BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c102687_g1_i1 len=116 path=[1:0-115]

Length=116
                                                                      Score     E

dbj|BAA14024.1|  ipomoelin                                            55.5    2e-08   Ipomoea batatas [batate]
pdb|3R50|A  Chain A, Structure Analysis Of A Wound-Inducible Lect...  55.5    2e-08   
gb|AAG10403.1|AF233284_1  mannose-binding lectin                      52.8    2e-07   Convolvulus arvensis
gb|EEE52450.1|  hypothetical protein OsJ_34606                        49.7    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066367.1|  Os12g0198700                                     49.3    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232946.1|  PREDICTED: uncharacterized protein LOC104583002  48.5    3e-05   
ref|NP_001066495.1|  Os12g0247700                                     48.9    3e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69076.1|  hypothetical protein OsI_37951                        48.1    4e-05   Oryza sativa Indica Group [Indian rice]
gb|AAC49564.1|  lectin                                                46.2    4e-05   Calystegia sepium
pdb|1OUW|A  Chain A, Crystal Structure Of Calystegia Sepium Agglu...  46.2    5e-05   
gb|EEE52196.1|  hypothetical protein OsJ_34075                        48.9    5e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68269.1|  hypothetical protein OsI_36304                        48.9    5e-05   Oryza sativa Indica Group [Indian rice]
gb|AAA87042.1|  putative 32.7 kDa jasmonate-induced protein           47.8    5e-05   Hordeum vulgare [barley]
gb|ABA94002.1|  Jacalin-like lectin domain containing protein, ex...  48.9    5e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004980207.1|  PREDICTED: mannose/glucose-specific lectin-like  45.4    5e-05   
ref|XP_010230396.1|  PREDICTED: jacalin-related lectin 3-like         47.4    6e-05   
ref|XP_006663484.1|  PREDICTED: putative disease resistance RPP13...  48.5    6e-05   
gb|EAY82651.1|  hypothetical protein OsI_37872                        47.8    6e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_004964114.1|  PREDICTED: mannose/glucose-specific lectin-like  45.4    8e-05   
emb|CDM80401.1|  unnamed protein product                              47.0    8e-05   
gb|EMT31922.1|  hypothetical protein F775_02779                       45.4    1e-04   
gb|ABA94732.1|  Jacalin-like lectin domain containing protein, ex...  47.4    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004298563.1|  PREDICTED: myrosinase-binding protein-like A...  47.0    1e-04   
ref|XP_006853910.1|  hypothetical protein AMTR_s00036p00183430        45.4    2e-04   
gb|EEC68267.1|  hypothetical protein OsI_36302                        47.4    2e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010099937.1|  hypothetical protein L484_020125                 46.6    2e-04   
gb|EMS66150.1|  hypothetical protein TRIUR3_12251                     46.2    2e-04   
gb|ABA94728.1|  Jacalin-like lectin domain containing protein         46.6    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AGT16237.1|  Jacalin-like lectin domain containing protein         45.8    4e-04   
gb|AGT16242.1|  Jacalin-like lectin domain containing protein         45.8    4e-04   
ref|XP_010232948.1|  PREDICTED: jacalin-related lectin 19-like        45.1    4e-04   
pdb|3P8S|A  Chain A, Crystal Structure Of Single Chain Recombinan...  43.1    7e-04   
ref|XP_002461768.1|  hypothetical protein SORBIDRAFT_02g007760        44.7    7e-04   Sorghum bicolor [broomcorn]
ref|XP_008677991.1|  PREDICTED: mannose/glucose-specific lectin-l...  45.4    7e-04   
ref|XP_008677990.1|  PREDICTED: mannose/glucose-specific lectin-l...  45.4    7e-04   
ref|XP_008677986.1|  PREDICTED: mannose/glucose-specific lectin-l...  45.4    7e-04   
pdb|1TOQ|A  Chain A, Crystal Structure Of A Galactose Specific Le...  42.7    8e-04   
ref|XP_008677992.1|  PREDICTED: mannose/glucose-specific lectin-l...  45.4    8e-04   
ref|XP_006663483.1|  PREDICTED: probable disease resistance RPP8-...  45.4    8e-04   
ref|XP_010932856.1|  PREDICTED: mannose/glucose-specific lectin-l...  44.3    8e-04   
gb|EMT11070.1|  hypothetical protein F775_02114                       44.7    8e-04   
sp|P18670.2|LECA_ARTIN  RecName: Full=Agglutinin alpha chain; Alt...  42.7    8e-04   Artocarpus integer [campedak]
gb|AAB22274.1|  jacalin heavy chain, agglutinin heavy chain=Thoms...  42.7    8e-04   
pdb|1UGW|A  Chain A, Crystal Structure Of Jacalin- Gal Complex        42.7    8e-04   
ref|XP_004291831.1|  PREDICTED: uncharacterized protein LOC101310192  45.1    8e-04   
ref|XP_010099935.1|  hypothetical protein L484_020123                 43.5    0.001   



>dbj|BAA14024.1| ipomoelin [Ipomoea batatas]
Length=154

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+KFTTN + +GPYG N G PFN+   +GNKIVGFFG
Sbjct  101  RSIKFTTNKKEYGPYGANAGTPFNIKIPDGNKIVGFFG  138



>pdb|3R50|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|E Chain E, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
Length=160

 Score = 55.5 bits (132),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+KFTTN + +GPYG N G PFN+   +GNKIVGFFG
Sbjct  107  RSIKFTTNKKEYGPYGANAGTPFNIKIPDGNKIVGFFG  144



>gb|AAG10403.1|AF233284_1 mannose-binding lectin [Convolvulus arvensis]
Length=152

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+KF TNL+ +GPYGPNVG PF+     GN+IVGF G
Sbjct  99   RSIKFITNLKAYGPYGPNVGTPFSSENVVGNEIVGFLG  136



>gb|EEE52450.1| hypothetical protein OsJ_34606 [Oryza sativa Japonica Group]
Length=370

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +1

Query  4    SVKFTTNL-RVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+KFTTNL R +GPYG   G PF +P ++   IVGFFG
Sbjct  316  SLKFTTNLNRTYGPYGKGGGTPFVVPVEDAASIVGFFG  353



>ref|NP_001066367.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|ABA96667.1| jasmonate-induced protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29386.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|EAY82558.1| hypothetical protein OsI_37779 [Oryza sativa Indica Group]
 gb|EAZ19941.1| hypothetical protein OsJ_35533 [Oryza sativa Japonica Group]
Length=307

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+KF TN + +GP+G   G PF++P QN + IVGFFG
Sbjct  254  RSIKFVTNKKTYGPFGRQEGTPFSVPVQNNSTIVGFFG  291



>ref|XP_010232946.1| PREDICTED: uncharacterized protein LOC104583002 [Brachypodium 
distachyon]
Length=250

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            +S+ F +N R +GPYG + G PF LPA  G +IVGF G
Sbjct  174  KSLTFVSNRRTYGPYGEDHGVPFELPAPAGGRIVGFHG  211



>ref|NP_001066495.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|ABA97248.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABB51090.1| mannose-specific jacalin-related lectin [Oryza sativa Japonica 
Group]
 dbj|BAF29514.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|EAZ20117.1| hypothetical protein OsJ_35712 [Oryza sativa Japonica Group]
Length=306

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+ F TN + +GP+G   G PF++PAQN + IVGFFG
Sbjct  254  SINFITNKQTYGPFGRQEGTPFSVPAQNNSSIVGFFG  290



>gb|EEC69076.1| hypothetical protein OsI_37951 [Oryza sativa Indica Group]
Length=250

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ F TN + +GP+G   G PF++PAQN + +VGFFG
Sbjct  197  RSINFITNKQTYGPFGRQEGTPFSVPAQNNSSVVGFFG  234



>gb|AAC49564.1| lectin [Calystegia sepium]
Length=153

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ FTTNL+  GPYG  VG PF+     GN+IVGF G
Sbjct  100  RSITFTTNLKAHGPYGQKVGTPFSSANVVGNEIVGFLG  137



>pdb|1OUW|A Chain A, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|B Chain B, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|C Chain C, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|D Chain D, Crystal Structure Of Calystegia Sepium Agglutinin
Length=152

 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ FTTNL+  GPYG  VG PF+     GN+IVGF G
Sbjct  99   RSITFTTNLKAHGPYGQKVGTPFSSANVVGNEIVGFLG  136



>gb|EEE52196.1| hypothetical protein OsJ_34075 [Oryza sativa Japonica Group]
Length=1431

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  4     SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
             S+ F TN + +GP+G   G PF++P Q G +IVGFFG
Sbjct  1068  SLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFG  1104



>gb|EEC68269.1| hypothetical protein OsI_36304 [Oryza sativa Indica Group]
Length=1419

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  4     SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
             S+ F TN + +GP+G   G PF++P Q G +IVGFFG
Sbjct  1068  SLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFG  1104



>gb|AAA87042.1| putative 32.7 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72097.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+KF TN++ +GP+G   G PF +PAQ  + IVGFFG
Sbjct  252  SLKFITNVKTYGPFGEAKGTPFTIPAQKNSSIVGFFG  288



>gb|ABA94002.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=1386

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +1

Query  4     SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
             S+ F TN + +GP+G   G PF++P Q G +IVGFFG
Sbjct  1023  SLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFG  1059



>ref|XP_004980207.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=75

 Score = 45.4 bits (106),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 1/38 (3%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGR-PFNLPAQNGNKIVGFFG  114
            S+KF TNLR  GPYG   GR PF+LP +    IVGFFG
Sbjct  21   SLKFITNLRTCGPYGKETGRTPFSLPEKKNGTIVGFFG  58



>ref|XP_010230396.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
 ref|XP_010230397.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
Length=246

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            R++ F +N R  GPYG + G  F LPA  G KIVGF G
Sbjct  193  RALTFVSNRRTIGPYGTDEGMEFELPAAGGGKIVGFHG  230



>ref|XP_006663484.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Oryza brachyantha]
Length=1366

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/37 (54%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  4     SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
             S+ F TN R +GPYG   G PF++P Q    IVGFFG
Sbjct  1001  SLTFVTNTRSYGPYGQRKGTPFDIPVQGSGCIVGFFG  1037


 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 18/37 (49%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +1

Query  4     SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
             S+   TN+  +GP+G   G PFN P Q   +IVGFFG
Sbjct  1156  SITLVTNVGCYGPFGQENGIPFNFPVQGNGRIVGFFG  1192



>gb|EAY82651.1| hypothetical protein OsI_37872 [Oryza sativa Indica Group]
Length=304

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+KF TN++ +GP+G   G PF++P QN + +VGFFG
Sbjct  252  SIKFVTNVKTYGPFGKQNGTPFSIPVQNNSSVVGFFG  288



>ref|XP_004964114.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=118

 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFF  111
            S+KF TN+R FGP+   +G PF++P Q+ + IVGFF
Sbjct  66   SLKFVTNVRTFGPWSRGIGTPFSVPVQSRSGIVGFF  101



>emb|CDM80401.1| unnamed protein product [Triticum aestivum]
Length=267

 Score = 47.0 bits (110),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 25/38 (66%), Gaps = 1/38 (3%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ F +N R +GPYG   G PF LPA  G +IVGF G
Sbjct  214  RSLTFISNRRTYGPYGKEEGAPFELPAA-GGRIVGFHG  250



>gb|EMT31922.1| hypothetical protein F775_02779 [Aegilops tauschii]
Length=185

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            ++ F +NLR FGPYG   G PF+LPA  G KIVGF G
Sbjct  88   TLTFISNLRTFGPYGTREGPPFDLPAA-GGKIVGFHG  123



>gb|ABA94732.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=597

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +1

Query  4    SVKFTTNL-RVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+KFTTNL R +GPYG   G PF +P ++   IVGFFG
Sbjct  543  SLKFTTNLNRTYGPYGKGGGTPFVVPVEDAASIVGFFG  580



>ref|XP_004298563.1| PREDICTED: myrosinase-binding protein-like At2g25980-like [Fragaria 
vesca subsp. vesca]
Length=379

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+KF TN R FGP+G  VG PF    ++G KIVGF G
Sbjct  137  RSLKFETNKRTFGPFGVEVGTPFTFRVKDGVKIVGFKG  174



>ref|XP_006853910.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
 gb|ERN15377.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
Length=191

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+KFTTN+R +GPYG   G PF+ P  +G  IVGF G
Sbjct  112  RSLKFTTNMRTYGPYGVEEGTPFSCP-MDGGLIVGFKG  148



>gb|EEC68267.1| hypothetical protein OsI_36302 [Oryza sativa Indica Group]
Length=1396

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  4     SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
             S+ F TN + +GPYG   G PF++P Q+   IVGFFG
Sbjct  1034  SLTFVTNAQSYGPYGQREGTPFHIPVQSSGCIVGFFG  1070



>ref|XP_010099937.1| hypothetical protein L484_020125 [Morus notabilis]
 gb|EXB80866.1| hypothetical protein L484_020125 [Morus notabilis]
Length=351

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 25/38 (66%), Gaps = 1/38 (3%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ F TN   +GPYG   G PFNLP QNG  IVGF G
Sbjct  166  RSLTFKTNKATYGPYGTTSGTPFNLPIQNG-LIVGFKG  202



>gb|EMS66150.1| hypothetical protein TRIUR3_12251 [Triticum urartu]
Length=307

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+KF TN++ +GP+G   G PF +P +N + IVGFFG
Sbjct  255  SLKFITNVKAYGPFGEANGTPFTIPVENNSSIVGFFG  291



>gb|ABA94728.1| Jacalin-like lectin domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ12138.1| hypothetical protein OsJ_02021 [Oryza sativa Japonica Group]
Length=837

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            SV F TN+R +GP+G   G PF++P Q+  KIVGFFG
Sbjct  785  SVTFVTNVRSYGPFGQGGGTPFDVPMQSNGKIVGFFG  821



>gb|AGT16237.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
 gb|AGT16239.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
Length=461

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+   TN R +GP+G   GRPF +P Q  + IVGFFG
Sbjct  379  SLTLVTNARSYGPFGHGGGRPFQVPMQGNSSIVGFFG  415



>gb|AGT16242.1| Jacalin-like lectin domain containing protein [Saccharum hybrid 
cultivar R570]
Length=561

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+   TN R +GP+G   GRPF +P Q  + IVGFFG
Sbjct  479  SLTLVTNARSYGPFGHGGGRPFQVPMQGNSSIVGFFG  515



>ref|XP_010232948.1| PREDICTED: jacalin-related lectin 19-like [Brachypodium distachyon]
Length=266

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = +1

Query  1    RSVKFTTNLR-VFGPYGPNVGRPFNLPAQ-NGNKIVGFFG  114
            RS+ F TN R  FGPYG   G PF LPA   G +I+GFFG
Sbjct  211  RSLTFVTNARRSFGPYGKEEGVPFALPAAVAGGRIIGFFG  250



>pdb|3P8S|A Chain A, Crystal Structure Of Single Chain Recombinant Jacalin 
Showing Highly Dynamic Posttranslational Excission Loop That 
Reduces Binding Affinity
 pdb|3P8S|B Chain B, Crystal Structure Of Single Chain Recombinant Jacalin 
Showing Highly Dynamic Posttranslational Excission Loop That 
Reduces Binding Affinity
Length=157

 Score = 43.1 bits (100),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 1/38 (3%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ F TN + +GPYG   G PFNLP +NG  IVGF G
Sbjct  106  RSLTFKTNKKTYGPYGVTSGTPFNLPIENG-LIVGFKG  142



>ref|XP_002461768.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
 gb|EER98289.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
Length=361

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+KF TNL+ +GP+G     PF +P Q G+ IVGFF 
Sbjct  253  SIKFVTNLQTYGPWGDGQDAPFTIPVQPGSGIVGFFA  289



>ref|XP_008677991.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Zea 
mays]
Length=778

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+ F TN R +GP+G   G PF++  QN  +IVGFFG
Sbjct  369  SLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFG  405



>ref|XP_008677990.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Zea 
mays]
Length=781

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+ F TN R +GP+G   G PF++  QN  +IVGFFG
Sbjct  367  SLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFG  403



>ref|XP_008677986.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677987.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677988.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677989.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
Length=783

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+ F TN R +GP+G   G PF++  QN  +IVGFFG
Sbjct  369  SLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFG  405



>pdb|1TOQ|A Chain A, Crystal Structure Of A Galactose Specific Lectin From 
Artocarpus Hirsuta In Complex With Methyl-a-d-galactose
 pdb|1TOQ|C Chain C, Crystal Structure Of A Galactose Specific Lectin From 
Artocarpus Hirsuta In Complex With Methyl-a-d-galactose
 pdb|1TOQ|E Chain E, Crystal Structure Of A Galactose Specific Lectin From 
Artocarpus Hirsuta In Complex With Methyl-a-d-galactose
 pdb|1TOQ|G Chain G, Crystal Structure Of A Galactose Specific Lectin From 
Artocarpus Hirsuta In Complex With Methyl-a-d-galactose
 pdb|1TP8|A Chain A, Crystal Structure Of A Galactose Specific Lectin From 
Artocarpus Hirsuta In Complex With Methyl-A-D-Galactose
 pdb|1TP8|C Chain C, Crystal Structure Of A Galactose Specific Lectin From 
Artocarpus Hirsuta In Complex With Methyl-A-D-Galactose
 pdb|1TP8|E Chain E, Crystal Structure Of A Galactose Specific Lectin From 
Artocarpus Hirsuta In Complex With Methyl-A-D-Galactose
 pdb|1TP8|G Chain G, Crystal Structure Of A Galactose Specific Lectin From 
Artocarpus Hirsuta In Complex With Methyl-A-D-Galactose
Length=133

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 1/38 (3%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ F TN + +GPYG   G PFNLP +NG  IVGF G
Sbjct  82   RSLTFKTNKKTYGPYGVTSGTPFNLPIENG-LIVGFKG  118



>ref|XP_008677992.1| PREDICTED: mannose/glucose-specific lectin-like isoform X4 [Zea 
mays]
Length=760

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+ F TN R +GP+G   G PF++  QN  +IVGFFG
Sbjct  346  SLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFG  382



>ref|XP_006663483.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Oryza brachyantha]
Length=1368

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = +1

Query  4     SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
             S+ F TN   +GPYG   G PF++P Q+   IVGFFG
Sbjct  1005  SLTFVTNAHSYGPYGKIEGTPFHMPVQSNGCIVGFFG  1041



>ref|XP_010932856.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Elaeis 
guineensis]
Length=271

 Score = 44.3 bits (103),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/37 (57%), Positives = 26/37 (70%), Gaps = 1/37 (3%)
 Frame = +1

Query  4    SVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            S+ F T +  +GPYGPN G  F+LP + G KIVGFFG
Sbjct  215  SLTFVTTMSTYGPYGPNEGTAFSLPMRAG-KIVGFFG  250



>gb|EMT11070.1| hypothetical protein F775_02114 [Aegilops tauschii]
Length=332

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGF  108
            RS+ F +NLR +GPYG   G PF L A  G KI+GF
Sbjct  277  RSLTFVSNLRSYGPYGKEDGVPFALHAGPGGKIIGF  312



>sp|P18670.2|LECA_ARTIN RecName: Full=Agglutinin alpha chain; AltName: Full=Jacalin alpha 
chain [Artocarpus integer]
 pdb|1JAC|A Chain A, A Novel Mode Of Carbohydrate Recognition In Jacalin, 
A Moraceae Plant Lectin With A Beta-Prism
 pdb|1JAC|C Chain C, A Novel Mode Of Carbohydrate Recognition In Jacalin, 
A Moraceae Plant Lectin With A Beta-Prism
 pdb|1JAC|E Chain E, A Novel Mode Of Carbohydrate Recognition In Jacalin, 
A Moraceae Plant Lectin With A Beta-Prism
 pdb|1JAC|G Chain G, A Novel Mode Of Carbohydrate Recognition In Jacalin, 
A Moraceae Plant Lectin With A Beta-Prism
 pdb|1KU8|A Chain A, Crystal Structure Of Jacalin
 pdb|1KU8|C Chain C, Crystal Structure Of Jacalin
 pdb|1KU8|E Chain E, Crystal Structure Of Jacalin
 pdb|1KU8|G Chain G, Crystal Structure Of Jacalin
 pdb|1KUJ|A Chain A, Crystal Structure Of Jacalin Complexed With 1-o-methyl- 
Alpha-d-mannose
 pdb|1KUJ|C Chain C, Crystal Structure Of Jacalin Complexed With 1-o-methyl- 
Alpha-d-mannose
 pdb|1KUJ|E Chain E, Crystal Structure Of Jacalin Complexed With 1-o-methyl- 
Alpha-d-mannose
 pdb|1KUJ|G Chain G, Crystal Structure Of Jacalin Complexed With 1-o-methyl- 
Alpha-d-mannose
 pdb|1M26|A Chain A, Crystal Structure Of Jacalin-T-Antigen Complex
 pdb|1M26|C Chain C, Crystal Structure Of Jacalin-T-Antigen Complex
 pdb|1M26|E Chain E, Crystal Structure Of Jacalin-T-Antigen Complex
 pdb|1M26|G Chain G, Crystal Structure Of Jacalin-T-Antigen Complex
 pdb|1UGW|C Chain C, Crystal Structure Of Jacalin- Gal Complex
 pdb|1UGW|E Chain E, Crystal Structure Of Jacalin- Gal Complex
 pdb|1UGY|C Chain C, Crystal Structure Of Jacalin- Mellibiose (Gal-Alpha(1-6)- 
Glc) Complex
 pdb|1UGY|E Chain E, Crystal Structure Of Jacalin- Mellibiose (Gal-Alpha(1-6)- 
Glc) Complex
 pdb|1UH0|A Chain A, Crystal Structure Of Jacalin- Me-Alpha-Galnac Complex
 pdb|1UH0|C Chain C, Crystal Structure Of Jacalin- Me-Alpha-Galnac Complex
 pdb|1UH0|E Chain E, Crystal Structure Of Jacalin- Me-Alpha-Galnac Complex
 pdb|1UH0|G Chain G, Crystal Structure Of Jacalin- Me-Alpha-Galnac Complex
 pdb|1UH1|A Chain A, Crystal Structure Of Jacalin- Galnac-Beta(1-3)-Gal-Alpha-O-Me 
Complex
 pdb|1UH1|C Chain C, Crystal Structure Of Jacalin- Galnac-Beta(1-3)-Gal-Alpha-O-Me 
Complex
 pdb|1UH1|E Chain E, Crystal Structure Of Jacalin- Galnac-Beta(1-3)-Gal-Alpha-O-Me 
Complex
 pdb|1UH1|G Chain G, Crystal Structure Of Jacalin- Galnac-Beta(1-3)-Gal-Alpha-O-Me 
Complex
 pdb|1PXD|A Chain A, Crystal Structure Of The Complex Of Jacalin With Meso- 
Tetrasulphonatophenylporphyrin.
 pdb|1WS4|C Chain C, Crystal Structure Of Jacalin- Me-alpha-mannose Complex: 
Promiscuity Vs Specificity
 pdb|1WS4|E Chain E, Crystal Structure Of Jacalin- Me-alpha-mannose Complex: 
Promiscuity Vs Specificity
 pdb|1WS5|C Chain C, Crystal Structure Of Jacalin-Me-Alpha-Mannose Complex: 
Promiscuity Vs Specificity
 pdb|1WS5|E Chain E, Crystal Structure Of Jacalin-Me-Alpha-Mannose Complex: 
Promiscuity Vs Specificity
 gb|AAB23127.1| jacalin major alpha-subunit=65 kda lectin major alpha-subunit 
[Artocarpus integrifolia=jackfruit, seeds, Peptide, 133 aa]
Length=133

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 1/38 (3%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ F TN + +GPYG   G PFNLP +NG  IVGF G
Sbjct  82   RSLTFKTNKKTYGPYGVTSGTPFNLPIENG-LIVGFKG  118



>gb|AAB22274.1| jacalin heavy chain, agglutinin heavy chain=Thomsen-Friedenreich-antigen-specific 
lectin [Artocarpus integrifolia=jack fruit, 
Peptide, 133 aa]
Length=133

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 1/38 (3%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ F TN + +GPYG   G PFNLP +NG  IVGF G
Sbjct  82   RSLTFKTNKKTYGPYGVTSGTPFNLPIENG-LIVGFKG  118



>pdb|1UGW|A Chain A, Crystal Structure Of Jacalin- Gal Complex
 pdb|1UGW|G Chain G, Crystal Structure Of Jacalin- Gal Complex
 pdb|1UGX|A Chain A, Crystal Structure Of Jacalin- Me-Alpha-T-Antigen (Gal-Beta(1-3)- 
Galnac-Alpha-O-Me) Complex
 pdb|1UGY|A Chain A, Crystal Structure Of Jacalin- Mellibiose (Gal-Alpha(1-6)- 
Glc) Complex
 pdb|1UGY|G Chain G, Crystal Structure Of Jacalin- Mellibiose (Gal-Alpha(1-6)- 
Glc) Complex
 pdb|1WS4|A Chain A, Crystal Structure Of Jacalin- Me-alpha-mannose Complex: 
Promiscuity Vs Specificity
 pdb|1WS4|G Chain G, Crystal Structure Of Jacalin- Me-alpha-mannose Complex: 
Promiscuity Vs Specificity
 pdb|1WS5|A Chain A, Crystal Structure Of Jacalin-Me-Alpha-Mannose Complex: 
Promiscuity Vs Specificity
 pdb|1WS5|G Chain G, Crystal Structure Of Jacalin-Me-Alpha-Mannose Complex: 
Promiscuity Vs Specificity
Length=133

 Score = 42.7 bits (99),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 1/38 (3%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ F TN + +GPYG   G PFNLP +NG  IVGF G
Sbjct  82   RSLTFKTNKKTYGPYGVTSGTPFNLPIENG-LIVGFKG  118



>ref|XP_004291831.1| PREDICTED: uncharacterized protein LOC101310192 [Fragaria vesca 
subsp. vesca]
Length=642

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ F +N R +GP+G   G  F+LP   GNKIVGF G
Sbjct  102  RSITFKSNKRSYGPFGMEQGTYFSLPVTTGNKIVGFHG  139



>ref|XP_010099935.1| hypothetical protein L484_020123 [Morus notabilis]
 gb|EXB80864.1| hypothetical protein L484_020123 [Morus notabilis]
Length=216

 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 25/38 (66%), Gaps = 1/38 (3%)
 Frame = +1

Query  1    RSVKFTTNLRVFGPYGPNVGRPFNLPAQNGNKIVGFFG  114
            RS+ F TN   +GPYG   G PFNLP QNG  IVGF G
Sbjct  165  RSLTFKTNKATYGPYGTKSGTPFNLPIQNG-LIVGFKG  201



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 534389527100