DVF  +  KD++SW +MI G+++ G+ KEAL+ FK M+     
Sbjct  206  NALTSMYAKFGLIADAFDVFSRVPTKDLISWGSMIAGFSQLGYEKEALDHFKDMLFQGAY  265

Query  51   KPDDVTMVGVLSAC  10
            +P++       SAC
Sbjct  266  RPNEFIFGSAFSAC  279


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIA-EKDVVSWNTMIIGYARHGFGKEAL  85
            K  ++    V N+LL MY KC ++ +A  VFE I  + D+V+WN +I    +H    E  
Sbjct  398  KRAFDFTVIVCNSLLTMYAKCSNLYDAFLVFEDIRNDADLVTWNAIISACMQHNQAGEVF  457

Query  84   EFFKMMKDFGIKPDDVTMVGVLSACSH  4
                +M+     PD +T+  ++ AC++
Sbjct  458  RLLNLMRISETTPDHITLGNLIGACAN  484



>gb|KCW51843.1| hypothetical protein EUGRSUZ_J01294, partial [Eucalyptus grandis]
Length=670

 Score =   102 bits (255),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G ES  +VGN+L+ MY KCG++ + L VF+ + E+D VSWN +I+GYA++G+G EALE
Sbjct  419  QSGEESDIFVGNSLIDMYVKCGAVEDGLWVFKNMLERDKVSWNAIIVGYAQNGYGIEALE  478

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G +PD VTM+GVL ACSH
Sbjct  479  IFRKMLVSGERPDRVTMIGVLCACSH  504


 Score = 76.3 bits (186),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+   S  ++G+AL+ MY KCG++  AL  F+ ++ +++VSWN++I  Y ++G   EALE
Sbjct  179  KSECSSDVHMGSALIDMYSKCGNVACALRAFDEMSSRNIVSWNSLITCYEQNGPASEALE  238

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M D G + D+VT+  V+SAC+
Sbjct  239  VFVSMMDCGFEIDEVTLASVVSACA  263


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/114 (30%), Positives = 53/114 (46%), Gaps = 31/114 (27%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIA----------------------------  157
            Y +   +GNAL+ MY KC  I EA  +F+ +                             
Sbjct  284  YRNDVVLGNALVDMYSKCSRISEARAIFDRMPTRNIVSATSMVSGYAKAASLKAARVMFT  343

Query  156  ---EKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
               EK+VVSWN +I GY ++G  +EA   F+++K   I+P   T   +L+AC++
Sbjct  344  RMMEKNVVSWNALIAGYTQNGENEEAFGLFRLLKREPIEPTHYTFGNLLNACAN  397


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  NA+L    + GS+ EA ++F+ + E D  SWN+M+ GYA+H   +EAL+ F  
Sbjct  82   EKNTFTWNAILGGLIRLGSLDEAENIFQSMPEPDQCSWNSMLSGYAQHERFEEALQCFGK  141

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M       ++ +    LSAC+
Sbjct  142  MHRENYVLNEYSFGSALSACA  162



>emb|CDX74970.1| BnaA05g07160D [Brassica napus]
Length=481

 Score =   101 bits (251),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S  ++ NAL++MYCKCG + +A  VF+   +KDVVSWN+MI GYA+HG   +A+E
Sbjct  230  KTGFKSCLHISNALISMYCKCGDLKDAFRVFDQFLDKDVVSWNSMIAGYAQHGLATQAIE  289

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ +M   G KPD +T +GVLS+C H
Sbjct  290  LFEVVMPKSGTKPDAITYLGVLSSCRH  316


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ S  YVG++L+ +Y   G +  A  VF  + EK+VVSW  MI G+A+       L 
Sbjct  128  KSGFTSDVYVGSSLVVLYRDSGELDNARKVFVEMPEKNVVSWTAMISGFAQEWRVDICLN  187

Query  81   FF-KMMKDFGIKPDDVTMVGVLSACS  7
             + KM      +P+D T   +L+AC+
Sbjct  188  LYSKMRNSTSEQPNDYTFTALLNACT  213



>ref|XP_006347856.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, 
chloroplastic-like [Solanum tuberosum]
Length=849

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG +S   V NAL++MY +CG+I  A  VFEG+ +++V+SW ++I G+A+HGF   A+E
Sbjct  505  KAGIQSNQSVSNALISMYSRCGNIEAAFQVFEGMEDRNVISWTSIITGFAKHGFAHRAVE  564

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  M + GIKP++VT + VLSACSH
Sbjct  565  LFNQMLEDGIKPNEVTYIAVLSACSH  590


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  261  KAGY-ESGCYVGNALLAMYCKCGS-IGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEA  88
            K GY ES   VG AL+ ++ K  S +  A  VF+ + E+++V+W  MI  +++ G  K+A
Sbjct  197  KTGYFESDICVGCALIDLFAKGFSDLRSAKKVFDRMPERNLVTWTLMITRFSQLGASKDA  256

Query  87   LEFFKMMKDFGIKPDDVTMVGVLSACS  7
            +  F  M   G  PD  T  GVLSAC+
Sbjct  257  VRLFLEMVSEGFVPDRFTFSGVLSACA  283


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G  S   V N+L++MY K G + EA   FE + EK++VS+N ++ GY++     EA E
Sbjct  405  KLGLASVNCVANSLISMYAKSGRMEEARKAFELLFEKNLVSYNIIVDGYSKSLDSAEAFE  464

Query  81   FFKMMKDFGIKPDDVTMVGVLS  16
             F  + D  ++ D  T   +LS
Sbjct  465  LFSHL-DSEVEVDTFTFASLLS  485


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 4/79 (5%)
 Frame = -2

Query  234  VGNALLAMYCKC---GSIGEALDVFEGIAEKDVVSWNTMIIGYARHG-FGKEALEFFKMM  67
            VG +L+ MY K    GS+ ++  VF+ +A+ +V+SW  +I GY + G +  EA++ +  M
Sbjct  309  VGCSLVDMYAKSTMDGSMDDSRKVFDRMADHNVMSWTAIITGYVQSGHYDMEAIKLYCRM  368

Query  66   KDFGIKPDDVTMVGVLSAC  10
             D  +KP+  T   +L AC
Sbjct  369  IDNPVKPNHFTFSSLLKAC  387


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEK-DVVSWNTMIIGYARHGFGKEALEFFK  73
            E    + N+L+++Y K GS   A  +FE + EK D+VSW+ MI  YA  G   E++  F 
Sbjct  99   EPDTILLNSLISLYSKMGSWETAEKIFESMGEKRDLVSWSAMISCYAHCGMELESVFTFF  158

Query  72   MMKDFGIKPDDVTMVGVLSAC  10
             M +FG  P+      V+ AC
Sbjct  159  DMVEFGEYPNQFCFSAVIQAC  179



>ref|XP_008387699.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Malus domestica]
Length=497

 Score =   101 bits (252),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 40/86 (47%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S  ++ NAL++MYCKCG + +AL +FE +  +D V WN+MI GYA+HG   +A++
Sbjct  236  RTGFBSYIHIANALISMYCKCGDVKDALSIFENLDGRDNVXWNSMIAGYAQHGLALQAID  295

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK   +KPD +T++GVLS+C H
Sbjct  296  LFEEMKRQRVKPDAITLLGVLSSCRH  321


 Score = 65.1 bits (157),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/85 (33%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+ S  Y+G++L+++Y +CG +  A  +F+ +  ++VVSW  +I G+A+       L+
Sbjct  136  RIGFISNVYIGSSLVSLYSRCGELQSAYKLFDEMPVRNVVSWTAIISGFAQAWQVDVCLQ  195

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M++F ++P+D T   +LSAC+
Sbjct  196  LFSEMRNF-LEPNDFTYASILSACT  219



>ref|XP_002279137.1| PREDICTED: pentatricopeptide repeat-containing protein ELI1, 
chloroplastic [Vitis vinifera]
Length=628

 Score =   102 bits (254),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 44/85 (52%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G +   +VG AL+ MY KCGS+ +A  VF+ I +KDVV+WN+MI+GYA HGF +EAL+ F
Sbjct  286  GIQFNVHVGTALVDMYSKCGSLEDARLVFDKIDDKDVVAWNSMIVGYAMHGFSQEALQLF  345

Query  75   KMMKDFGIKPDDVTMVGVLSACSHT  1
            K M   G+ P ++T +G+LSAC H+
Sbjct  346  KSMCRMGLHPTNITFIGILSACGHS  370


 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            A+L  Y K G +  A  +F+G+ E+D V WN MI GY ++G   EAL  F+ M     KP
Sbjct  195  AMLTCYAKHGELDAARVLFDGMEERDGVCWNVMIDGYTQNGMPNEALVLFRRMLKAKAKP  254

Query  45   DDVTMVGVLSACSH  4
            ++VT++ VLSAC  
Sbjct  255  NEVTVLSVLSACGQ  268



>ref|XP_010923534.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like 
[Elaeis guineensis]
Length=787

 Score =   102 bits (255),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   Y+G++L+ MY KCG I  +L+VF  +  KD++SW+TMI+G A HG  + A+EFF+ 
Sbjct  537  EMDAYLGSSLIDMYAKCGCINLSLEVFNRMPTKDLLSWSTMIVGLAMHGHSEYAIEFFRQ  596

Query  69   MKDFGIKPDDVTMVGVLSACSH  4
            M+D+G++PD VT VGVLSACSH
Sbjct  597  MEDYGVQPDAVTFVGVLSACSH  618


 Score = 59.3 bits (142),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G  +  YV N+L+ MY  CG   +   +F+ + E+ VV+W+ +I GYA  G  +    
Sbjct  167  KCGAVADPYVQNSLVRMYFGCGRSRDGQLLFDKMPERSVVAWSCVIGGYAELGLWERVKS  226

Query  81   FFKMM-KDFGIKPDDVTMVGVLSAC  10
             F+MM  +F   P+ VT+V V++AC
Sbjct  227  LFRMMVSEFHCVPNSVTLVRVITAC  251


 Score = 58.9 bits (141),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  222  LLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPD  43
            LL+ Y   G +  A ++F+ + +++VV+WN MI GY  +G  +EA+  +K M    ++ D
Sbjct  313  LLSGYASMGHLTLAHEIFDKMPDRNVVAWNAMIAGYVLNGCFEEAILLYKEMLALNVEID  372

Query  42   DVTMVGVLSACSHT  1
              TM+ VLSAC+ +
Sbjct  373  KATMISVLSACAKS  386


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/72 (33%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = -2

Query  222  LLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPD  43
            ++  Y   G I  AL+ F  +  KD+ +WN +I   A+  +  EAL+ F+ M+   + P+
Sbjct  445  MMVGYVTIGEIKAALETFNQMPHKDLAAWNALISTLAQCNYFSEALDIFEKMQRTKVSPN  504

Query  42   DVTMVGVLSACS  7
              T+V +LSAC+
Sbjct  505  CFTLVSILSACA  516



>ref|XP_009124193.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04750, 
mitochondrial isoform X1 [Brassica rapa]
 emb|CDY50754.1| BnaAnng10610D [Brassica napus]
Length=651

 Score =   102 bits (254),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G +   ++G+AL+ MYCKCGSI  A  VF+ +AEKDV  W TMI G A HG GK+ALE
Sbjct  393  RLGLQVDAFLGSALVDMYCKCGSIERAFKVFKTVAEKDVTLWTTMISGTAFHGNGKQALE  452

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ M++ G+KP+ VT++ VL+ACSH+
Sbjct  453  LFEEMQEEGVKPNKVTLLAVLTACSHS  479


 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE-FFKMMKD  61
            Y+ N+L+ +Y + G +G A  VF+ + E+DV S+NTMI+GYA+ G+  EA++ ++KM+ D
Sbjct  164  YLWNSLVKVYMEFGDLGYAEKVFDEMPERDVSSFNTMIVGYAKKGYCLEAMKVYYKMVGD  223

Query  60   FGIKPDDVTMVGVLSAC  10
             GI+PD+  ++G+L  C
Sbjct  224  -GIEPDEYAVLGLLVCC  239


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE--FFKMMKDFG  55
            N ++  + K   +  A DVF+ +  +D+VSWN++++GY++ G  + A+    ++M+    
Sbjct  301  NTMVGGFVKLEDMEAARDVFDQMPRRDLVSWNSLLLGYSKKGCDQMAVRELVYEMLIVEK  360

Query  54   IKPDDVTMVGVLSACSHT  1
            + PD VTMV ++S  ++ 
Sbjct  361  VVPDRVTMVSLISGAANN  378


 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G  S   + NA+L MY KC   G A  VF+ +A+KD  SWNTM+ G+ +    + A +
Sbjct  259  KPGSSSNLILWNAVLDMYFKCRESGLAKRVFDMMAKKDTCSWNTMVGGFVKLEDMEAARD  318

Query  81   FFKMM  67
             F  M
Sbjct  319  VFDQM  323



>ref|XP_009143507.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like 
isoform X1 [Brassica rapa]
Length=481

 Score =   101 bits (251),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++S  ++ NAL++MYCKCG + +A  VF+   +KDVVSWN+MI GYA+HG   +A+E
Sbjct  230  KTGFKSCLHISNALISMYCKCGDLKDAFRVFDQFIDKDVVSWNSMIAGYAQHGLATQAIE  289

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ +M   G KPD +T +GVLS+C H
Sbjct  290  LFEVVMPKSGTKPDAITYLGVLSSCRH  316


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ S  YVG++L+ +Y   G +  A  VF  + EK+VVSW  MI G+A+       L+
Sbjct  128  KSGFTSDVYVGSSLVVLYRDSGEVDNARKVFVEMPEKNVVSWTAMISGFAQEWRVDICLK  187

Query  81   FF-KMMKDFGIKPDDVTMVGVLSACS  7
             + KM      +P+D T   +L+AC+
Sbjct  188  LYSKMRNSTSEQPNDYTFTALLNACT  213



>ref|XP_003632690.2| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, 
mitochondrial [Vitis vinifera]
Length=650

 Score =   102 bits (254),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEG--IAEKDVVSWNTMIIGYARHGFGKEA  88
            K  Y+   +V +AL+ MY KCG +G A  +F+    +++D+VSWN +I  YA HG+GKEA
Sbjct  380  KTVYQDSTFVVSALINMYSKCGELGTARKMFDDGMTSQRDLVSWNGIIAAYAHHGYGKEA  439

Query  87   LEFFKMMKDFGIKPDDVTMVGVLSACSH  4
            + FFK M+  G KPDDVT VG+LSACSH
Sbjct  440  INFFKEMRKSGFKPDDVTYVGLLSACSH  467


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF-KMMKDFGI  52
            N ++    + G +  A  +F  + +K+V+SW TMI G  + G  +EAL+ F +M+   G 
Sbjct  289  NTMITGLIQNGDLRRARKLFNEMPKKNVISWTTMITGCVQEGESEEALKIFSRMLSTNGA  348

Query  51   KPDDVTMVGVLSACSH  4
            KP+  T V VL ACS+
Sbjct  349  KPNQGTFVSVLGACSN  364


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 25/69 (36%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            A++A   K G I EA  +F+ + E++VVSWN MI GYA++    EAL+ F+ M +  +  
Sbjct  228  AMIAGLSKNGRIDEARLLFDRMPERNVVSWNAMITGYAQNLRLDEALDLFERMPERDLPS  287

Query  45   DDVTMVGVL  19
             +  + G++
Sbjct  288  WNTMITGLI  296


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKD  61
            N +++M  +CG I EA  +F+ + E+DV+SW  MI G +++G   EA   F  M +
Sbjct  196  NTVMSMLAQCGRIEEARRLFDRMPERDVISWTAMIAGLSKNGRIDEARLLFDRMPE  251



>emb|CBI30094.3| unnamed protein product [Vitis vinifera]
Length=614

 Score =   102 bits (253),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 62/88 (70%), Gaps = 2/88 (2%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEG--IAEKDVVSWNTMIIGYARHGFGKEA  88
            K  Y+   +V +AL+ MY KCG +G A  +F+    +++D+VSWN +I  YA HG+GKEA
Sbjct  344  KTVYQDSTFVVSALINMYSKCGELGTARKMFDDGMTSQRDLVSWNGIIAAYAHHGYGKEA  403

Query  87   LEFFKMMKDFGIKPDDVTMVGVLSACSH  4
            + FFK M+  G KPDDVT VG+LSACSH
Sbjct  404  INFFKEMRKSGFKPDDVTYVGLLSACSH  431


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/76 (37%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF-KMMKDFGI  52
            N ++    + G +  A  +F  + +K+V+SW TMI G  + G  +EAL+ F +M+   G 
Sbjct  253  NTMITGLIQNGDLRRARKLFNEMPKKNVISWTTMITGCVQEGESEEALKIFSRMLSTNGA  312

Query  51   KPDDVTMVGVLSACSH  4
            KP+  T V VL ACS+
Sbjct  313  KPNQGTFVSVLGACSN  328



>ref|XP_009124194.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04750, 
mitochondrial isoform X2 [Brassica rapa]
Length=651

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 64/87 (74%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G +   ++G+AL+ MYCKCGSI  A  VF+ +AEKDV  W TMI G A HG GK+ALE
Sbjct  393  RLGLQVDAFLGSALVDMYCKCGSIERAFKVFKTVAEKDVTLWTTMISGTAFHGNGKQALE  452

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ M++ G+KP+ VT++ VL+ACSH+
Sbjct  453  LFEEMQEEGVKPNKVTLLAVLTACSHS  479


 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 56/77 (73%), Gaps = 2/77 (3%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE-FFKMMKD  61
            Y+ N+L+ +Y + G +G A  VF+ + E+DV S+NTMI+GYA+ G+  EA++ ++KM+ D
Sbjct  164  YLWNSLVKVYMEFGDLGYAEKVFDEMPERDVSSFNTMIVGYAKKGYCLEAMKVYYKMVGD  223

Query  60   FGIKPDDVTMVGVLSAC  10
             GI+PD+  ++G+L  C
Sbjct  224  -GIEPDEYAVLGLLVCC  239


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE--FFKMMKDFG  55
            N ++  + K   +  A DVF+ +  +D+VSWN++++GY++ G  + A+    ++M+    
Sbjct  301  NTMVGGFVKLEDMEAARDVFDQMPRRDLVSWNSLLLGYSKKGCDQMAVRELVYEMLIVEK  360

Query  54   IKPDDVTMVGVLSACSHT  1
            + PD VTMV ++S  ++ 
Sbjct  361  VVPDRVTMVSLISGAANN  378


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 0/65 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G  S   + NA+L MY KC   G A  VF+ +A+KD  SWNTM+ G+ +    + A +
Sbjct  259  KPGSSSNLILWNAVLDMYFKCRESGLAKRVFDMMAKKDTCSWNTMVGGFVKLEDMEAARD  318

Query  81   FFKMM  67
             F  M
Sbjct  319  VFDQM  323



>ref|NP_178983.1| protein SLOW GROWTH 2 [Arabidopsis thaliana]
 sp|Q9SIT7.1|PP151_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g13600 
[Arabidopsis thaliana]
 gb|AAD22682.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06244.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=697

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E   +VGN+L+ MY KCG + E   VF  + E+D VSWN MIIG+A++G+G EALE
Sbjct  420  QSGEEDDIFVGNSLIDMYVKCGCVEEGYLVFRKMMERDCVSWNAMIIGFAQNGYGNEALE  479

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M + G KPD +TM+GVLSAC H
Sbjct  480  LFREMLESGEKPDHITMIGVLSACGH  505


 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ + S  Y+G+AL+ MY KCG++ +A  VF+ + +++VVSWN++I  + ++G   EAL+
Sbjct  180  KSPFLSDVYIGSALVDMYSKCGNVNDAQRVFDEMGDRNVVSWNSLITCFEQNGPAVEALD  239

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F+MM +  ++PD+VT+  V+SAC+
Sbjct  240  VFQMMLESRVEPDEVTLASVISACA  264


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            +   Y  N+++    K G + EA  +F  + E+D  +WN+M+ G+A+H   +EAL +F M
Sbjct  83   QRNIYTWNSVVTGLTKLGFLDEADSLFRSMPERDQCTWNSMVSGFAQHDRCEEALCYFAM  142

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G   ++ +   VLSACS
Sbjct  143  MHKEGFVLNEYSFASVLSACS  163


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 47/107 (44%), Gaps = 31/107 (29%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGI-------------------------------AEKD  148
            + NA + MY KC  I EA  +F+ +                               AE++
Sbjct  291  LSNAFVDMYAKCSRIKEARFIFDSMPIRNVIAETSMISGYAMAASTKAARLMFTKMAERN  350

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACS  7
            VVSWN +I GY ++G  +EAL  F ++K   + P   +   +L AC+
Sbjct  351  VVSWNALIAGYTQNGENEEALSLFCLLKRESVCPTHYSFANILKACA  397



>gb|KDP47022.1| hypothetical protein JCGZ_10749 [Jatropha curcas]
Length=632

 Score =   102 bits (253),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            Y+    + NALL MYCKCGS+ +A  VF  + EKDV+SW+TMI G A++G+ +EALE F+
Sbjct  291  YDQDLILNNALLDMYCKCGSLEDANSVFTRMVEKDVISWSTMIAGLAQNGYSREALELFE  350

Query  72   MMKDFGIKPDDVTMVGVLSACSH  4
             MK  GIKP+ +T++GVL ACSH
Sbjct  351  SMKVSGIKPNYITILGVLFACSH  373


 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G ES  +V +AL+ +Y K G    AL +F  +   D+V WN++I G+A++  G EAL 
Sbjct  189  KSGLESDVFVRSALIDIYSKWGECENALRIFNEMVTGDLVVWNSIIAGFAQNSDGDEALN  248

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             FK MK  G   D  T+  VL AC+
Sbjct  249  LFKRMKRAGFPADQSTLTSVLRACT  273


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = -2

Query  258  AGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEF  79
             GY+   ++ N LL MY K   + +A  +F+ + E++VVSW TMI  Y+      +ALEF
Sbjct  92   GGYQPEMFLINVLLNMYVKFNLLDDARALFDKMPERNVVSWTTMISAYSNAKLNDKALEF  151

Query  78   FKMMKDFGIKPDDVTMVGVLSAC  10
               M   G++P+  T   VL AC
Sbjct  152  LISMLREGVRPNMYTYSTVLRAC  174



>ref|XP_007204096.1| hypothetical protein PRUPE_ppa002338mg [Prunus persica]
 gb|EMJ05295.1| hypothetical protein PRUPE_ppa002338mg [Prunus persica]
Length=685

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G E   +VGN+L+ MY KCGSI +   VF+ + E+D VSWN MI+GYA++G+G EALE
Sbjct  399  QVGEEPDIFVGNSLIDMYMKCGSIEDGCRVFKSMLERDYVSWNAMIVGYAQNGYGTEALE  458

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G +PD VTM+GVL ACSH
Sbjct  459  IFRKMLASGEQPDHVTMIGVLCACSH  484


 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y S  Y+G+AL+ MY KCGS+  A  VF+ +++++ VSWN++I  Y ++G   EALE
Sbjct  159  KSCYSSDVYMGSALIDMYSKCGSVASAQRVFDWMSDRNTVSWNSLITCYEQNGPASEALE  218

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M D G KPD++T+  V+SAC+
Sbjct  219  VFVRMMDGGFKPDELTLASVVSACA  243


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 51/113 (45%), Gaps = 31/113 (27%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIA----------------------------  157
            Y     +GNAL+ MY KC  + +A  +F+G+                             
Sbjct  264  YRDDLVLGNALVDMYAKCNRLKQARWIFDGMPVRNVVSETSMVSGYAKAASVKAARLMFA  323

Query  156  ---EKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACS  7
               E+++VSWN +I GY ++G  +EA+  F ++K   + P   T   +L+AC+
Sbjct  324  KMMERNIVSWNALISGYTQNGENEEAVGLFLLLKRESVLPTHYTFGNLLNACA  376


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            +   +  N++++   K G I +A+ +F  + E D  SWN+M+ G+A+H   +EALE+F  
Sbjct  62   QRNTFTWNSIISTLTKLGFIDDAVQIFRLMPEPDQCSWNSMVSGFAQHDRFEEALEYFVK  121

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            +       ++ +    LSAC+
Sbjct  122  LHVEDFVLNEYSFGSALSACA  142


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/82 (26%), Positives = 46/82 (56%), Gaps = 4/82 (5%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K  + S  ++ N L+  Y KCG + +A  +F+ + +++  +WN++I    + GF  +A++
Sbjct  27   KTQFSSEIFIQNRLIDAYGKCGCLDDARKLFDKMPQRNTFTWNSIISTLTKLGFIDDAVQ  86

Query  81   FFKMMKDFGIKPDDVTMVGVLS  16
             F++M +    PD  +   ++S
Sbjct  87   IFRLMPE----PDQCSWNSMVS  104



>ref|XP_010278845.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, 
mitochondrial-like isoform X1 [Nelumbo nucifera]
 ref|XP_010278846.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, 
mitochondrial-like isoform X1 [Nelumbo nucifera]
 ref|XP_010278847.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, 
mitochondrial-like isoform X1 [Nelumbo nucifera]
 ref|XP_010278848.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, 
mitochondrial-like isoform X1 [Nelumbo nucifera]
 ref|XP_010278849.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, 
mitochondrial-like isoform X1 [Nelumbo nucifera]
 ref|XP_010278850.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, 
mitochondrial-like isoform X1 [Nelumbo nucifera]
Length=703

 Score =   102 bits (254),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y+S  ++ +AL  MY KCG + +A  VF+    KDVV WN+MI GYA+HG G+EAL+
Sbjct  358  KSQYDSEVFIASALTTMYVKCGDLVKAKRVFDRFNPKDVVMWNSMITGYAQHGLGEEALQ  417

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  M   G+ PDDVT VGVLSACS++
Sbjct  418  VFHEMCSVGLSPDDVTFVGVLSACSYS  444


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA++    + G + +A  VF+ + EKD  SW+ +I  Y R+G   EAL  F +M++ G +
Sbjct  268  NAMIVGLGQNGRLVKAKQVFDRMREKDDGSWSAIIKAYERNGHELEALNMFVLMQEAGFR  327

Query  48   PDDVTMVGVLSACS  7
            P+  +++ VL+ C+
Sbjct  328  PNYPSLISVLTVCT  341



>ref|XP_006477459.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like 
[Citrus sinensis]
Length=580

 Score =   102 bits (253),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GY S   + N+L+AMY KCGS+G A +VF+G+ EKDVVSW+ MI G A +G G++A+E F
Sbjct  238  GYGSKMNLCNSLIAMYSKCGSLGMAFEVFKGMPEKDVVSWSAMISGLAMNGHGRDAIEAF  297

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
              M+  G+ PDD T  GVLSACSH
Sbjct  298  GAMQRAGVFPDDQTFTGVLSACSH  321


 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 49/88 (56%), Gaps = 2/88 (2%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + GY+    +   L+ +Y       EA  +F+ I ++D V+WN +I  Y R+   ++AL 
Sbjct  133  RDGYQLDSQLMTTLMDLYSTFEKSFEACKLFDEIPQRDTVAWNVLISCYIRNQRTRDALC  192

Query  81   FFKMM--KDFGIKPDDVTMVGVLSACSH  4
             F  +  ++ G KPDDVT + VL AC+H
Sbjct  193  LFDNLNREESGCKPDDVTCLLVLQACAH  220



>ref|XP_007043099.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOX98930.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=642

 Score =   102 bits (253),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            + NALL MYCKCGS+ +A  VFE + ++DV+SW+TMI G A++G+ +EAL+FF +MK  G
Sbjct  307  LNNALLDMYCKCGSLEDAKSVFERMVDRDVISWSTMIAGLAQNGYSREALKFFDLMKASG  366

Query  54   IKPDDVTMVGVLSACSH  4
            +KP+ +T++GVL ACSH
Sbjct  367  VKPNYITILGVLFACSH  383


 Score = 65.1 bits (157),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G ES  +V +AL+ +Y K   + +A+ VF  +  +D V WN++I G A++  G EAL 
Sbjct  199  KVGLESDVFVRSALIDVYSKLDKLKDAVCVFNEMQTRDYVVWNSIIGGLAQNSDGDEALN  258

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             FK MK  G   D  T+  VL AC+
Sbjct  259  QFKRMKRAGFSADQSTLTSVLRACT  283


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G++   ++ N L++MY K   + +A  +F+ + E++VV+W TMI  YA      +ALEF 
Sbjct  103  GHQPKTFLVNILISMYVKFNLLEQARALFDQMPERNVVTWTTMISAYANAKLSVKALEFL  162

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
             +M   G+ P+  T   VL AC
Sbjct  163  VLMLREGVLPNTYTFSSVLRAC  184



>emb|CDP11486.1| unnamed protein product [Coffea canephora]
Length=576

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
             +  Y+ NA++ MY KCGS+ EA  VF+ ++ +DV SWN MI+GY  HGFG EAL+ F +
Sbjct  318  HNNIYINNAVMDMYAKCGSLREARLVFDKMSHRDVASWNIMIMGYGMHGFGNEALDMFHI  377

Query  69   MKDFGIKPDDVTMVGVLSACSH  4
            M    +KPD+VT VGVLSACSH
Sbjct  378  MSKTELKPDEVTFVGVLSACSH  399


 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY+SG  V NAL+ MY KC  + +A  VF+   EKD+ SWN++I  + + G  +E L 
Sbjct  207  KMGYDSGVAVANALIDMYGKCQFVMDASKVFDSTLEKDIFSWNSIICVHGQCGEHEETLR  266

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
              + M   G++PD VT+  VL AC+H
Sbjct  267  QLENMLHAGVQPDFVTVASVLPACAH  292


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIG-EALDVFEGIAEKD-VVSWNTMIIGYARHGFGKEA  88
            K G E   YVG+AL+  Y + G +  EAL VF+ + E+D VV WN MI G+A+ G   + 
Sbjct  104  KLGLEFDLYVGSALVHGYLRVGLLSSEALKVFDELPERDDVVIWNAMINGFAQLGEIDKP  163

Query  87   LEFFKMMKDFGIKPDDVTMVGVLSACS  7
            L  F+ M +  + P+  ++ G+LS  +
Sbjct  164  LGIFRRMVENRVVPNRFSVTGILSVLA  190


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 44/85 (52%), Gaps = 2/85 (2%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCG-SIGEALDVFEGIAE-KDVVSWNTMIIGYARHGFGKEALEF  79
            + S      +L+ MY KC  SI +AL +F      ++V ++N +I G+  H    + LEF
Sbjct  7    FHSSPLSATSLINMYSKCSISISDALSIFLASPHCQNVYAYNAIIAGFISHDLPNKVLEF  66

Query  78   FKMMKDFGIKPDDVTMVGVLSACSH  4
            +  M+  G+ PD  T   ++ AC H
Sbjct  67   YFNMRMVGLIPDKFTFPCLIKACCH  91



>ref|XP_010278851.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, 
mitochondrial-like isoform X2 [Nelumbo nucifera]
 ref|XP_010278852.1| PREDICTED: pentatricopeptide repeat-containing protein At1g56690, 
mitochondrial-like isoform X2 [Nelumbo nucifera]
Length=662

 Score =   102 bits (253),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 46/87 (53%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y+S  ++ +AL  MY KCG + +A  VF+    KDVV WN+MI GYA+HG G+EAL+
Sbjct  317  KSQYDSEVFIASALTTMYVKCGDLVKAKRVFDRFNPKDVVMWNSMITGYAQHGLGEEALQ  376

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  M   G+ PDDVT VGVLSACS++
Sbjct  377  VFHEMCSVGLSPDDVTFVGVLSACSYS  403


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA++    + G + +A  VF+ + EKD  SW+ +I  Y R+G   EAL  F +M++ G +
Sbjct  227  NAMIVGLGQNGRLVKAKQVFDRMREKDDGSWSAIIKAYERNGHELEALNMFVLMQEAGFR  286

Query  48   PDDVTMVGVLSACS  7
            P+  +++ VL+ C+
Sbjct  287  PNYPSLISVLTVCT  300



>ref|XP_010437793.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 
[Camelina sativa]
Length=997

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +VG +L+ MY KCGSI +A  +F+ I  +++ +WN M++G A+HG GKEAL+ FK MK  
Sbjct  661  FVGTSLVDMYAKCGSIDDAYSLFKRIQMRNIAAWNAMLVGLAQHGEGKEALQLFKQMKSL  720

Query  57   GIKPDDVTMVGVLSACSHT  1
            G+KPD VT +GVLSACSH+
Sbjct  721  GVKPDKVTFIGVLSACSHS  739


 Score = 73.9 bits (180),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G E    V N+L+ MYCK   IG A  VF  ++E+D++SWN++I G+A+ G   EA+ 
Sbjct  350  KLGLEVMLTVANSLINMYCKLRKIGFARRVFHNMSERDLISWNSVIAGFAQSGLEMEAVC  409

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  +   G+ PD  TM  VL A S
Sbjct  410  LFMQLLRCGLTPDQYTMTSVLKAAS  434


 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 43/85 (51%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY    +V + +L MY KCG +  A   F  I   D V+W TMI G   +G  + A  
Sbjct  552  KSGYHLDLWVSSGILDMYVKCGDMSAAQLAFNTIPVPDDVAWTTMISGCIENGEEERAYH  611

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M+  G+ PD+ T+  +  A S
Sbjct  612  VYSQMRLMGVLPDEFTIATLAKASS  636


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 48/83 (58%), Gaps = 7/83 (8%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE-------F  79
            ++ N L++MY KCGS+  A  VF+ + E+D+VSWN+++  YA+   G  A+E        
Sbjct  80   FLVNNLISMYSKCGSLTYARRVFDLMPERDLVSWNSILAAYAQSSEGAAAVENIEEAYLL  139

Query  78   FKMMKDFGIKPDDVTMVGVLSAC  10
            F++++   +    +T+  +L  C
Sbjct  140  FRILRQDVVYTSRMTLAPMLKLC  162


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +   +V  AL+ +Y K G + E   +FE ++ +DVV WN M+  Y   GF +EA++
Sbjct  180  KIGLDGDEFVAGALVNIYLKFGKVKEGKVLFEEMSYRDVVLWNLMLKAYLEMGFKEEAID  239

Query  81   FFKMMKDFGIKPDDVT  34
                    G+ P+++T
Sbjct  240  LSSEFLRSGLHPNEIT  255


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 1/76 (1%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +V  AL+  Y +   + EA  +FE  ++ D V+WN M+ GY +   G + L+ F +M   
Sbjct  460  FVSTALIDAYSRNRCMTEAEVLFER-SKFDPVAWNAMMAGYTQSHDGLKTLKLFALMHKQ  518

Query  57   GIKPDDVTMVGVLSAC  10
            G + DD T+  VL  C
Sbjct  519  GERSDDFTLATVLKTC  534



>ref|XP_010447274.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like 
[Camelina sativa]
Length=998

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +VG +L+ MY KCGSI +A  +F+ I  +++ +WN M++G A+HG GKEAL+ FK MK  
Sbjct  662  FVGTSLVDMYAKCGSIDDAYSLFKRIQMRNIAAWNAMLVGLAQHGEGKEALQLFKQMKSL  721

Query  57   GIKPDDVTMVGVLSACSHT  1
            G+KPD VT +GVLSACSH+
Sbjct  722  GVKPDKVTFIGVLSACSHS  740


 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +    V N+L+ MY K   IG A +VF  ++E+D++SWN++I G+ + G   EA+ 
Sbjct  351  KLGLDVMLTVANSLINMYSKLRKIGFAREVFYNMSERDLISWNSVIAGFVQSGLEMEAVC  410

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  +   G+ PD  TM  VL A S
Sbjct  411  LFMQLLRCGLTPDQYTMTSVLKAAS  435


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 43/85 (51%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY    +V + +L MY KCG +  A   F  I   D V+W TMI G   +G  + A  
Sbjct  553  KSGYHLDLWVSSGILDMYVKCGDMSAAQLAFNTIPVPDDVAWTTMISGCIENGEEERAYH  612

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M+  G+ PD+ T+  +  A S
Sbjct  613  VYSQMRLMGVLPDEFTIATLAKASS  637


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 48/83 (58%), Gaps = 7/83 (8%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE-------F  79
            ++ N L++MY KCGS+  A  VF+ + E+D+VSWN+++  YA+   G  A+E        
Sbjct  81   FLVNNLISMYSKCGSLTYARRVFDVMPERDLVSWNSVLAAYAQSFEGAAAVENIEEAFLL  140

Query  78   FKMMKDFGIKPDDVTMVGVLSAC  10
            F++++   +    +T+  +L  C
Sbjct  141  FRILRQDVVYTSRMTLAPMLKLC  163


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 41/76 (54%), Gaps = 1/76 (1%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +V  AL+  Y +   + EA  +FE  ++ D V+WN M+ GY +   G + L+ F +M   
Sbjct  461  FVSTALIDAYSRNRCMTEAEVLFER-SKFDPVAWNAMMAGYTQSHDGLKTLKLFALMHKQ  519

Query  57   GIKPDDVTMVGVLSAC  10
            G + DD T+  VL  C
Sbjct  520  GERSDDFTLATVLKTC  535



>emb|CDY28284.1| BnaC03g66750D [Brassica napus]
Length=988

 Score =   102 bits (255),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K  +    +VG +L+ MY KCGSI +A  +F+ I  +++ +WN M++G A+HG GKEAL+
Sbjct  644  KLNFSGDPFVGTSLVDMYAKCGSIDDAFSLFKRIEMRNIAAWNAMLVGLAQHGEGKEALQ  703

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ M+  GIKPD VT +GVLSACSH+
Sbjct  704  LFEQMRSLGIKPDKVTFIGVLSACSHS  730


 Score = 68.2 bits (165),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++    V N+L+ MYCK   +G A  VF  ++E+D +SWN++I G+A+ G   EA+ 
Sbjct  345  KLGFDLMLTVANSLINMYCKLRKVGYARTVFNSMSERDSISWNSVISGFAQSGLEVEAVC  404

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  +   G+ PD  T+  VL A S
Sbjct  405  LFMELLRCGLTPDHYTLTSVLKATS  429


 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY    +V + +L MY KCG +  A   F  IA  D V+W TMI G   +G  + A  
Sbjct  543  KSGYNLDLWVSSGVLDMYVKCGDMKAAHVAFNCIAAPDDVAWTTMISGCIENGEEERAFH  602

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M+  G+ PD+ T+  +  A S
Sbjct  603  VYSQMRLMGVLPDEFTIATLAKASS  627


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/77 (34%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S  +V   L+ +Y K G + E   +FE +  +DVV WN M+  Y   GF +EA+E
Sbjct  182  KIGLDSDEFVAGGLVNIYLKFGKVKEGRVLFEEMPGRDVVLWNLMLKAYLDMGFKEEAVE  241

Query  81   FFKMMKDFGIKPDDVTM  31
                    G+ P+ +T+
Sbjct  242  LSSAFHKSGLHPNGITL  258


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/78 (31%), Positives = 42/78 (54%), Gaps = 5/78 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARH-----GFGKEALEFFKMMK  64
            N L+ MY KCGS+  A  VF+ + E+D+VSWN+++  YA+         +E    F+ ++
Sbjct  87   NNLITMYSKCGSLTHARRVFDKMPERDLVSWNSILAAYAQSYEHVIDSTEEGFVLFRSLR  146

Query  63   DFGIKPDDVTMVGVLSAC  10
               +    +T+  +L  C
Sbjct  147  QNVVFTSRMTLAPLLKLC  164



>ref|XP_006489927.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33680-like 
isoform X2 [Citrus sinensis]
Length=723

 Score =   102 bits (254),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY +   VGNAL+ MY KCGSI  A  +F+GI+++D+VSWN M+  YA HG GK AL 
Sbjct  458  KTGYAADVIVGNALITMYAKCGSIDGAFQIFKGISDRDIVSWNAMLSAYALHGLGKGALL  517

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  G  PDD++++GVL AC ++
Sbjct  518  LFEEMKREGFAPDDISILGVLQACIYS  544


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 31/84 (37%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+E+  +VG +L++MY   G   EA +VF G+A KDV   N MI+ Y + G  + A  
Sbjct  187  KSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFH  246

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
             F  +     +P+D T   V+S C
Sbjct  247  VFVHLLSSDFEPNDYTFTNVISVC  270


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            VGNA++ MY K G   EA  +F+ I+E++++SW  +I GY R G G +A+  F    D G
Sbjct  297  VGNAIVTMYGKHGMSEEAERMFDAISERNLISWTALISGYVRSGHGGKAINGFLEFLDLG  356

Query  54   IKPDDVTMVGVLSACS  7
            I  D   +  V+  CS
Sbjct  357  ICCDSSCLATVIDGCS  372



>gb|KFK36619.1| hypothetical protein AALP_AA4G147200 [Arabis alpina]
Length=492

 Score =   100 bits (250),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S  ++ NAL++MYCKCG + +A  +F+    KDVVSWN+MI GYA+HG   +A+E
Sbjct  241  QMGFKSYLHISNALISMYCKCGDLKDAFRIFDQFLNKDVVSWNSMIAGYAQHGLATQAIE  300

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ MM   G KPD +T +GVLS+C H
Sbjct  301  LFEVMMPKSGTKPDAITYLGVLSSCRH  327


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ S  YVG++L+ +Y   G +  A  VF+ + E++VVSW  MI G+A+       L+
Sbjct  140  KSGFVSDVYVGSSLVVLYRDSGDLDNAHKVFDEMPERNVVSWTAMISGFAQEWRVDICLK  199

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M++    P+D T   +LSAC+
Sbjct  200  LYSKMRNSTSDPNDYTFTALLSACT  224



>ref|XP_010435864.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like 
isoform X1 [Camelina sativa]
Length=710

 Score =   102 bits (253),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY +   VGNAL+ MY K GSI +A   F GIA KD+V+WNT+I G++ HG GKEALE
Sbjct  366  KSGYRNHLMVGNALVNMYAKSGSIEDARKTFSGIAFKDIVTWNTLICGFSHHGLGKEALE  425

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  M   G  P+ +T +G+L ACSHT
Sbjct  426  AFDRMMYAGELPNRITFIGILQACSHT  452


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG-I  52
            N+L+ +Y KCG    A  +F+ + +++VVSW  M+ GY   GF  E L+ FK M   G  
Sbjct  73   NSLINLYVKCGENVRARKLFDLMPDRNVVSWCAMMKGYQNSGFDFEVLKLFKSMFFSGES  132

Query  51   KPDDVTMVGVLSACS  7
            +P++     VL +CS
Sbjct  133  RPNEFVATVVLKSCS  147



>emb|CBI38165.3| unnamed protein product [Vitis vinifera]
Length=654

 Score =   102 bits (253),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            +S  +VGN+L+ MY KCGSI +   VFE + E+D VSWN +I+GYA++G+G EAL+ F+ 
Sbjct  389  KSDIFVGNSLIDMYMKCGSIEDGSRVFEKMKERDCVSWNAIIVGYAQNGYGAEALQIFRK  448

Query  69   MKDFGIKPDDVTMVGVLSACSH  4
            M   G KPD VTM+GVL ACSH
Sbjct  449  MLVCGEKPDHVTMIGVLCACSH  470


 Score = 89.4 bits (220),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y +  Y+G+AL+ MY KCGS+  A +VF G+ E+++V+WN++I  Y ++G   EALE
Sbjct  175  KSRYSTDVYMGSALIDMYSKCGSVACAEEVFSGMIERNLVTWNSLITCYEQNGPASEALE  234

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M D G++PD+VT+  V+SAC+
Sbjct  235  VFVRMMDSGLEPDEVTLASVVSACA  259


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/105 (29%), Positives = 48/105 (46%), Gaps = 31/105 (30%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIA-------------------------------EKD  148
            +GNAL+ MY KC  + EA  VF+ ++                               +++
Sbjct  286  LGNALVDMYAKCSKVNEARRVFDRMSIRNVVSETSMVSGYARAASVKAARFMFSKMTQRN  345

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSA  13
            VVSWN +I GY ++G  +EAL  F+++K   I P   T   +L +
Sbjct  346  VVSWNALIAGYTQNGENEEALRLFRLLKRESIWPTHYTFGNLLKS  390


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +  N+L+++  K G + EA  +F  + E D  SWN+M+ G+A+H   +E+LE+F  M   
Sbjct  82   FTWNSLISVLTKSGFLDEAARLFGSMPEPDQCSWNSMVSGFAQHDRFEESLEYFVKMHRE  141

Query  57   GIKPDDVTMVGVLSACS  7
                ++ +    LSAC+
Sbjct  142  DFLLNEYSFGSALSACA  158



>ref|XP_009804752.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana sylvestris]
 ref|XP_009804753.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana sylvestris]
 ref|XP_009804754.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana sylvestris]
 ref|XP_009804755.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana sylvestris]
 ref|XP_009804757.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana sylvestris]
 ref|XP_009804758.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana sylvestris]
 ref|XP_009804759.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Nicotiana sylvestris]
Length=659

 Score =   102 bits (253),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            ++    + NALL MYCKCG++ +A  +F  + EKDV+SW+TMIIGYA++GF ++ALE  K
Sbjct  318  FQRDLILNNALLDMYCKCGNLEDAHKIFTRMVEKDVISWSTMIIGYAQNGFSRKALELLK  377

Query  72   MMKDFGIKPDDVTMVGVLSACSH  4
             MK  GIKP+ +T++GVL ACSH
Sbjct  378  EMKVSGIKPNYITVLGVLFACSH  400


 Score = 65.1 bits (157),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GYE   ++ N L+ MY K   + EA  +F+ +++++VVSW TMI  Y+      +ALEF 
Sbjct  120  GYEPKTFLVNTLINMYVKFNMLDEAQALFDQMSDRNVVSWTTMIAAYSSAKINNKALEFL  179

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
             +M   G++P+  T   VL AC
Sbjct  180  ILMLRDGVRPNMFTYSSVLRAC  201


 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G E   +V +AL+ +Y K G +  AL  F  +   D+V WN++I G+A++  G +AL 
Sbjct  216  KVGLEFDVFVRSALIDVYSKMGQLECALCTFNEMVTGDLVVWNSIIGGFAQNSDGDDALT  275

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             FK MK  G   D  T+  VL AC+
Sbjct  276  LFKRMKRAGFSADQSTLTSVLRACT  300



>gb|EYU25211.1| hypothetical protein MIMGU_mgv1a001568mg [Erythranthe guttata]
Length=794

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+ES   + NAL++MY +CGSI     VF  + +++++SW ++I G+A+HGF K ALE
Sbjct  450  KAGFESNLCICNALISMYTRCGSIEAGFQVFNEMEDRNIISWTSIITGFAKHGFAKRALE  509

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             +K M D G++P++VT V VLSACSH
Sbjct  510  LYKQMLDSGVEPNEVTFVAVLSACSH  535


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 46/82 (56%), Gaps = 0/82 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G  +   VGN+L++MY KC  I +A   FE + EK++VS+N ++ GY R+    EA E
Sbjct  349  KLGLATVSVVGNSLISMYSKCDRIEDARKAFEFLFEKNLVSYNALVDGYTRNLDSDEAFE  408

Query  81   FFKMMKDFGIKPDDVTMVGVLS  16
             F  +++     D  T   +LS
Sbjct  409  LFNEIENSSAGADAFTFASLLS  430



>ref|XP_007162705.1| hypothetical protein PHAVU_001G173400g [Phaseolus vulgaris]
 gb|ESW34699.1| hypothetical protein PHAVU_001G173400g [Phaseolus vulgaris]
Length=763

 Score =   102 bits (254),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G      V N L+ MY KCGS+  A DVF+     D+VSW+++I+GYA+ G G EAL+
Sbjct  499  KSGLVVDVSVSNRLIDMYAKCGSLKHARDVFDSTQNPDIVSWSSLIVGYAQFGLGHEALD  558

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+MMK+ G++P++VT +GVLSACSH
Sbjct  559  LFRMMKNLGVQPNEVTYLGVLSACSH  584


 Score = 59.7 bits (143),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEK-DVVSWNTMIIGYARHGFGKEAL  85
            K G ++   V N+LL MY KC ++ +A +VF  +  + ++VSWN ++    +H    EA 
Sbjct  397  KIGLDNEAAVCNSLLTMYTKCSNLHDAFNVFTYLGRRANLVSWNAILSACLQHKHAGEAF  456

Query  84   EFFKMMKDFGIKPDDVTMVGVLSACS  7
              FK+M     KPD++T+  +L  C+
Sbjct  457  RLFKLMLFSENKPDNITITTILGTCA  482


 Score = 59.3 bits (142),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 1/85 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY+      NAL++MY K G I  A  VF  I+ KD++S+ +MI G+ + G   EAL 
Sbjct  194  KSGYDHHLIAQNALISMYTKFGQIAHASGVFAMISTKDLISYASMITGFTQLGNDIEALY  253

Query  81   FFK-MMKDFGIKPDDVTMVGVLSAC  10
             F+ M++    +P++     V SAC
Sbjct  254  LFRDMLRQSVYQPNEFIFGSVFSAC  278


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G     + G +L  MY K G +  A  VF  I   D+VSWN +I  ++  G   EA+ 
Sbjct  296  KFGLGRNIFAGCSLCDMYAKFGFLPSAERVFYQIESPDLVSWNAIIAAFSDSGHVNEAVS  355

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
            FF  M   G+ PD++T + +L  C
Sbjct  356  FFCQMMHTGLMPDNITFLSLLCPC  379


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 39/73 (53%), Gaps = 0/73 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L MY KCGS  +A  +F+ +  ++VVSW  MI GY ++    +A+  +  M   G  
Sbjct  104  NHILNMYGKCGSSKDARKLFDAMQLRNVVSWTIMISGYMQNDQENDAITMYIQMLRSGYL  163

Query  48   PDDVTMVGVLSAC  10
            PD  T   ++  C
Sbjct  164  PDQFTFGSIIKVC  176



>ref|XP_009614785.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 
[Nicotiana tomentosiformis]
Length=624

 Score =   101 bits (252),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 43/85 (51%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G++    + NAL+ MY +CG I +A +VF+G+AEKDVVSW+ MI G A +G+G++A+E F
Sbjct  282  GFDKAINICNALITMYSRCGCIEKAFEVFKGMAEKDVVSWSAMISGLASNGYGRDAIEAF  341

Query  75   KMMKDFGIKPDDVTMVGVLSACSHT  1
              M+  G+ PDD T  GVL+ACSH+
Sbjct  342  SEMQRSGVSPDDQTFTGVLNACSHS  366


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 26/87 (30%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+ S   +   L+  Y       EA  VF+ ++ +D V+WN +I  Y R+   ++AL 
Sbjct  178  RDGHHSDGRLLTTLMDFYSSNEKYSEACKVFDEMSHRDTVAWNVLISCYLRNRRTRDALR  237

Query  81   FFKMMKDFG-IKPDDVTMVGVLSACSH  4
             F M++     +PD+VT + +L AC++
Sbjct  238  VFDMIRSSSECQPDEVTCLLLLQACAN  264



>ref|XP_008805605.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, 
mitochondrial [Phoenix dactylifera]
Length=715

 Score =   102 bits (253),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 44/78 (56%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            VG++L++MY KCG IG+A  VF+ +A KD+VSWN +I  YA HG G+EA++ F+ MK  G
Sbjct  454  VGSSLISMYSKCGEIGKARKVFDLLARKDLVSWNGIIAAYAHHGNGREAVQLFEEMKRSG  513

Query  54   IKPDDVTMVGVLSACSHT  1
             +P+DVT VG+LSACSH+
Sbjct  514  FRPNDVTYVGLLSACSHS  531


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/56 (41%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKD  61
            NA+++ Y +   +GEALD+F+ +  +D+ SWNTMI G+ ++G  K A E F  M +
Sbjct  324  NAMISGYAQNRRLGEALDLFDKMPSRDIPSWNTMITGFIQNGDLKRAQELFNKMDE  379


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  + + G +  A ++F  + E++VV+W TMI GY + G  + A + F  M   GI 
Sbjct  355  NTMITGFIQNGDLKRAQELFNKMDERNVVTWTTMITGYIQDGQNEMASKIFSEMLAAGIM  414

Query  48   PDDVTMVGVLSACSH  4
            P+    V VL A S+
Sbjct  415  PNQGAFVSVLDAVSN  429


 Score = 46.6 bits (109),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 24/69 (35%), Positives = 39/69 (57%), Gaps = 0/69 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            A++A   + G + EA  VF+ + E++V+SWN MI GYA++    EAL+ F  M    I  
Sbjct  294  AMIAGLSQNGRVDEARTVFDQMPERNVISWNAMISGYAQNRRLGEALDLFDKMPSRDIPS  353

Query  45   DDVTMVGVL  19
             +  + G +
Sbjct  354  WNTMITGFI  362



>ref|XP_010435865.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like 
isoform X2 [Camelina sativa]
Length=585

 Score =   101 bits (252),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY +   VGNAL+ MY K GSI +A   F GIA KD+V+WNT+I G++ HG GKEALE
Sbjct  241  KSGYRNHLMVGNALVNMYAKSGSIEDARKTFSGIAFKDIVTWNTLICGFSHHGLGKEALE  300

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  M   G  P+ +T +G+L ACSHT
Sbjct  301  AFDRMMYAGELPNRITFIGILQACSHT  327



>ref|XP_010243684.1| PREDICTED: pentatricopeptide repeat-containing protein At2g42920, 
chloroplastic [Nelumbo nucifera]
Length=547

 Score =   101 bits (251),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 42/83 (51%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E+   V  A++ MYCKCG + +AL VFE I+EK +  WN+MI+G A +G GKEA++FF  
Sbjct  287  ETNSIVSTAIIDMYCKCGCVDKALQVFETISEKGLSCWNSMILGLAINGCGKEAIQFFSR  346

Query  69   MKDFGIKPDDVTMVGVLSACSHT  1
            ++  G++PDDV+ +GVL+ACSH+
Sbjct  347  LQSSGLRPDDVSFIGVLTACSHS  369


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N+++    K G I ++  +F+ + ++  +SWN+MI GY R+G  KEA++ F  M+  GIK
Sbjct  193  NSMITGLAKFGEIDQSRRLFDKMPKRSTISWNSMISGYVRNGNFKEAMDLFDEMQKEGIK  252

Query  48   PDDVTMVGVLSACS  7
            P   T+V +L+ACS
Sbjct  253  PSGFTIVSLLNACS  266



>ref|XP_011098682.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 
[Sesamum indicum]
Length=597

 Score =   101 bits (252),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++ Y+ G  V NAL+ MYCKCGS+  A  +F  +  KD+VSWN MI G A HG G++AL+
Sbjct  338  ESRYKCGALVSNALIDMYCKCGSLNRAWSIFSAMGRKDIVSWNAMIHGLAMHGHGRKALQ  397

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             +  MK  G  PD VT VGVL+ACSH
Sbjct  398  LYDRMKQEGFAPDKVTFVGVLAACSH  423


 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  210  YCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTM  31
            Y K G I  A  +F+ + +K++V+W  MI GYA  G  KEA   + +M++  +KPDD T 
Sbjct  254  YAKTGDIEMAKVLFDNMPDKNLVAWTIMISGYAEKGLAKEAAGLYDLMEEARLKPDDATF  313

Query  30   VGVLSACSHT  1
            V +LSA + +
Sbjct  314  VSILSASAES  323


 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 43/85 (51%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+      +V   L++    C  +  A++VF+ I   +    NT+I  Y R+    +A E
Sbjct  44   KSNLHKDPFVAPKLISALSLCQQMSLAINVFDQIQNPNAHLCNTLIKAYIRNSEPDKAFE  103

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F+ M+  GI PD+ T + +L ACS
Sbjct  104  VFREMRWSGIFPDNYTYLFLLKACS  128


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIG--EALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            S  +V N+L+  Y KCG IG   A  VF+ + EKDVV++N+MI G  + G  K+A + F 
Sbjct  147  SDLFVPNSLIDAYSKCGLIGVKAAKIVFDVMEEKDVVTYNSMISGLVKAGELKQAKKLFD  206

Query  72   MM  67
             M
Sbjct  207  EM  208



>ref|XP_004981445.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like 
isoform X1 [Setaria italica]
 ref|XP_004981446.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like 
isoform X2 [Setaria italica]
 ref|XP_004981447.1| PREDICTED: pentatricopeptide repeat-containing protein At2g02980-like 
isoform X3 [Setaria italica]
Length=605

 Score =   101 bits (252),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S   V  AL+ MY KCGS+ +A+ VF+G+  +D  +W+ MI+ YA HG+G+EA+ 
Sbjct  261  KIGLDSLVKVSTALIDMYAKCGSLEDAVAVFQGMESRDKQAWSVMIVAYANHGYGREAIL  320

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  GIKPDD+T +GVL ACSH+
Sbjct  321  LFEEMKKQGIKPDDITFLGVLYACSHS  347


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            YV   L+ MY +CG +  A  +F+ +    VVS+N MI    R     EAL  F+ M+  
Sbjct  168  YVRPTLINMYAECGDVRAARAMFDRMEGDCVVSYNAMIAAAVRSSRPGEALVLFREMQAK  227

Query  57   GIKPDDVTMVGVLSACS  7
            G+KP  VT++  LSAC+
Sbjct  228  GLKPTSVTVISALSACA  244



>ref|XP_010111526.1| hypothetical protein L484_001076 [Morus notabilis]
 gb|EXC31089.1| hypothetical protein L484_001076 [Morus notabilis]
Length=625

 Score =   101 bits (252),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 43/78 (55%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +VG AL+ MY KCGS+ +A  VF+ I +KDV++WNTMI+GYA HGF ++AL+ F  M   
Sbjct  289  HVGTALIDMYSKCGSLEDARLVFDRIRDKDVIAWNTMIVGYAMHGFSQDALQLFNEMCRI  348

Query  57   GIKPDDVTMVGVLSACSH  4
            G +P D+T +GVLSAC+H
Sbjct  349  GYQPTDITFIGVLSACAH  366


 Score = 71.6 bits (174),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            A++  Y K G + EA  +F+ + ++DVV WN MI GYA+HG   E+L  F+ M    ++P
Sbjct  192  AMITCYAKHGKVDEARALFDRMGDRDVVCWNVMIDGYAQHGMPNESLFLFRKMLAAKVRP  251

Query  45   DDVTMVGVLSACSH  4
            ++VT++ VLSAC  
Sbjct  252  NEVTVLAVLSACGQ  265



>ref|XP_008776808.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230 
[Phoenix dactylifera]
Length=514

 Score =   100 bits (250),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G++   YVGN L+ MY KCG I +A+ VF+G+  +D+++WN+MI G A HG   EALE F
Sbjct  255  GFKGNVYVGNGLIDMYAKCGCIEDAVSVFDGMETRDLITWNSMIGGLAMHGHSMEALELF  314

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
              MKD G KPD +T+VGVLSAC H
Sbjct  315  DRMKDTGEKPDGITLVGVLSACVH  338


 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE-FFKMMKDFGI  52
            N +L  Y   G +     +FE + E++V SWN +I G+ARHG   E L+   +M+    +
Sbjct  162  NTILLGYANGGDLEACERLFEEMPERNVFSWNALIGGFARHGRYYEVLDALTRMLGLSDV  221

Query  51   KPDDVTMVGVLSACSH  4
            KP+D T+V VLSACS 
Sbjct  222  KPNDATLVMVLSACSR  237


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/101 (31%), Positives = 42/101 (42%), Gaps = 31/101 (31%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIG-------------------------------EALD  175
            K G+E+  +VG AL+ MY   G +G                                A +
Sbjct  58   KTGFETNAFVGPALIDMYSDRGVVGAAHRVFSQMPVKNVVAWTAVVAAFLSAGDVKSARE  117

Query  174  VFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGI  52
            +F+   E+DV+ WNTM+ GY RHG    A E F  M D  I
Sbjct  118  LFDQAVERDVILWNTMVCGYTRHGDMAAAQELFVRMPDKDI  158



>ref|XP_010092936.1| hypothetical protein L484_018873 [Morus notabilis]
 gb|EXB52989.1| hypothetical protein L484_018873 [Morus notabilis]
Length=713

 Score =   102 bits (253),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++ ++   YV + L+ MY KCG++ +A  VF+  A KDVV WNTMI GYA+HG G+EAL+
Sbjct  368  RSHFDHDVYVVSVLITMYVKCGNLEKAKLVFDSFAPKDVVMWNTMITGYAQHGLGEEALQ  427

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F  M   G+ PDD+T +GVLSACS+T
Sbjct  428  VFHDMCSVGLAPDDITFIGVLSACSYT  454


 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA++  + + G +G+A+ VF+ + EKD  +W+ MI  Y R GF  +ALEFF  M+  G++
Sbjct  278  NAMILGFGQIGEVGKAMWVFDQMREKDEGTWSAMIKVYERKGFELQALEFFSSMQRQGVR  337

Query  48   PDDVTMVGVLSACS  7
            P+  T++ VLS C+
Sbjct  338  PNYPTLISVLSVCA  351


 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/70 (33%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NAL+  Y K G + +A  VF+ + E++V+SW  M+ GY + G   EA   F  M +  + 
Sbjct  92   NALIGGYVKNGMLNKARRVFDSMPERNVISWTAMVRGYVQEGMISEAGSLFWQMPEKNVV  151

Query  48   PDDVTMVGVL  19
               V + G++
Sbjct  152  SWTVMLGGLI  161



>ref|XP_006421425.1| hypothetical protein CICLE_v10004455mg [Citrus clementina]
 gb|ESR34665.1| hypothetical protein CICLE_v10004455mg [Citrus clementina]
Length=703

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY +   VGNAL+ MY KCGSI  A  +F+GI+++D+VSWN M+  YA HG GK AL 
Sbjct  482  KTGYAADVIVGNALITMYAKCGSIDSAFQIFKGISDRDIVSWNAMLSAYALHGLGKGALL  541

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  G  PDD++++GVL AC ++
Sbjct  542  LFEEMKREGFAPDDISILGVLQACIYS  568


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+E+  +VG +L++MY   G   EA +VF G+A KDV   N MI+ Y + G  + A  
Sbjct  187  KSGFENNVFVGTSLISMYFHSGCFREAENVFRGLAYKDVRCVNFMILEYNKAGESEMAFH  246

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
             F  +     +P+D T   V+S C
Sbjct  247  VFVHLLSSDFEPNDYTFTNVISVC  270



>ref|XP_010526989.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
isoform X1 [Tarenaya hassleriana]
Length=706

 Score =   102 bits (253),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
             S  +VGNAL+ MY KCGS+ +    F+ ++E+D VSWN MI+GYA++G+G EAL  F+ 
Sbjct  424  RSDIFVGNALIDMYVKCGSVEDGYLAFKKMSERDCVSWNAMIVGYAQNGYGIEALALFRE  483

Query  69   MKDFGIKPDDVTMVGVLSACSHT  1
            M D G KPD +TM+GVLSAC+H+
Sbjct  484  MLDSGEKPDHITMIGVLSACNHS  506


 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S  Y+G+AL+ MY KCGS G A  VF+ +++++VVSWN +I  Y ++G   EAL+ F MM
Sbjct  185  SDVYIGSALVDMYSKCGSTGSAQLVFDEMSDRNVVSWNNLITCYEQNGPAMEALKVFLMM  244

Query  66   KDFGIKPDDVTMVGVLSACS  7
                 +PD+VT+  V+SAC+
Sbjct  245  LKSEFEPDEVTLTSVVSACA  264


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            ++++ Y K  S   A  +F  + E++V+SWN +I GY ++G  +EA+  F+++K   + P
Sbjct  325  SMVSGYAKTASTKAARLMFTEMIERNVISWNALIAGYTQNGENEEAINLFRILKRESVCP  384

Query  45   DDVTMVGVLSACSH  4
             D T   +L+AC++
Sbjct  385  TDYTFGNLLNACAN  398


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 4/79 (5%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM--K  64
            Y  N++L    K G + EA  +F  + + D  +WN+M+ G+A+H   +EAL +F +M  K
Sbjct  87   YSWNSVLTALTKSGFLDEAERMFWSMPDHDQCTWNSMVAGFAQHNSFEEALHYFALMHKK  146

Query  63   DFGIKPDDVTMVGVLSACS  7
            DF +  ++ T    LSAC+
Sbjct  147  DFVL--NEYTFGSGLSACA  163



>gb|KFK29928.1| hypothetical protein AALP_AA7G196500 [Arabis alpina]
Length=993

 Score =   102 bits (254),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +VG +L+ MY KCGSI +A  +F+ I  +++ +WN M++G A+HG GKEAL  FK MK  
Sbjct  657  FVGTSLVDMYSKCGSIDDAYSLFKRIEMRNIAAWNAMLVGLAQHGEGKEALLLFKQMKSL  716

Query  57   GIKPDDVTMVGVLSACSHT  1
            GIKPD VT +GVLSACSH+
Sbjct  717  GIKPDKVTFIGVLSACSHS  735


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +    V N+L+ MYCK  +IG A+ VF  ++E+D++SWN++I G+ + G   EA+ 
Sbjct  346  KLGLDLMLAVANSLINMYCKLRNIGLAMTVFHNMSERDLISWNSVIDGFTQSGLDVEAVC  405

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  +   G+ PD  TM  VL A S
Sbjct  406  MFMELLRCGLTPDQYTMTSVLKAAS  430


 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 45/85 (53%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY+   +V + +L +Y KCG +  A   F GI   D V+W TMI G   +G  + A  
Sbjct  548  KSGYDLDLWVSSGILDLYVKCGDMSAAQFAFNGIPVPDDVAWTTMISGCIENGEEERAFH  607

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M+  G+ PD+ T+  +  A S
Sbjct  608  VYSQMRLKGVLPDEFTIATLAKASS  632


 Score = 53.1 bits (126),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/84 (31%), Positives = 48/84 (57%), Gaps = 5/84 (6%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFG-----KEALEFFK  73
            ++ N L++MY KCGS+  A  VF+ + E+D+VSWN+++  YA+   G      E    F+
Sbjct  81   FLVNNLISMYSKCGSLTYARRVFDTMPERDLVSWNSILAAYAQCSEGIVENIGEGFLLFR  140

Query  72   MMKDFGIKPDDVTMVGVLSACSHT  1
            +++   +    +T+  +L  C H+
Sbjct  141  ILRQNIVFTSRMTLAPLLKLCLHS  164


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/79 (37%), Positives = 42/79 (53%), Gaps = 1/79 (1%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S  YV  AL+  Y +   + EA  +FE     D+V+WN M+ GY +   G + L+ F +M
Sbjct  453  SDSYVSTALIDAYSRNRCMEEAEVLFER-NSFDLVAWNAMMSGYTQSNDGDKTLKLFALM  511

Query  66   KDFGIKPDDVTMVGVLSAC  10
               G + DD T+  VL AC
Sbjct  512  HKQGERSDDFTLATVLKAC  530


 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S  +V  AL+ +Y K G + E   +FE +  +DVV WN M+  Y   G  +EA+ 
Sbjct  179  KIGLDSDEFVAGALVNIYLKFGKVKEGRVLFEEMPSRDVVLWNLMLKAYLDMGLKEEAVN  238

Query  81   FFKMMKDFGIKPDDVTM  31
                 +   + P++VT+
Sbjct  239  LSSAFQRTNLHPNEVTL  255



>gb|AEW07722.1| hypothetical protein 0_9722_01, partial [Pinus radiata]
Length=151

 Score = 96.3 bits (238),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G +S   V N+L+ MY KCGS+ +A  VF  +  +DVVSWN MI+GYA HG GKEAL+
Sbjct  35   RSGLQSYVTVENSLVDMYAKCGSLEDARKVFNRMTTRDVVSWNAMIVGYAIHGCGKEALQ  94

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK  G  PD VT +GVLSA  H
Sbjct  95   LFEQMKHTGTGPDHVTFIGVLSAVCH  120



>ref|XP_003574410.2| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 
[Brachypodium distachyon]
 ref|XP_010233790.1| PREDICTED: pentatricopeptide repeat-containing protein At2g34400 
[Brachypodium distachyon]
Length=608

 Score =   101 bits (252),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -2

Query  258  AGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEF  79
            A  E G  VG+AL+ MY KCG + EA  VF+GIA KDVV+WN MI GYA++G  KEA+  
Sbjct  247  AEIEVGSLVGSALVGMYEKCGEMTEARRVFDGIAHKDVVAWNAMITGYAQNGMSKEAIAL  306

Query  78   FKMMKDFGIKPDDVTMVGVLSACS  7
            F  M+  G  PD +T+VGVLSAC+
Sbjct  307  FHSMRQEGASPDKITLVGVLSACA  330


 Score = 81.6 bits (200),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G     YVG AL+ MY KCG + +A+ VF  +  K+  +WN +I G A +G G EA+  F
Sbjct  349  GLYGNVYVGTALVDMYSKCGDLDKAVQVFGKLPCKNEATWNALICGLAFNGRGHEAIRQF  408

Query  75   KMMK-DFGIKPDDVTMVGVLSACSH  4
            ++M+ + G++PDD+T +GVLSAC H
Sbjct  409  EVMRNEEGLRPDDITFIGVLSACVH  433


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G ++  +  ++L+ MY   G    A  VF+GI  +DVVSWN M+  Y R G   +   
Sbjct  144  RLGLQAHDHTVHSLVTMYSNLGDPLAARRVFDGIPRRDVVSWNAMMKAYERAGMAADVAR  203

Query  81   FFKMMKDFG-IKPDDVTMVGVLSAC  10
             F+ M D G + P++VT+  VL+AC
Sbjct  204  MFRDMIDEGAVAPNEVTVAVVLAAC  228



>ref|XP_004504222.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46460, 
mitochondrial-like [Cicer arietinum]
Length=708

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G E+G YVGN+L+ MY KCG IG+AL VF+GI EK+VVSWN++I+G A+HG G  AL 
Sbjct  364  KMGLENGVYVGNSLVVMYSKCGFIGDALYVFKGIGEKNVVSWNSVIVGCAQHGCGVWALA  423

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             FK M   G++ D++T+ G+LSACS 
Sbjct  424  LFKEMLREGVESDEITLTGLLSACSR  449


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 1/73 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF-KMMKDFGI  52
            NA++  YC  G I +AL +F  +  +DV+SW ++I G  R+G   +AL F  KM+    +
Sbjct  170  NAMIHGYCNNGRINDALRLFRLMGSRDVISWTSIIAGLDRNGMSYQALVFLKKMVGSSDV  229

Query  51   KPDDVTMVGVLSA  13
            +    T+V  LSA
Sbjct  230  EISSTTLVSGLSA  242


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 38/76 (50%), Gaps = 0/76 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            YV  +L+  Y  C  +     VF  I  K+VV W  ++ G+  +    EALE F  M  F
Sbjct  271  YVSASLVTFYASCKKMESTCKVFGEIVCKNVVVWTALLTGFGLNDRHVEALEVFGDMIRF  330

Query  57   GIKPDDVTMVGVLSAC  10
            G+ P++ +    L++C
Sbjct  331  GVVPNESSFTSALNSC  346



>ref|XP_010032449.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like 
[Eucalyptus grandis]
Length=704

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G ES  +VGN+L+ MY KCG++ + L VF+ + E+D VSWN +I+GYA++G+G EALE
Sbjct  419  QSGEESDIFVGNSLIDMYVKCGAVEDGLWVFKNMLERDKVSWNAIIVGYAQNGYGIEALE  478

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G +PD VTM+GVL ACSH
Sbjct  479  IFRKMLVSGERPDRVTMIGVLCACSH  504


 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+   S  ++G+AL+ MY KCG++  AL  F+ ++ +++VSWN++I  Y ++G   EALE
Sbjct  179  KSECSSDVHMGSALIDMYSKCGNVACALRAFDEMSSRNIVSWNSLITCYEQNGPASEALE  238

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M D G + D+VT+  V+SAC+
Sbjct  239  VFVSMMDCGFEIDEVTLASVVSACA  263


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 53/114 (46%), Gaps = 31/114 (27%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIA----------------------------  157
            Y +   +GNAL+ MY KC  I EA  +F+ +                             
Sbjct  284  YRNDVVLGNALVDMYSKCSRISEARAIFDRMPTRNIVSATSMVSGYAKAASLKAARVMFT  343

Query  156  ---EKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSH  4
               EK+VVSWN +I GY ++G  +EA   F+++K   I+P   T   +L+AC++
Sbjct  344  RMMEKNVVSWNALIAGYTQNGENEEAFGLFRLLKREPIEPTHYTFGNLLNACAN  397


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  NA+L    + GS+ EA ++F+ + E D  SWN+M+ GYA+H   +EAL+ F  
Sbjct  82   EKNTFTWNAILGGLIRLGSLDEAENIFQSMPEPDQCSWNSMLSGYAQHERFEEALQCFGK  141

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M       ++ +    LSAC+
Sbjct  142  MHRENYVLNEYSFGSALSACA  162


 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            + +  ++ N L+ +Y +CG + +A  VF+ + EK+  +WN ++ G  R G   EA   F+
Sbjct  50   FSAEVFIQNRLIDVYARCGCLDDARRVFDRMPEKNTFTWNAILGGLIRLGSLDEAENIFQ  109

Query  72   MMKDFGIKPDDVTMVGVLS  16
             M +    PD  +   +LS
Sbjct  110  SMPE----PDQCSWNSMLS  124



>ref|XP_004235997.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 
[Solanum lycopersicum]
Length=621

 Score =   101 bits (252),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G++    + NAL+ MY +CG + +A +VF+G+ EKDVVSW  MI G A +G+G++A+E F
Sbjct  279  GFDKAMNICNALITMYSRCGCLEKAFEVFKGMTEKDVVSWTAMISGLASNGYGRDAIEAF  338

Query  75   KMMKDFGIKPDDVTMVGVLSACSHT  1
            + M+  G+ PDD T  GVLSACSH+
Sbjct  339  REMQRVGVSPDDQTFTGVLSACSHS  363


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/87 (30%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S   +   L+  Y       EA  VF+ ++ +D ++WN +I  Y R+   ++AL 
Sbjct  175  RDGHQSDGRLLTTLMDFYSSNEKYTEACKVFDEMSHRDTIAWNVLISVYMRNRRTRDALG  234

Query  81   FFKMMK-DFGIKPDDVTMVGVLSACSH  4
             F MM+  +  + DDVT + +L AC++
Sbjct  235  LFDMMQSSYDCQSDDVTCLMLLQACAN  261



>ref|XP_010505312.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
isoform X1 [Camelina sativa]
Length=506

 Score =   100 bits (249),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S  ++ NAL++MYCKCG + +A  +F+  + KDVVSWN+MI GYA+HG   +A+E
Sbjct  255  RMGFKSYLHISNALISMYCKCGDLKDAFRIFDLFSNKDVVSWNSMIAGYAQHGLATQAIE  314

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ MM   G KPD +T +GVLS+C H
Sbjct  315  LFEVMMPKSGTKPDAITYLGVLSSCRH  341


 Score = 62.0 bits (149),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ S  YVG++L+ +Y   G +  A  VFE + E++VVSW  MI G+A+       L+
Sbjct  154  KSGFISDVYVGSSLVVLYRDSGEVESAHKVFEEMPERNVVSWTAMISGFAQEWRVDLCLK  213

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M+     P+D T   +LSAC+
Sbjct  214  LYSKMRYSTSDPNDYTFTALLSACT  238



>ref|XP_007226336.1| hypothetical protein PRUPE_ppa022305mg [Prunus persica]
 gb|EMJ27535.1| hypothetical protein PRUPE_ppa022305mg [Prunus persica]
Length=454

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GY+   +VGNAL+ MY KCG I  ALDVF+ +  KD+++WNT+I G A HG G +AL  F
Sbjct  228  GYKRNVFVGNALIDMYAKCGIIDNALDVFKSMDNKDLITWNTIICGLAMHGRGADALNLF  287

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            + MK++G  PD +T +G+L +C+H
Sbjct  288  RQMKNYGENPDGITFIGILCSCTH  311


 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 45/98 (46%), Gaps = 15/98 (15%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGY--------ARHGFG  97
            +E       +++  Y  CG +  A  +F    E+D+V WNTM+ GY        AR  F 
Sbjct  113  FERNVVAWTSMINGYILCGDMVSAQRLFHLAPERDIVLWNTMVSGYIELRDMVAARKLFD  172

Query  96   KEALE-------FFKMMKDFGIKPDDVTMVGVLSACSH  4
                        F +M+ +  + P+D T+V VLSAC+ 
Sbjct  173  DMPRRDVMVLGSFKRMLSESDVLPNDATLVTVLSACAR  210



>ref|XP_010526990.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
isoform X2 [Tarenaya hassleriana]
Length=677

 Score =   101 bits (252),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
             S  +VGNAL+ MY KCGS+ +    F+ ++E+D VSWN MI+GYA++G+G EAL  F+ 
Sbjct  395  RSDIFVGNALIDMYVKCGSVEDGYLAFKKMSERDCVSWNAMIVGYAQNGYGIEALALFRE  454

Query  69   MKDFGIKPDDVTMVGVLSACSHT  1
            M D G KPD +TM+GVLSAC+H+
Sbjct  455  MLDSGEKPDHITMIGVLSACNHS  477


 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S  Y+G+AL+ MY KCGS G A  VF+ +++++VVSWN +I  Y ++G   EAL+ F MM
Sbjct  156  SDVYIGSALVDMYSKCGSTGSAQLVFDEMSDRNVVSWNNLITCYEQNGPAMEALKVFLMM  215

Query  66   KDFGIKPDDVTMVGVLSACS  7
                 +PD+VT+  V+SAC+
Sbjct  216  LKSEFEPDEVTLTSVVSACA  235


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            ++++ Y K  S   A  +F  + E++V+SWN +I GY ++G  +EA+  F+++K   + P
Sbjct  296  SMVSGYAKTASTKAARLMFTEMIERNVISWNALIAGYTQNGENEEAINLFRILKRESVCP  355

Query  45   DDVTMVGVLSACSH  4
             D T   +L+AC++
Sbjct  356  TDYTFGNLLNACAN  369


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 4/79 (5%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM--K  64
            Y  N++L    K G + EA  +F  + + D  +WN+M+ G+A+H   +EAL +F +M  K
Sbjct  58   YSWNSVLTALTKSGFLDEAERMFWSMPDHDQCTWNSMVAGFAQHNSFEEALHYFALMHKK  117

Query  63   DFGIKPDDVTMVGVLSACS  7
            DF +  ++ T    LSAC+
Sbjct  118  DFVL--NEYTFGSGLSACA  134



>ref|XP_004961435.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Setaria italica]
Length=843

 Score =   102 bits (253),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +SG  V NAL++MY KCGS  ++L VF+ + E+D+ +WNT+I GYA+HG G+EA+ 
Sbjct  500  KLGMDSGLIVANALISMYFKCGS-ADSLKVFDSMEERDIFTWNTVITGYAQHGLGREAIR  558

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             ++ M+  G+ P++VT VG+L ACSH+
Sbjct  559  IYQQMESAGVLPNEVTFVGLLHACSHS  585


 Score = 58.9 bits (141),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 6/78 (8%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYA---RHGFGKEALEFFKMMKDF  58
            NA+L  YC    + +A ++FE + E++ VSW  MI GY    +HG   +A + F+MM   
Sbjct  83   NAMLTGYCHSRQMVDARNLFEQMPERNTVSWTVMISGYVLIEQHG---KAWDMFRMMHYD  139

Query  57   GIKPDDVTMVGVLSACSH  4
            G+ P+   +V VLSA SH
Sbjct  140  GMSPEQPNLVSVLSAISH  157


 Score = 52.8 bits (125),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 32/96 (33%), Positives = 43/96 (45%), Gaps = 31/96 (32%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIG-------------------------------EALD  175
            KAG +   YV NAL+ MY KC +IG                               EA D
Sbjct  368  KAGCQFNSYVCNALITMYAKCKNIGFVRQIFDRMTVKDTVSYNSFITALVQNDMLEEARD  427

Query  174  VFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
             F+ +  +DVVSW T+I  YA+   G +A+E F+ M
Sbjct  428  TFDNMPIRDVVSWTTIISAYAQADQGNDAIEIFRSM  463



>ref|XP_007020712.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
 gb|EOY12237.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
Length=1067

 Score =   102 bits (253),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+ +  +V +AL+ MY  CG I EA   F+G+A  DVVSWNTM+ GY +HG G + LE
Sbjct  604  KAGHSADLFVSSALVDMYANCGCIEEAESAFQGMASADVVSWNTMLFGYLQHGQGLKVLE  663

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M D G++PD+VT +GVLSACS+
Sbjct  664  TFRTMLDKGLEPDEVTFIGVLSACSY  689


 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G +   ++ N+L+ +Y KCGS G A  V + + E DVVSW  +  G    G G   L  +
Sbjct  101  GLDPDLHLWNSLVNVYAKCGSFGYACKVLDKMPETDVVSWTALFSGLVNEGHGSAVLGLY  160

Query  75   KMMKDFGIKPDDVTMVGVLSACS  7
              MK  G++P+   +V  L ACS
Sbjct  161  CFMKKDGVRPNGHCLVTALKACS  183


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G E   +VG  LL MY KCG   +AL VF+ I E ++V+W+ MI      G  +EA E
Sbjct  301  KSGCEHDEFVGCCLLDMYSKCGLAEDALKVFQRIQEPNIVAWSAMIDCLDEQGQIQEAAE  360

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F +M+  G+ P+  T   +  A ++
Sbjct  361  MFCLMRRKGVSPNQHTFSSIAGAATN  386


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 29/86 (34%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G     +VG++L+ +Y KCG +  A  VF  + +K+VVSWN ++ GYA  G   + L 
Sbjct  200  KVGVLLDVFVGSSLVDLYAKCGEMELAERVFVYMDKKNVVSWNALLNGYALEGDAGKVLN  259

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M +  ++    T+  VL +C++
Sbjct  260  LFEGMTESELRCSKFTLSNVLKSCTY  285


 Score = 53.1 bits (126),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 26/85 (31%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G      VG +L+ +Y K   + +A  +F  + E+D+ SW  +I GYA+    ++A++
Sbjct  503  KNGLNGNNLVGTSLIDLYAKNRFLEDAELLFSQLIERDLFSWTALIAGYAQTNRVEKAIK  562

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  ++  G+KP++  +   LS+CS
Sbjct  563  CFNQIQRQGVKPNEFILATCLSSCS  587


 Score = 50.1 bits (118),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 27/85 (32%), Positives = 42/85 (49%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+ES   + NAL++MY K  S+     VF+ ++  D+ SWN ++ G        +   
Sbjct  402  KYGFESENVLSNALISMYMKIRSVQNGWQVFKEMSSWDLASWNALLSGPHDDKTCDQGPI  461

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M   G +PD  T   +L +CS
Sbjct  462  IFHKMLAAGFRPDICTFASILRSCS  486



>dbj|BAJ88458.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG +S   V  AL+ MY KCGS+ +A+DVF+G+  +D  +W+ MI+ YA H +G+EA+ 
Sbjct  253  KAGLDSLVKVNTALIDMYGKCGSLEDAIDVFQGMESRDRQAWSVMIVAYANHSYGREAIS  312

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  GI+PD VT +GVL ACSH+
Sbjct  313  LFEEMKKQGIRPDAVTFLGVLYACSHS  339


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKD-VVSWNTMIIGYARHGFGKEAL  85
            K G     YV   L+ MY +CG    A  +F  +   D VVS+N MI    R     EAL
Sbjct  151  KTGAADHEYVLPTLINMYAECGDARSARAMFGRVPNGDCVVSYNAMITAAVRSSRPGEAL  210

Query  84   EFFKMMKDFGIKPDDVTMVGVLSACS  7
              F+ M+  G+KP  VT+  VLSAC+
Sbjct  211  VLFREMQAKGLKPTSVTVTSVLSACA  236



>ref|XP_008238970.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At3g25970 [Prunus mume]
Length=1118

 Score =   102 bits (253),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++ G +V +A++ +YCKCGSIG+A  VF   +  ++ SWN M++GYA+HGF  E  E
Sbjct  544  KTGFDQGSFVESAIIDVYCKCGSIGDAEKVFRHASTNNLASWNAMVMGYAQHGFHDEVSE  603

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  M  FG+KPD +T +GVL++C H
Sbjct  604  LFNKMSKFGVKPDHITYLGVLTSCCH  629


 Score = 74.3 bits (181),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY     VGN L++MY KC  IG+A  +F+ +  +D VSWN++I GY+ +G   +ALE
Sbjct  342  KLGYLRVVSVGNVLISMYGKCEQIGDARSIFDDMLCRDSVSWNSLIAGYSENGLVTQALE  401

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
              + M+D  ++P+  T+  +L   S+
Sbjct  402  VLRCMRDISLQPNGYTLASLLEVASN  427


 Score = 60.8 bits (146),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 5/85 (6%)
 Frame = -2

Query  261  KAGYESGC--YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEA  88
            K G+  GC  ++ NA++ MY +CG+   A  VF+ I + DVVSW T  IG A  G   EA
Sbjct  242  KMGFLWGCSVHLSNAIMNMYSRCGNQQNAAKVFDEITDPDVVSW-TERIGAASDGV--EA  298

Query  87   LEFFKMMKDFGIKPDDVTMVGVLSA  13
            LE FK++    +K ++ T++ VLSA
Sbjct  299  LELFKILHSGDVKVNEYTIINVLSA  323


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+    ++ +A+++ + K G    AL       + D VS+N +I G AR G      +
Sbjct  46   KSGHRLDPFLASAVISQFAKLGLFYHALQFLNDTPDPDTVSYNALIAGLARSGRPGPVFD  105

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
             F  ++  G++PD  T+  ++ AC
Sbjct  106  LFDRLRHVGLRPDAFTLSSLVKAC  129



>gb|KDP29416.1| hypothetical protein JCGZ_18337 [Jatropha curcas]
Length=497

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GY+   YVGNAL+ MY KCG +  A+DVF+ + +KD++SWNTM+ G A HG G +AL  F
Sbjct  235  GYKGNVYVGNALMDMYAKCGVVENAIDVFKSMVKKDLISWNTMVGGLAVHGRGADALSLF  294

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
              MK+ G KPD +T +GVL AC+H
Sbjct  295  SQMKNSGQKPDGITFLGVLCACTH  318


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHG-FGKEALEFFKMMKDFGI  52
            N +L  Y   G +     +FE + E+++ SWN +I GYAR+G F +  + F +M+ D  +
Sbjct  142  NTILNGYANKGDVDACQRLFEEMPERNIFSWNGLIGGYARNGHFFEVLISFKRMLIDGNV  201

Query  51   KPDDVTMVGVLSACSH  4
             P+D T V VLSACS 
Sbjct  202  IPNDATFVTVLSACSR  217



>emb|CDP05081.1| unnamed protein product [Coffea canephora]
Length=862

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+ES  Y+ N+L++MY +CG+I  A  VF  ++++ ++SW  MI G+A+HGF + ALE
Sbjct  518  KAGFESNEYICNSLISMYSRCGNIEAASQVFRDMSDQSIISWTAMITGFAKHGFAERALE  577

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  M   GIKP++VT V VLSACSH
Sbjct  578  LFTAMLSAGIKPNEVTYVAVLSACSH  603


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            VGNAL+++Y +C  + +A   FE + +K++VS+NT++  YA++    EA E F  ++D G
Sbjct  426  VGNALISLYARCDKLEDARRAFEVLFQKNLVSFNTIVDAYAKNFKSDEAFELFSGIEDSG  485

Query  54   IKPDDVTMVGVLS  16
            +  D  T   +LS
Sbjct  486  VVVDAFTYASLLS  498


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 50/89 (56%), Gaps = 5/89 (6%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKC---GSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGK-  94
            K+G  S   VG +L+ MY K    GS+ ++  VF+ +   +V+SW  +I GY + G    
Sbjct  311  KSGLSSDVCVGCSLVDMYAKSTADGSMSDSRKVFDRMPVHNVMSWTAIITGYVQGGGDDW  370

Query  93   EALEFFKMMKDFG-IKPDDVTMVGVLSAC  10
            EA+  ++MM + G +KP+  T   +L AC
Sbjct  371  EAINLYRMMMEEGSVKPNHFTFSALLKAC  399



>ref|XP_006410915.1| hypothetical protein EUTSA_v10017783mg [Eutrema salsugineum]
 gb|ESQ52368.1| hypothetical protein EUTSA_v10017783mg [Eutrema salsugineum]
Length=502

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S  ++ NAL++MYCKCG + +A  +F+  + KDVVSWN+MI GYA+HG   +A+E
Sbjct  249  QMGFKSYLHISNALISMYCKCGDLKDAFCIFDQFSNKDVVSWNSMIAGYAQHGLASQAIE  308

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ MM   G KPD +T +GVLS+C H
Sbjct  309  LFEVMMLKSGTKPDAITYLGVLSSCRH  335


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+ S  YVG++L+ +Y   G + +A  VFE + EK+VVSW  MI G+A+       L 
Sbjct  148  KCGFTSDVYVGSSLVVLYRGSGDLDDAHKVFEEMPEKNVVSWTAMISGFAQEWRVDICLN  207

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M++    P+D T   +LSAC+
Sbjct  208  LYSKMRNSRSFPNDYTFTALLSACT  232



>ref|XP_010107584.1| hypothetical protein L484_024440 [Morus notabilis]
 gb|EXC16266.1| hypothetical protein L484_024440 [Morus notabilis]
Length=762

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G      V N L+ MY KCGS+  A  +F  +   D+VSW+++I+GYA+ G+GKEALE
Sbjct  502  KSGLVLNVSVTNGLIDMYTKCGSLETARKLFNLMENPDIVSWSSLIVGYAQSGYGKEALE  561

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F++MKDFG +P+++T VGVL+AC H
Sbjct  562  LFRIMKDFGTRPNEITFVGVLTACGH  587


 Score = 70.9 bits (172),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            + G +L  MY KCG +  A  VF  I   D+VSWN +I G+A  G   EA+ FF  M+  
Sbjct  307  FAGCSLCDMYAKCGFLECAKTVFNHIESPDLVSWNVIISGFASIGDANEAISFFNEMRYM  366

Query  57   GIKPDDVTMVGVLSAC  10
            G  P+DVT++ +LSAC
Sbjct  367  GFIPNDVTVISLLSAC  382


 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L MY KCGS+ +AL VF+ + ++++VSW ++I G +++G  K+A+E +  M+  G  
Sbjct  107  NHVLNMYGKCGSVKDALKVFDEMPQRNIVSWTSVISGCSQNGQDKDAVELYFRMRRAGYV  166

Query  48   PDDVTMVGVLSACS  7
            PD  T   V+ ACS
Sbjct  167  PDQFTFGSVIKACS  180


 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/75 (41%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK-MMKDFGI  52
            NAL+AMY + G I +A +VF  IA +D++SW +MI G ++ G+  EAL  FK M++    
Sbjct  208  NALIAMYTRFGRIDDASNVFSRIATRDLISWGSMIAGSSQLGYELEALHHFKEMLRQGAY  267

Query  51   KPDDVTMVGVLSACS  7
            KP++       S CS
Sbjct  268  KPNEFVFASAFSTCS  282


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 1/86 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEK-DVVSWNTMIIGYARHGFGKEAL  85
            K G+ S   V N LL  Y K  ++ +A  VFE +  + D VSWN ++    +H   ++  
Sbjct  400  KHGFNSYVPVCNTLLTTYAKGSALSDAFKVFEDVKSRADPVSWNAILTASVQHNQAEDVF  459

Query  84   EFFKMMKDFGIKPDDVTMVGVLSACS  7
              F+ M    I+PD +T+  +++AC+
Sbjct  460  RLFRTMLFSHIRPDHITLSNLIAACA  485



>ref|XP_009409927.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Musa acuminata subsp. malaccensis]
Length=674

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/86 (55%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G E+    GNAL+ MY KCG I  A +VF G+A KDV ++ +MI+G A HG G+EALE
Sbjct  346  RNGIEADGITGNALVDMYSKCGRIDRAKEVFGGMAHKDVYTYTSMIVGLAMHGRGEEALE  405

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  M   G+KP++VT VGVLSACSH
Sbjct  406  LFAAMSSAGVKPNEVTFVGVLSACSH  431


 Score = 81.3 bits (199),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G ++  YV N L+++Y  CG +     +F+G  EKD+VSW T+I GY + G  K+A++
Sbjct  144  KMGLDANVYVRNNLMSLYAVCGEVRSIQKLFDGFPEKDLVSWTTLISGYTKAGLAKKAVK  203

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F+ M    ++ D VTMV VLSAC+
Sbjct  204  VFEEMMSENLRADGVTMVAVLSACA  228


 Score = 77.0 bits (188),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +VGNAL+ MY KCG +  A  +F  +  ++VVSWN++I G   +   K+ALE F+ M+  
Sbjct  253  FVGNALVDMYSKCGDVDSAYQLFNEMPVRNVVSWNSIISGLVNNKEFKQALELFRQMQRQ  312

Query  57   GIKPDDVTMVGVLSACS  7
            GI+PD  T+VG L++C+
Sbjct  313  GIEPDPFTLVGALNSCA  329



>ref|XP_008808564.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Phoenix dactylifera]
Length=781

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+ES   VGN+L+ MYCKCG +  A  +F+ + E DVV+WN MI GYA +G GK A+E
Sbjct  566  KLGHESHMVVGNSLINMYCKCGDMLLAKLIFDCMPEWDVVTWNAMINGYAFNGLGKNAIE  625

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F++MK    KPD+VT +G+LSAC+H
Sbjct  626  MFEIMKRTNTKPDEVTFLGILSACTH  651


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/74 (34%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N L+    K G +  A  +F+ + E+DVVSWN+++  YA++G   E +  F  M    + 
Sbjct  56   NKLIMGCSKAGDLVSARRLFDQMPERDVVSWNSIMTAYAKNGRCNEVIRIFSEMNGCRLM  115

Query  48   PDDVTMVGVLSACS  7
            P+  ++  VLSAC+
Sbjct  116  PNHTSISTVLSACA  129


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/74 (35%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF-KMMKDFGIK  49
            A++  Y +   +  AL++F  +  K+VV+W+ M+ G+  +G  +EA+EFF KMM D G+ 
Sbjct  220  AMINGYAEVKKVRIALELFNLMPAKNVVTWSVMLGGFVSNGQFEEAIEFFAKMMSD-GVP  278

Query  48   PDDVTMVGVLSACS  7
                +++ V +ACS
Sbjct  279  TTAASIIKVTNACS  292



>emb|CDX89609.1| BnaC03g45230D [Brassica napus]
Length=698

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E+  +VGN+L+ MY KCG + +   VF  + E+D VSWN MIIG+A++G+G EALE
Sbjct  418  QSGEETDIFVGNSLIDMYVKCGCVEDGYLVFRKMVERDRVSWNAMIIGFAQNGYGNEALE  477

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ M+   G KPD +TM+GVLSAC H
Sbjct  478  LFREMLGGSGEKPDHITMIGVLSACGH  504


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGI-AEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            S  ++G+AL+ MY KCG + +A   F+ +   ++VV+WN++I  Y ++G  +EAL  F +
Sbjct  182  SEVHIGSALVDMYSKCGHVDDAQQCFDELCGYRNVVTWNSLITCYEQNGPVEEALSVFNL  241

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G +PD+VT+  V+SAC+
Sbjct  242  MLRSGFEPDEVTLASVISACA  262


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 31/107 (29%), Positives = 48/107 (45%), Gaps = 31/107 (29%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGI-------------------------------AEKD  148
            + NA + MY KCG + EA  VF+ +                                E++
Sbjct  289  LSNAFVDMYAKCGRVKEARIVFDSMPIRNAIAETSMISGYAMAASTKAARLMFTKMTERN  348

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACS  7
            VVSWN +I GY ++G  +EAL  F+++K   + P   T   +L AC+
Sbjct  349  VVSWNALIAGYTQNGENEEALSLFRLLKRESVSPTHYTFANILKACA  395


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            Y  N L+    K G + EA  +F  + E+D  +WN+M+ G+A+    +EAL +   M   
Sbjct  83   YTWNTLVTALAKLGLLEEAETLFRSMPERDQCTWNSMVSGFAQRNRCEEALRYLASMHKE  142

Query  57   GIKPDDVTMVGVLSACS  7
            G   ++ ++   LSACS
Sbjct  143  GFSLNEYSLASGLSACS  159



>ref|XP_008229674.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Prunus mume]
Length=739

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 47/87 (54%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY +  +V NAL+ MY KCG +  A  VFE I   D+VSWN++I GY+ +G G+EA+E
Sbjct  480  KGGYVNDLFVCNALITMYAKCGRVTNAELVFEDINHGDIVSWNSLISGYSLNGHGREAVE  539

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             FK M   G+ PD VT VGVLSACSH+
Sbjct  540  LFKQMLIEGVNPDQVTFVGVLSACSHS  566


 Score = 63.5 bits (153),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G + +AL +FE + E+ +VSWN++I G+ ++G   +AL+   MM   G +
Sbjct  390  NTMITGYAQVGQMDKALKIFEEMGERSIVSWNSLITGFVQNGLYLDALKSIVMMGQEGKR  449

Query  48   PDDVTMVGVLSACSH  4
            PD+ T    LSAC++
Sbjct  450  PDESTFACCLSACAN  464


 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            A+++ Y + G + EA  +F  IA  DVV WNTMI GYA+ G   EA   F+ M
Sbjct  329  AMMSGYVQNGRMDEASQIFNQIAIYDVVCWNTMIAGYAQCGKMVEAQSLFRKM  381


 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 33/68 (49%), Gaps = 0/68 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            NA+LA Y +   I +A+ +F  + E D VSW TMI GY R G   EA +    M    I 
Sbjct  266  NAMLAAYVRDHQIDKAIKIFRDMPEMDSVSWTTMINGYVRVGKLDEARQLLNRMPYRNIA  325

Query  48   PDDVTMVG  25
                 M G
Sbjct  326  AQTAMMSG  333



>ref|XP_009152140.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, 
mitochondrial [Brassica rapa]
Length=630

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/83 (53%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            Y+    + NAL+ MYCKCGS+ +A  VF G+ E+DV++W+TMI G A++G+ +EALE F+
Sbjct  289  YDQDLILNNALVDMYCKCGSLDDARRVFNGMKERDVITWSTMISGLAQNGYSQEALELFE  348

Query  72   MMKDFGIKPDDVTMVGVLSACSH  4
             MK  G KP+ +T+VGVL ACSH
Sbjct  349  SMKASGTKPNYITIVGVLFACSH  371


 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G ES  +V +AL+ ++ K G   +AL VF+ +   D + WN++I G+A++    EAL+
Sbjct  187  KEGLESDVFVRSALIDVFAKLGEPEDALSVFDEMVTGDAIVWNSIIGGFAQNSKNDEALK  246

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             FK MK  G   +  T+  VL AC+
Sbjct  247  LFKRMKRAGFTAEQATLTSVLRACT  271


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/82 (33%), Positives = 47/82 (57%), Gaps = 0/82 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G++   ++ N L+ MY K   + +A +VF+ +  ++VVSW TMI  Y++    ++ALE  
Sbjct  91   GHQPMLFLANVLINMYVKFNLLTDAHNVFDEMPLRNVVSWTTMISAYSKCKQQQKALELL  150

Query  75   KMMKDFGIKPDDVTMVGVLSAC  10
              M   G++P+  T   VL +C
Sbjct  151  VSMLREGVRPNVYTYSSVLRSC  172



>ref|XP_003632994.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 
[Vitis vinifera]
Length=613

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +   + GNALL +Y KCGSI +A  VF+ + EK VVSW ++I+G A +GFGKEALE
Sbjct  269  KVGLDGNLHAGNALLDLYAKCGSIRQAHKVFDEMEEKSVVSWTSLIVGLAVNGFGKEALE  328

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             FK ++  G+ P ++T VGVL ACSH
Sbjct  329  LFKELERKGLMPSEITFVGVLYACSH  354


 Score = 80.5 bits (197),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+ES  +V N L+ MY  CG    A  +FE +AE+++V+WN++I GYA +G   EAL 
Sbjct  168  RNGFESLVFVQNTLVHMYAACGHAESAHKLFELMAERNLVTWNSVINGYALNGRPNEALT  227

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F+ M   G++PD  TMV +LSAC+
Sbjct  228  LFREMGLRGVEPDGFTMVSLLSACA  252



>ref|XP_004305889.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
[Fragaria vesca subsp. vesca]
Length=739

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 63/87 (72%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY +  +V NAL++MY KCG +  A  VF+ I   D+VSWN++I GYA +G+G+EA+E
Sbjct  480  KTGYLNDLFVSNALISMYAKCGMVVSAKQVFKDINHGDIVSWNSLISGYALNGYGEEAVE  539

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ M+  G+ PD +T VGVLSACSH+
Sbjct  540  LFEEMQIEGLNPDQLTFVGVLSACSHS  566


 Score = 62.8 bits (151),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 46/75 (61%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++  Y + G + +AL +FE + EK+ VSWN++I GY ++G   +ALE   +M   G +
Sbjct  390  NTMITGYAQVGEMDKALQIFEQMGEKNTVSWNSLITGYVQNGLYLDALESTVVMGREGKR  449

Query  48   PDDVTMVGVLSACSH  4
            PD  T    LSAC++
Sbjct  450  PDQSTFSSGLSACAN  464


 Score = 58.9 bits (141),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N ++A Y +CG + EAL +F  +  KD VSWNTMI GYA+ G   +AL+ F+ M
Sbjct  359  NTMIAGYAQCGRMVEALSLFRKMTNKDAVSWNTMITGYAQVGEMDKALQIFEQM  412


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKD  61
            A+++ Y   G + EA  +F  IA +D V WNTMI GYA+ G   EAL  F+ M +
Sbjct  329  AMISGYAHNGRMDEASQIFNQIAIRDAVCWNTMIAGYAQCGRMVEALSLFRKMTN  383


 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 31/54 (57%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            NA+LA Y +   + +A+ +F  + E D VSW TMI GY R G  +EA E    M
Sbjct  266  NAMLAAYVQDQQVDKAVKIFRDMPEMDSVSWTTMINGYVRAGKLEEARELLNRM  319



>ref|XP_010259970.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Nelumbo nucifera]
Length=550

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/86 (49%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+ S  ++GNAL++MY KCG+IGEA  +FE +  +D++SWN+MI G+A+HG  ++A++
Sbjct  287  KMGFHSYTHIGNALVSMYSKCGNIGEAFYIFENMQGRDLISWNSMIAGFAQHGLAEKAID  346

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
              K M    IKPD +T +GVLS+C H
Sbjct  347  LLKEMVKQKIKPDAITFLGVLSSCRH  372


 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/84 (36%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+    YVG++L+ +Y KC  + +A  +FEG+  ++VVSW  +I  +A+H   +  L 
Sbjct  186  KTGFVMNVYVGSSLVTLYGKCWRLDDAYRMFEGMPVRNVVSWTAIIASFAQHCQVEMCLW  245

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
             +  M+   IKP+D+T++ +L+AC
Sbjct  246  LYHEMRHLTIKPNDITLMSLLTAC  269



>ref|XP_010516999.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like 
[Camelina sativa]
Length=506

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S  ++ NAL++MYCKCG + +A  +F+  + KDVVSWN+MI GYA+HG   +A+E
Sbjct  255  RMGFKSYLHISNALISMYCKCGDLKDAFRIFDLFSNKDVVSWNSMIAGYAQHGLATQAIE  314

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ MM   G KPD +T +GVLS+C H
Sbjct  315  LFEVMMPKSGTKPDAITYLGVLSSCRH  341


 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+ S  YVG++L+ +Y   G +  A  VFE + E++VVSW  M+ G+A+        +
Sbjct  154  KGGFISDVYVGSSLVVLYRDSGDVESAHKVFEEMPERNVVSWTAMVSGFAQEWRVDLCFK  213

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M+D    P+D T   +LSAC+
Sbjct  214  LYSKMRDSTSDPNDYTFTALLSACT  238



>gb|EMS46552.1| hypothetical protein TRIUR3_15385 [Triticum urartu]
Length=547

 Score =   100 bits (249),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/87 (52%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG +S   V  AL+ MY KCGS+ +A+DVF+G+  +D  +W+ MI+ YA H +G+EA+ 
Sbjct  203  KAGLDSLVKVNTALIDMYGKCGSLEDAIDVFQGMESRDRQAWSVMIVAYANHSYGREAIS  262

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ MK  GIKPD VT +GVL ACSH+
Sbjct  263  LFEEMKKQGIKPDAVTFLGVLYACSHS  289


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKD-VVSWNTMIIGYARHGFGKEAL  85
            K G     YV   L+ MY +CG    A  +F  + + D VVS+N MI    R     EAL
Sbjct  101  KTGAADHEYVLPTLINMYAECGDARSAHVMFGRVPDGDCVVSYNAMITAAVRSSRPGEAL  160

Query  84   EFFKMMKDFGIKPDDVTMVGVLSACS  7
              F+ M+  G+KP  +T+  VLSAC+
Sbjct  161  VLFREMQAKGLKPTSITVTSVLSACA  186



>ref|XP_002524945.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF37442.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=417

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 44/84 (52%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G E   +VG+AL+ MY KCG++ +A  VFE I  KDVV WN+M+ GYA HGF ++AL+ F
Sbjct  290  GIEINAHVGSALIDMYSKCGNLEDARLVFERIKYKDVVVWNSMVTGYATHGFSQDALQLF  349

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
              M   G +P D+T +GVLSAC H
Sbjct  350  NEMCGLGYQPTDITFIGVLSACGH  373


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            A++  + K G + EA  +F+G+ ++D+V WN MI GY +HG   E L  F+ M    ++P
Sbjct  199  AMITCFAKHGMVKEARVLFDGLEDRDLVCWNVMIDGYVQHGLANEGLVLFRQMLKDRVRP  258

Query  45   DDVTMVGVLSACSH  4
             +VT++ VLSAC  
Sbjct  259  SEVTVLAVLSACGQ  272



>ref|XP_007156271.1| hypothetical protein PHAVU_003G272400g [Phaseolus vulgaris]
 gb|ESW28265.1| hypothetical protein PHAVU_003G272400g [Phaseolus vulgaris]
Length=618

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GY+   +VGNAL+ MY KCG I +ALDVF  +  KD+++WNT+I G A HG   +AL  F
Sbjct  356  GYKENLFVGNALIDMYAKCGVIEKALDVFNCLDVKDIITWNTVINGLAMHGHAADALSLF  415

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            + MK  G KPD VT VG+LSAC+H
Sbjct  416  ERMKSAGEKPDGVTFVGILSACTH  439


 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/84 (38%), Positives = 44/84 (52%), Gaps = 10/84 (12%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM------  67
            N +L  Y   G +     +F+ +  ++V SWN +I GY R+G   EALE FK M      
Sbjct  254  NTVLNGYAYNGDVESFEQLFDEMPARNVYSWNGLIGGYVRNGLFNEALECFKRMLMLAKQ  313

Query  66   ----KDFGIKPDDVTMVGVLSACS  7
                 D  + P+D T+V VLSACS
Sbjct  314  EGEGGDVVVVPNDYTVVAVLSACS  337



>ref|XP_007044258.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
 gb|EOY00090.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma 
cacao]
Length=700

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G +S  +VGN+L+ MY KCGS+ +   VF+ + E+D VSWN MI+GYA++G+G +ALE F
Sbjct  421  GEDSDIFVGNSLIDMYMKCGSVEDGDQVFKNMMERDWVSWNAMIVGYAQNGYGNKALELF  480

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            K M   G KPD VTM+GVL ACSH
Sbjct  481  KNMLVSGEKPDHVTMIGVLCACSH  504


 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K  + S  Y+G+AL+ MY KCGS+  A   F+ + +++ VSWN++I  Y ++G    ALE
Sbjct  179  KTLFLSDVYMGSALVDMYGKCGSVCCAQRAFDDMNQRNRVSWNSLITCYEQNGPAGVALE  238

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M D GI+PD+VT+  V+SAC+
Sbjct  239  VFLRMMDCGIEPDEVTLASVVSACA  263


 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  225  ALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKP  46
            ++++ Y K  S+  A  +F  + E+++VSWN +I GY ++G  +EAL  F+++K   + P
Sbjct  324  SMVSGYAKAASVKTARLMFMKMMERNIVSWNALIAGYTQNGEDEEALRLFRLLKRESVCP  383

Query  45   DDVTMVGVLSACSH  4
               T   +L+AC++
Sbjct  384  THYTFGNLLNACAN  397


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ + S  ++ N L+  Y KCGS+ +A  VF+ + ++++ SWN+ I    + GF  EA  
Sbjct  47   KSNFASETFILNRLIDAYGKCGSLEDARKVFDRMPQRNIFSWNSAITALTKFGFVDEAAR  106

Query  81   FFKMMKD  61
             F  M +
Sbjct  107  IFGSMSE  113



>ref|XP_009108814.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like 
[Brassica rapa]
Length=984

 Score =   101 bits (252),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +VG +L+ MY KCGSI +A  +F+ I  +++ +WN M++G A+HG GKEAL+ F+ M+  
Sbjct  648  FVGTSLVDMYAKCGSIDDAYSLFKRIEMRNIAAWNAMLVGLAQHGEGKEALQLFEQMRSL  707

Query  57   GIKPDDVTMVGVLSACSHT  1
            GIKPD VT +GVLSACSH+
Sbjct  708  GIKPDKVTFIGVLSACSHS  726


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/85 (39%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++    V N+L+ MYCK   +G A  VF  ++E+D++SWN++I G+A+ G   EA+ 
Sbjct  341  KLGFDLMLTVANSLINMYCKLRKVGYARTVFNSMSERDLISWNSVISGFAQSGLEVEAVC  400

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  +   G+ PD  TM  VL + S
Sbjct  401  LFMELLRCGLTPDHYTMTSVLKSTS  425


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S  +V  AL+ +Y K G + E   +FE + EKDVV WN M+  Y   GF ++A+E
Sbjct  178  KIGLDSDEFVAGALVNIYLKFGMVKEGRVLFEEMPEKDVVLWNLMLKAYLDMGFKEDAVE  237

Query  81   FFKMMKDFGIKPDDVTM  31
                    G+ P+ +T+
Sbjct  238  LSSAFHKSGLHPNGITL  254


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY+   +V + +L MY KCG +  A   F  I   D V+W TMI G   +G  + A  
Sbjct  539  KSGYDLDLWVSSGVLDMYVKCGDMKAAHFAFNCIPVPDDVAWTTMISGCIENGEEERAFH  598

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M+  G+ PD+ T+  +  A S
Sbjct  599  VYSQMRLMGVLPDEFTIATLAKASS  623


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/78 (31%), Positives = 43/78 (55%), Gaps = 5/78 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHG-----FGKEALEFFKMMK  64
            N L+ MY KCGS+  A  VF+ + E+D+VSWN+++  YA+         +E    F++++
Sbjct  83   NNLITMYSKCGSLNYARRVFDKMPERDLVSWNSILAAYAQSSEHVIDSTEEGFVLFRVLR  142

Query  63   DFGIKPDDVTMVGVLSAC  10
               +    +T+  +L  C
Sbjct  143  QNVVFTSRMTLAPLLKLC  160



>ref|XP_004231236.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, 
chloroplastic [Solanum lycopersicum]
Length=844

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG +S   V NAL++MY +CG+I  A  VFEG+ +++V+SW ++I G+A+HGF   A+E
Sbjct  500  KAGIQSSQSVCNALISMYSRCGNIEAAFQVFEGMEDRNVISWTSIITGFAKHGFAHRAVE  559

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  M + GIKP++VT + VLSACSH
Sbjct  560  LFNQMLEDGIKPNEVTYIAVLSACSH  585


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 2/87 (2%)
 Frame = -2

Query  261  KAGY-ESGCYVGNALLAMYCKCGS-IGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEA  88
            K GY ES   VG AL+ ++ K  S +  A  VF+ + E+++V+W  MI  +++ G  K+A
Sbjct  192  KTGYFESDVCVGCALIDLFAKGFSDLRSAKKVFDRMPERNLVTWTLMITRFSQLGASKDA  251

Query  87   LEFFKMMKDFGIKPDDVTMVGVLSACS  7
            +  F  M   G  PD  T  GVLSAC+
Sbjct  252  VRLFLEMVSEGFVPDRFTFSGVLSACA  278


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 4/79 (5%)
 Frame = -2

Query  234  VGNALLAMYCKC---GSIGEALDVFEGIAEKDVVSWNTMIIGYARHG-FGKEALEFFKMM  67
            VG +L+ MY K    GS+ ++  VF+ +A+ +V+SW  +I GY + G +  EA++ +  M
Sbjct  304  VGCSLVDMYAKSTMDGSMDDSRKVFDRMADHNVMSWTAIITGYVQRGHYDMEAIKLYCRM  363

Query  66   KDFGIKPDDVTMVGVLSAC  10
             D  +KP+  T   +L AC
Sbjct  364  IDGLVKPNHFTFSSLLKAC  382


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEK-DVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            V N+L+++Y K GS   A  +FE + EK D+VSW+ MI  YA  G   E++  F  M +F
Sbjct  99   VLNSLISLYSKMGSWETAEKIFESMGEKRDLVSWSAMISCYAHCGMELESVFTFYDMVEF  158

Query  57   GIKPDDVTMVGVLSAC  10
            G  P+      V+ AC
Sbjct  159  GEYPNQFCFSAVIQAC  174



>ref|NP_189568.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q9LS72.1|PP261_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g29230 
[Arabidopsis thaliana]
 dbj|BAB01819.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE77553.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=600

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            S  YV NALL MY KCG++ +A DVF  I +KD+VSWNTM+ G   HG GKEA+E F  M
Sbjct  348  SNAYVLNALLDMYAKCGNLKKAFDVFNDIPKKDLVSWNTMLHGLGVHGHGKEAIELFSRM  407

Query  66   KDFGIKPDDVTMVGVLSACSH  4
            +  GI+PD VT + VL +C+H
Sbjct  408  RREGIRPDKVTFIAVLCSCNH  428


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIG--EALDVFEGIAEKDVVSWNTMIIGYARHGFGKEA  88
            K G  S  YV NAL+  Y +CG +G  +A+ +FE ++E+D VSWN+M+ G  + G  ++A
Sbjct  145  KLGLSSDIYVPNALIDCYSRCGGLGVRDAMKLFEKMSERDTVSWNSMLGGLVKAGELRDA  204

Query  87   LEFFKMM  67
               F  M
Sbjct  205  RRLFDEM  211


 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/109 (25%), Positives = 46/109 (42%), Gaps = 33/109 (30%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMII------------------------  121
            N +L  Y +C  + +A ++FE + E++ VSW+TM++                        
Sbjct  220  NTMLDGYARCREMSKAFELFEKMPERNTVSWSTMVMGYSKAGDMEMARVMFDKMPLPAKN  279

Query  120  ---------GYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACSHT  1
                     GYA  G  KEA      M   G+K D   ++ +L+AC+ +
Sbjct  280  VVTWTIIIAGYAEKGLLKEADRLVDQMVASGLKFDAAAVISILAACTES  328



>ref|XP_006364594.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530-like 
[Solanum tuberosum]
Length=621

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G++    + NAL+ MY +CG + +A +VF+G+ EKDVVSW  MI G A +G+G++A+E F
Sbjct  279  GFDKAMNICNALITMYSRCGCLEKAFEVFKGMTEKDVVSWTAMISGLASNGYGRDAIEAF  338

Query  75   KMMKDFGIKPDDVTMVGVLSACSHT  1
            + M+  G+ PDD T  GVLSACSH+
Sbjct  339  REMQRAGVSPDDQTFTGVLSACSHS  363


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 27/87 (31%), Positives = 48/87 (55%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+ S   +   L+  Y       EA  VF+ ++ +D ++WN +I  Y R+   ++AL 
Sbjct  175  RDGHPSDGRLLTTLMDFYSSNEKYTEACKVFDEMSHRDTIAWNVLISVYMRNRRTRDALG  234

Query  81   FFKMMK-DFGIKPDDVTMVGVLSACSH  4
             F MM+  +  +PDDVT + +L AC++
Sbjct  235  VFDMMQSSYDCQPDDVTCLMLLQACAN  261



>ref|XP_010509351.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37320-like 
[Camelina sativa]
Length=506

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G++S  ++ NAL++MYCKCG + +A  +F+  + KDVVSWN+M+ GYA+HG   +A+E
Sbjct  255  RIGFKSYLHISNALISMYCKCGDLKDAFRIFDLFSNKDVVSWNSMVAGYAQHGLATQAIE  314

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ MM   G KPD +T +GVLS+C H
Sbjct  315  LFEVMMPKSGTKPDAITYLGVLSSCRH  341


 Score = 61.6 bits (148),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G+ S  YVG++L+  Y     +  A  VFE + E++VVSW  MI G+A+       L+
Sbjct  154  KSGFISDVYVGSSLVVFYRDSCDVESAHKVFEEMPERNVVSWTAMISGFAQEWRVDLCLK  213

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M+D    P+D T   +LSAC+
Sbjct  214  LYSKMRDSTSDPNDYTFTALLSACT  238



>ref|XP_006466530.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic-like [Citrus sinensis]
Length=622

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            VG AL+ MY KCGS+ +A  VF+ + +KDVV WN+MI+GYA HGFGK+AL+ F  M    
Sbjct  287  VGTALINMYSKCGSLKDARLVFDRVNDKDVVVWNSMIVGYAMHGFGKDALQLFNEMCRIR  346

Query  54   IKPDDVTMVGVLSACSH  4
            +KP D+T +G+LSAC+H
Sbjct  347  LKPSDITFIGLLSACAH  363


 Score = 73.2 bits (178),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  222  LLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPD  43
            +L  Y K G +  A  +F+ + EKDVV WN MI GYA+HG   EAL  F+ M    ++P+
Sbjct  189  MLTCYAKQGEVAAARVLFDDMEEKDVVCWNVMIDGYAQHGLANEALVLFRRMLAEKVEPN  248

Query  42   DVTMVGVLSACSH  4
            +VT V VLSAC  
Sbjct  249  EVTAVAVLSACGQ  261



>ref|XP_006426011.1| hypothetical protein CICLE_v10025167mg [Citrus clementina]
 gb|ESR39251.1| hypothetical protein CICLE_v10025167mg [Citrus clementina]
Length=622

 Score =   100 bits (250),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            VG AL+ MY KCGS+ +A  VF+ + +KDVV WN+MI+GYA HGFGK+AL+ F  M    
Sbjct  287  VGTALINMYSKCGSLKDARLVFDRVNDKDVVVWNSMIVGYAMHGFGKDALQLFNEMCRIR  346

Query  54   IKPDDVTMVGVLSACSH  4
            +KP D+T +G+LSAC+H
Sbjct  347  LKPSDITFIGLLSACAH  363


 Score = 73.2 bits (178),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  222  LLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPD  43
            +L  Y K G +  A  +F+ + EKDVV WN MI GYA+HG   EAL  F+ M    ++P+
Sbjct  189  MLTCYAKQGEVAAARVLFDDMEEKDVVCWNVMIDGYAQHGLANEALVLFRRMLAEKVEPN  248

Query  42   DVTMVGVLSACSH  4
            +VT V VLSAC  
Sbjct  249  EVTAVAVLSACGQ  261



>ref|XP_009149215.1| PREDICTED: putative pentatricopeptide repeat-containing protein 
At1g17630 [Brassica rapa]
Length=735

 Score =   101 bits (251),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/77 (58%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            V NAL+ MY KCGS+GE   VFE I +KD++SWN+MI GY  HGFG++AL  F  M   G
Sbjct  475  VQNALVNMYSKCGSLGEGNQVFEAIRDKDLISWNSMIKGYGMHGFGEKALSMFDRMIKSG  534

Query  54   IKPDDVTMVGVLSACSH  4
            + PD + MV VLSACSH
Sbjct  535  LHPDGIAMVAVLSACSH  551


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 46/87 (53%), Gaps = 0/87 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G     YV N LL +Y K G + +A  +F  +  ++ +SWN MI GY++    + A+ 
Sbjct  190  KIGLLENLYVANELLTLYPKAGRMSDAYKLFVEMPVRNRISWNVMISGYSQEHDCESAVR  249

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             F+ M+     PD+VT   VLS  S +
Sbjct  250  VFEWMQREEFVPDEVTWTSVLSCHSQS  276


 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 44/82 (54%), Gaps = 8/82 (10%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAE--------KDVVSWNTMIIGYARHGFGKEALEFFK  73
            NAL+  +   G + EAL +F  + E         +VV+W ++I G    G G ++LE+F+
Sbjct  368  NALITSFVDAGKLDEALSLFTELEEMNGFCNVKANVVTWTSIIKGCNVQGRGDDSLEYFR  427

Query  72   MMKDFGIKPDDVTMVGVLSACS  7
             M+   +  + VT+  +LS C+
Sbjct  428  RMQFSKVLSNSVTICCILSICA  449



>ref|XP_009368106.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
[Pyrus x bretschneideri]
 ref|XP_009368107.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
[Pyrus x bretschneideri]
Length=706

 Score =   100 bits (250),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G E   +VGN+L+ MY KCGSI +   VF+ + ++D VSWN MI+GYA++G+G EALE
Sbjct  420  QVGEEPDIFVGNSLIDMYMKCGSIEDGCRVFKNMLQRDYVSWNAMIVGYAQNGYGIEALE  479

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G +PD VTM+GVL ACSH
Sbjct  480  LFRKMLASGEQPDHVTMIGVLCACSH  505


 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+ Y S  Y+G+AL+ MY KCGS+  A  VF+G+ +++ VSWN++I  Y ++G   EALE
Sbjct  180  KSSYSSDVYMGSALIDMYSKCGSVSCAQRVFDGMNDRNTVSWNSLITCYEQNGPASEALE  239

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F  M + G KPD++T+  V+SAC+
Sbjct  240  VFVKMMECGFKPDELTLASVVSACA  264


 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = -2

Query  249  ESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            E   +  N++L+   K G I EA+ +F  + E D  SWN+M+ G+A+H   +E+LE+F  
Sbjct  83   ERNTFTWNSILSTLTKLGLIDEAVKIFRLMPEPDQCSWNSMVSGFAQHDRFEESLEYFVR  142

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            +      P++ +    LSAC+
Sbjct  143  LHGENFVPNEYSFGSALSACA  163


 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
             ++++ Y K  S+  A  +F  + E+++VSWN +I GY ++G  +EAL  F ++K   + 
Sbjct  324  TSMVSGYAKSASVKAARLMFTRMMERNIVSWNALIAGYTQNGENEEALGLFLLLKRESVL  383

Query  48   PDDVTMVGVLSACS  7
            P   T   +L+AC+
Sbjct  384  PTHYTFGNLLNACA  397



>gb|ADG37864.1| AT1G13410-like protein [Capsella grandiflora]
Length=185

 Score = 96.3 bits (238),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            V NAL+ MY KCG+I   ++VFE I  +D++SWNTMI G A HG G EAL+ F  MK+ G
Sbjct  3    VKNALIDMYAKCGAIELGMEVFESIKRRDLISWNTMINGLAAHGHGTEALDLFHEMKNCG  62

Query  54   IKPDDVTMVGVLSACSH  4
            I+PD VT VGVL AC H
Sbjct  63   IRPDKVTFVGVLCACKH  79



>ref|XP_007206763.1| hypothetical protein PRUPE_ppa025253mg [Prunus persica]
 gb|EMJ07962.1| hypothetical protein PRUPE_ppa025253mg [Prunus persica]
Length=720

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+G      + N L+ MY KCGS+G A ++F  +   DVVSW+++I+GYA+ G+G+EALE
Sbjct  457  KSGLVLDVTITNGLIDMYTKCGSLGSAQNLFGLMENPDVVSWSSLIVGYAQFGYGEEALE  516

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             FK MK  GIKP++VT+VGVL+ACSH
Sbjct  517  LFKTMKGLGIKPNEVTLVGVLTACSH  542


 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G     + G +L  MY KCG +  A  VF  I   D+VSWN +I G++  G   EA+ 
Sbjct  254  KFGLGRDIFAGCSLCDMYAKCGYLESARTVFYQIERPDLVSWNAIISGFSNGGDANEAIS  313

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
            FF  M+  G+ PD+++++ +LSAC+
Sbjct  314  FFSQMRHKGLVPDEISVLSILSACT  338


 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N +L MY KCGS+ +A  VF+ + E++VVSW ++I G++++    +A+E +  M   G +
Sbjct  62   NHILNMYGKCGSVKDAGKVFDAMPERNVVSWTSLISGHSQNKQEDKAIELYFEMLRSGCR  121

Query  48   PDDVTMVGVLSACS  7
            PD  T   ++ ACS
Sbjct  122  PDHFTFGSIIKACS  135


 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK-MMKDFGI  52
            NAL +MY K G I +A DVF  +  KD++SW +MI G+++ G+ KE+L  FK M+ +   
Sbjct  163  NALTSMYTKFGLIADAFDVFSHVQTKDLISWGSMIAGFSQLGYDKESLGHFKEMLCEGAH  222

Query  51   KPDDVTMVGVLSACS  7
            +P++       SACS
Sbjct  223  QPNEFIFGSAFSACS  237


 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIA-EKDVVSWNTMIIGYARHGFGKEAL  85
            K  ++    V NALL MY KC ++ +A  VFE I    D VSWN +I    +H    E  
Sbjct  355  KRAFDCIVIVCNALLTMYAKCSNLYDAFIVFEDIRNHTDSVSWNAIITSCMQHNQAGEVF  414

Query  84   EFFKMMKDFGIKPDDVTMVGVLSACSH  4
               K+M    IKPD +T+  V+ AC++
Sbjct  415  RLLKLMCSSEIKPDYITLKNVIGACAN  441



>ref|XP_009124630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 
[Brassica rapa]
Length=988

 Score =   101 bits (251),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            +VG +L+ MY KCGSI +A  +F+ I  +++  WN M++G A+HG GKEAL+ F  MK  
Sbjct  652  FVGTSLVDMYAKCGSIDDAYSLFKRIEMRNIAVWNAMLVGLAQHGEGKEALQLFNQMKSL  711

Query  57   GIKPDDVTMVGVLSACSHT  1
            GIKPD VT +GVLSACSH+
Sbjct  712  GIKPDKVTFIGVLSACSHS  730


 Score = 65.1 bits (157),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G++    V N+L+ MYCK   +  A  VF  + E+D++SWN++I G+A+ G   EA+ 
Sbjct  341  KLGFDLKLTVANSLINMYCKLRRVNFARTVFNSMNERDLISWNSVISGFAQSGLDVEAVR  400

Query  81   FFKMMKDFGIKPDDVTMVGVLSA  13
             F  +   G  PD  T+  VL A
Sbjct  401  LFMKLLRCGFTPDHYTVTSVLKA  423


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 29/85 (34%), Positives = 44/85 (52%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY+   +V + +L MY KCG +  A   F  I   D V+W TMI G   +G  + A  
Sbjct  543  KSGYDLDLWVSSGVLDMYVKCGDMRAAQLAFNCIPVPDDVAWTTMISGCIENGEEERAFH  602

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M+  G+ PD+ T+  +  A S
Sbjct  603  VYSQMRLMGVMPDEFTIATLAKASS  627


 Score = 55.8 bits (133),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/81 (32%), Positives = 47/81 (58%), Gaps = 5/81 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFG-----KEALEFFKMMK  64
            N L++MY KCGS+  A  VF+ + E+D+VSWN+++  YA+   G     +E    F++++
Sbjct  79   NNLISMYSKCGSLSYARRVFDEMPERDLVSWNSILAAYAQSSEGFIENVEEGFHIFRILR  138

Query  63   DFGIKPDDVTMVGVLSACSHT  1
               +    +T+  +L  C H+
Sbjct  139  QDVVFTSRMTLAPLLKLCLHS  159


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S  +V  AL+ +Y K G + E  D+FE +  +DVV WN M+  Y   G  +E+++
Sbjct  174  KIGLDSDEFVSGALVNIYLKFGKVKEGRDLFEEMPYRDVVLWNLMLKAYLDMGLKEESVD  233

Query  81   FFKMMKDFGIKPDDVTM  31
                 +  G+ P+++T+
Sbjct  234  LSSAFRRSGLHPNEITL  250



>ref|XP_009412940.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like 
[Musa acuminata subsp. malaccensis]
Length=626

 Score =   100 bits (249),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            SG YVG+AL+ MY KCG+IG A  VF  + ++DV++WN+MI G A +GF +EA + +  M
Sbjct  371  SGVYVGSALVDMYSKCGNIGGARRVFSKMKQRDVITWNSMIAGLAFNGFAQEAFDLYHRM  430

Query  66   KDFGIKPDDVTMVGVLSACSHT  1
            +D  +KP DVT VG+L+AC+HT
Sbjct  431  RDQHLKPTDVTFVGLLTACTHT  452


 Score = 78.2 bits (191),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFG  55
            V  A+L MY KCG++ EA   F+ +  +DVV+W+ MI GYA++G   EALE F+ MK   
Sbjct  274  VRTAVLEMYVKCGAVDEARREFDEMVHRDVVAWSAMIAGYAQNGRPDEALELFERMKAEN  333

Query  54   IKPDDVTMVGVLSACSH  4
             KP++VT+V VLSA + 
Sbjct  334  CKPNEVTLVSVLSASAQ  350


 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N L++ Y K G + EA  +F+ + ++   SWN+MI  YA  G   EAL  F+ M     +
Sbjct  175  NCLISGYSKAGDVVEARRLFDDMTKRTSASWNSMISCYAHSGNFAEALTLFERMLKEKAR  234

Query  48   PDDVTMVGVLSACS  7
            P+++T+V +LS C+
Sbjct  235  PNEITVVTLLSICA  248



>ref|XP_010273504.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X2 [Nelumbo nucifera]
Length=756

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY +  +VGNAL+ MY KCG I  A  VF  I   D++SWN++I GYA +G+GK+A++
Sbjct  484  KIGYVNDLFVGNALITMYAKCGRILSAEQVFNDIDNTDIISWNSLISGYAFNGYGKDAIQ  543

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G+ PD VT VG+LSACSH
Sbjct  544  LFQEMLTEGLNPDQVTFVGLLSACSH  569


 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++A Y + G + +AL +FE + EK++VSWN++I G+ ++G   + L  F +M   G K
Sbjct  394  NTVIAGYAQGGEMNKALRIFEKMEEKNIVSWNSLISGFTQNGLYMDGLRHFVLMGREGKK  453

Query  48   PDDVTMVGVLSACSH  4
            PD  T    LSAC++
Sbjct  454  PDQSTFASSLSACAN  468


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N++LA Y +   +G ALD F+ ++E+DVVSWN +I G+ + G    A++FF+ +      
Sbjct  177  NSMLAAYIQNEEMGLALDFFDKMSERDVVSWNLVIDGFMQIGDLDSAMQFFQRIP----S  232

Query  48   PDDVTMVGVLSA  13
            P+ ++ V +LS 
Sbjct  233  PNVISWVTMLSG  244


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N++++ Y K G I +A ++FE +  +++VSWNTMI GY  +    EA E F+ M
Sbjct  52   NSMISAYAKNGRINDARNLFEQMPLRNLVSWNTMISGYLHNDKVHEAAELFERM  105



>ref|XP_006842247.1| hypothetical protein AMTR_s00078p00195340 [Amborella trichopoda]
 gb|ERN03922.1| hypothetical protein AMTR_s00078p00195340 [Amborella trichopoda]
Length=907

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G E    VG+AL+ MY KCGSI +A+ +F+ I  + +VSWNT+I GYA+HG+ KEAL+ F
Sbjct  607  GLELDASVGDALIDMYAKCGSIIDAMAMFKKIPVRSMVSWNTIITGYAQHGYAKEALDLF  666

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            + MK  GIKPD +T V VLSACSH
Sbjct  667  EEMKKEGIKPDHITYVAVLSACSH  690


 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+     +GN+++  Y KCG I  A   F+ +  +D  SW  +I GYAR+G G EAL 
Sbjct  503  KTGFGIDIILGNSIINFYIKCGDIKCAWRNFKAMQRRDSASWEMIISGYARNGNGNEALR  562

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             F+ M  +G++ + + ++ VL  C+
Sbjct  563  LFREMHRYGMRANRLALISVLKGCA  587


 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKD-VVSWNTMIIGYARHGFGKEAL  85
            K G+    ++   LL MY KCGS+ ++L +F  +++KD +VSWN++I G   +GF  EA 
Sbjct  101  KTGFCCDGFLEIGLLDMYAKCGSVKDSLLIFNLMSKKDCLVSWNSIISGLVHNGFVDEAF  160

Query  84   EFFKMMKDFGIKPDDVTMVGVLSA  13
              +K M   G+ PD VTM  VLSA
Sbjct  161  SLYKEMNYRGLLPDIVTMRIVLSA  184


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G+    +V N+LL MY   G I  A  +F  +   DVVS N MI GY R+ + KEAL+
Sbjct  402  KLGFGFNIFVTNSLLNMYINFGHIKRAQKLFFLMPFHDVVSLNVMISGYCRNSWRKEALD  461

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
               +    G+ PD  T   +L AC++
Sbjct  462  LLSLEYRRGLIPDQFTFATILGACTN  487


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K  ++S   + NAL+ MY KCGS+  A  +F  + +KD+VSW  ++ G+ R+   KEA +
Sbjct  301  KTRWKSDVSIANALITMYAKCGSVSSANRIFFQMGDKDLVSWTAIVSGHLRNKQFKEAFK  360

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
                  + GI  D   +  ++ AC+
Sbjct  361  LLSYFGETGINLDQHFIATIIGACT  385


 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G+++   + N LL MY K G + E   +F+ +  +D++SW+T+I     +GF   ALE F
Sbjct  2    GFQAEIVLSNVLLDMYGKAGLMTEMHQLFDEMPTQDLISWSTVISRCTHNGFSIGALELF  61

Query  75   KMMKDFGIKPDDVTMVGVLSACS  7
            + M + G+KP+      ++ AC+
Sbjct  62   EKMYNSGLKPNQFVFASMVKACA  84


 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +S   +   LL +  K G +     +FE +   D+ +++ ++ GY  +G+ +EA++
Sbjct  203  KTGLDSDDVLVIELLKLQAKLGEVANMRKLFETMKNPDLNTFSVLVSGYLHNGYQEEAVK  262

Query  81   FFKMMKDFGIKPDDVTMVGVLSAC  10
              + M+ FG KP+   ++ +L  C
Sbjct  263  VTRKMRIFGSKPNQGALISLLGLC  286



>ref|XP_004141894.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic-like [Cucumis sativus]
 ref|XP_004164238.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, 
chloroplastic-like [Cucumis sativus]
 gb|KGN48568.1| hypothetical protein Csa_6G492280 [Cucumis sativus]
Length=645

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G +   +VG AL+ MY KCGS+ +A  VF+ I +KDVV+WN+MI+GYA HGF + AL+ F
Sbjct  303  GIQINVHVGTALIDMYSKCGSLEDARLVFDRIRDKDVVAWNSMIVGYAMHGFSQHALQLF  362

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            + M + G KP D+T +G+LSAC H
Sbjct  363  EEMTETGHKPTDITFIGILSACGH  386


 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
              +L  Y K G + +A  +FEG+ E+DVV WN MI GYA+ G   E+L+ F+ M      
Sbjct  211  TTMLTCYSKMGELDKARSLFEGMKERDVVCWNVMIGGYAQSGVPNESLKLFRRMLVAKAI  270

Query  48   PDDVTMVGVLSAC  10
            P++VT++ VLSAC
Sbjct  271  PNEVTVLAVLSAC  283



>ref|XP_009778667.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 
[Nicotiana sylvestris]
Length=624

 Score =   100 bits (249),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 42/85 (49%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G++    + NAL+ MY +CG I +A +VF+G+A+KDVVSW+ MI G A +G+G++A+E F
Sbjct  282  GFDKAINICNALITMYSRCGCIEKAFEVFKGVAKKDVVSWSAMISGLASNGYGRDAIEAF  341

Query  75   KMMKDFGIKPDDVTMVGVLSACSHT  1
              M+  G+ PDD T  GVL+ACSH+
Sbjct  342  SEMQRSGVSPDDQTFTGVLNACSHS  366


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/87 (30%), Positives = 47/87 (54%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+ S   +   L+  Y       EA  VF+ ++ +D V+WN +I  Y R+   ++AL 
Sbjct  178  RDGHHSDGRLLTTLMDFYSSNEKYSEACKVFDEMSHRDTVAWNVLISCYLRNRRTRDALR  237

Query  81   FFKMMKDFG-IKPDDVTMVGVLSACSH  4
             F M++     +PD+VT + +L AC++
Sbjct  238  LFDMIRSLSECQPDEVTCLLLLQACAN  264



>ref|XP_003547890.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like 
[Glycine max]
Length=619

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GY+   +VGNAL+ MY KCG I +ALDVF+G+  KD+++WNT+I G A HG   +AL  F
Sbjct  357  GYKGNLFVGNALIDMYAKCGVIEKALDVFDGLDVKDIITWNTIINGLAMHGHVADALSLF  416

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            + MK  G +PD VT VG+LSAC+H
Sbjct  417  ERMKRAGERPDGVTFVGILSACTH  440


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 11/86 (13%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM------  67
            N +L+ Y   G +   + +FE +  ++V SWN +I GY R+G  KEALE FK M      
Sbjct  254  NTVLSGYATNGEVESFVKLFEEMPVRNVYSWNGLIGGYVRNGLFKEALECFKRMLVLVEG  313

Query  66   -----KDFGIKPDDVTMVGVLSACSH  4
                  D  + P+D T+V VL+ACS 
Sbjct  314  EGKEGSDGVVVPNDYTVVAVLTACSR  339



>gb|AFG58307.1| hypothetical protein 0_9722_01, partial [Pinus taeda]
Length=151

 Score = 95.5 bits (236),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G +S   V N+LL MY KCGS+ +A  VF  +  +DVVSWN MI+GYA HG GKEAL+
Sbjct  35   RSGLQSYVTVENSLLDMYAKCGSLEDARKVFNRMTTRDVVSWNAMIVGYAIHGCGKEALQ  94

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ MK     PD VT +GVLSA  H
Sbjct  95   LFEQMKHTDTGPDHVTFIGVLSATCH  120



>ref|XP_006651199.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37170-like 
[Oryza brachyantha]
Length=637

 Score =   100 bits (249),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K+GY   C+  +AL+ MY KCG +G A+ VFE  A+ D+VSW  +I GYA++G  +EAL 
Sbjct  293  KSGYGDSCFAESALVRMYSKCGDMGNAVRVFEATAKPDLVSWTAVISGYAQNGQPEEALR  352

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
            +F M    GI+PD VT VGVLSAC+H
Sbjct  353  YFDMFLRSGIRPDHVTFVGVLSACAH  378


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE-FFKMMKDFGI  52
            +AL  MY KCG + +A  VF+ +  +D VSW  M+  Y   G G E    F  M++  G+
Sbjct  202  SALADMYAKCGRVDDARRVFDRMPVRDAVSWTAMVERYFDGGRGGEGFRLFLHMLRAGGV  261

Query  51   KPDDVTMVGVLSACS  7
            +P++ T  GVL AC+
Sbjct  262  RPNEFTYAGVLRACA  276



>ref|XP_002273989.2| PREDICTED: pentatricopeptide repeat-containing protein At2g37320 
[Vitis vinifera]
Length=510

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/84 (49%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            G++S  +V NAL++MYCKCG++ +A  +FE +  KD+VSWN+MI G+A+HG   +A++ F
Sbjct  244  GFDSYVHVANALISMYCKCGNVEDAYYIFERMDGKDIVSWNSMIAGHAQHGLAVQAIDLF  303

Query  75   KMMKDFGIKPDDVTMVGVLSACSH  4
            + MK   +KPD +T +GVLS+C H
Sbjct  304  EEMKKQKLKPDAITFLGVLSSCRH  327


 Score = 70.1 bits (170),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            + G+    YVG+ L++ Y KCG +  A  VFE +  K+VVSW  +I G+A+       LE
Sbjct  141  RTGFVGNVYVGSCLISFYSKCGELCHAYRVFEEMPVKNVVSWTAIIAGFAQEWLVDGCLE  200

Query  81   FFKMMKDFGIKPDDVTMVGVLSACS  7
             +  M++  +KP+D+T   +LS C+
Sbjct  201  LYSRMRNSTLKPNDLTFTCLLSTCT  225



>ref|XP_010468211.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610-like 
[Camelina sativa]
Length=783

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GY +   + NAL+ MY KCG +  A+ VF+ + ++D+VSWNTM+ G+  HG GKEAL  F
Sbjct  440  GYSAYTSICNALMDMYTKCGKLDVAMRVFDTMHKRDIVSWNTMLFGFGIHGLGKEALSLF  499

Query  75   KMMKDFGIKPDDVTMVGVLSACSHT  1
            K M+D G+ PD+VT + +LSACSH+
Sbjct  500  KSMRDTGVNPDEVTFLAILSACSHS  524


 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -2

Query  255  GYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFF  76
            GY +   + NAL+ MY KCG +  A+ VF+ + ++D+VSWNTM+ G+  HG GKEAL  F
Sbjct  568  GYSAYTSICNALMDMYTKCGKLDVAMRVFDTMHKRDIVSWNTMLFGFGIHGLGKEALSLF  627

Query  75   KMMKDFGIKPDDVTMVGVLSACSHT  1
            K M+D G+ PD+VT + +LSACSH+
Sbjct  628  KSMRDTGVNPDEVTFLAILSACSHS  652


 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            KAG+     VGN +++ Y K GS+ +A   F  I  KDV+S+N++I G   +   +E+L 
Sbjct  337  KAGFMLDLTVGNTIISFYAKYGSLCDAFKQFSEIGLKDVISYNSLISGCVENCRPEESLR  396

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F  MK  G++PD  T++GVL+ACSH
Sbjct  397  LFHDMKSSGVRPDITTLLGVLNACSH  422


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 2/82 (2%)
 Frame = -2

Query  252  YESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFK  73
            + +  YV  AL+  Y KCG +  AL VF+ + + D+VSWN MI G++ H    + +  F 
Sbjct  134  FTTDMYVCTALVDFYAKCGELDMALQVFDKMPKIDIVSWNAMISGFSLHCSLTDVIGLFL  193

Query  72   MMKDF--GIKPDDVTMVGVLSA  13
             M+    G++P+  T+VG+  A
Sbjct  194  DMRRSSDGLRPNLSTIVGMFPA  215



>ref|XP_010273499.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010273500.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010273501.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010273502.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010273503.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like 
isoform X1 [Nelumbo nucifera]
Length=756

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/86 (52%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K GY +  +VGNAL+ MY KCG I  A  VF  I   D++SWN++I GYA +G+GK+A++
Sbjct  484  KIGYVNDLFVGNALITMYAKCGRILSAEQVFNDIDNTDIISWNSLISGYAFNGYGKDAIQ  543

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSH  4
             F+ M   G+ PD VT VG+LSACSH
Sbjct  544  LFQEMLTEGLNPDQVTFVGLLSACSH  569


 Score = 65.5 bits (158),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N ++A Y + G + +AL +FE + EK++VSWN++I G+ ++G   + L  F +M   G K
Sbjct  394  NTVIAGYAQGGEMNKALRIFEKMEEKNIVSWNSLISGFTQNGLYMDGLRHFVLMGREGKK  453

Query  48   PDDVTMVGVLSACSH  4
            PD  T    LSAC++
Sbjct  454  PDQSTFASSLSACAN  468


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 45/72 (63%), Gaps = 4/72 (6%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDFGIK  49
            N++LA Y +   +G ALD F+ ++E+DVVSWN +I G+ + G    A++FF+ +      
Sbjct  177  NSMLAAYIQNEEMGLALDFFDKMSERDVVSWNLVIDGFMQIGDLDSAMQFFQRIP----S  232

Query  48   PDDVTMVGVLSA  13
            P+ ++ V +LS 
Sbjct  233  PNVISWVTMLSG  244


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMM  67
            N++++ Y K G I +A ++FE +  +++VSWNTMI GY  +    EA E F+ M
Sbjct  52   NSMISAYAKNGRINDARNLFEQMPLRNLVSWNTMISGYLHNDKVHEAAELFERM  105



>ref|XP_009136220.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 
[Brassica rapa]
Length=699

 Score =   100 bits (250),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            ++G E+  +VGN+L+ MY KCG + +   VF  + E+D VSWN MI+G+A++G+G EALE
Sbjct  418  RSGEETDIFVGNSLIDMYVKCGCVEDGYLVFRKMVERDRVSWNAMIVGFAQNGYGNEALE  477

Query  81   FFK-MMKDFGIKPDDVTMVGVLSACSH  4
             F+ M+   G KPD +TM+GVLSAC H
Sbjct  478  LFREMLGGSGEKPDHITMIGVLSACGH  504


 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = -2

Query  246  SGCYVGNALLAMYCKCGSIGEALDVFEGI-AEKDVVSWNTMIIGYARHGFGKEALEFFKM  70
            S  ++G+AL+ MY KCG + EA   F+ +   ++VV+WN++I  Y ++G  +EAL  F +
Sbjct  182  SDVHIGSALVDMYSKCGHVDEAQQCFDELRGYRNVVTWNSLITCYEQNGPVEEALTVFNL  241

Query  69   MKDFGIKPDDVTMVGVLSACS  7
            M   G +PD+VT+  V+SAC+
Sbjct  242  MLRSGFEPDEVTLASVISACA  262


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/107 (28%), Positives = 47/107 (44%), Gaps = 31/107 (29%)
 Frame = -2

Query  234  VGNALLAMYCKCGSIGEALDVFEGI-------------------------------AEKD  148
            + NA + MY KCG + EA  VF+ +                                E++
Sbjct  289  LSNAFVDMYAKCGRVKEARIVFDSMPIRNAIAETSMISGYAMAASTKAARLMFAKMTERN  348

Query  147  VVSWNTMIIGYARHGFGKEALEFFKMMKDFGIKPDDVTMVGVLSACS  7
            VVSWN +I GY ++G  +EA+  F+ +K   + P   T   +L AC+
Sbjct  349  VVSWNALIAGYTQNGENEEAVGLFRQLKRESVSPTHYTFANILKACA  395


 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 0/77 (0%)
 Frame = -2

Query  237  YVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALEFFKMMKDF  58
            Y  N L+    K G + EA  +F  + E+D  +WN+M+ G+A+    +EAL +   M   
Sbjct  83   YTWNTLVTALAKLGLLDEADSLFRSMPERDQCTWNSMVSGFAQRDRCEEALRYLASMHKE  142

Query  57   GIKPDDVTMVGVLSACS  7
            G   ++ ++   LSACS
Sbjct  143  GFSLNEYSLASGLSACS  159



>ref|XP_002439788.1| hypothetical protein SORBIDRAFT_09g020050 [Sorghum bicolor]
 gb|EES18218.1| hypothetical protein SORBIDRAFT_09g020050 [Sorghum bicolor]
Length=551

 Score =   100 bits (248),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = -2

Query  261  KAGYESGCYVGNALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYARHGFGKEALE  82
            K G +SG  V NAL++MY KCGS  ++L VF  + E+D+ +WNT+I GYA+HG G+EA++
Sbjct  459  KLGMDSGLVVANALVSMYFKCGS-ADSLMVFYSMEERDIFTWNTIITGYAQHGLGREAIK  517

Query  81   FFKMMKDFGIKPDDVTMVGVLSACSHT  1
             +++M   G+ P++VT VG+L ACSH+
Sbjct  518  MYQLMISAGVLPNEVTFVGLLHACSHS  544


 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 43/78 (55%), Gaps = 6/78 (8%)
 Frame = -2

Query  228  NALLAMYCKCGSIGEALDVFEGIAEKDVVSWNTMIIGYA---RHGFGKEALEFFKMMKDF  58
            N +L  YC    + +A ++FE + E+++VSW  MI GY    +HG   +A + F  M   
Sbjct  158  NTMLTGYCHSQLMVDARNLFELMPERNMVSWTVMISGYVLIEQHG---KAWDMFHTMLCE  214

Query  57   GIKPDDVTMVGVLSACSH  4
            G+ P+   +V VLSA  H
Sbjct  215  GMPPEQPNLVSVLSAVRH  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 523274929020