BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10266_g1_i1 len=774 path=[1:0-773]

Length=774
                                                                      Score     E

ref|XP_002526873.1|  60S acidic ribosomal protein P0, putative          300   1e-97   Ricinus communis
ref|NP_001238374.1|  60S acidic ribosomal protein P0                    299   6e-97   
gb|EYU18304.1|  hypothetical protein MIMGU_mgv1a010092mg                297   2e-96   
gb|KHG25462.1|  60S acidic ribosomal P0                                 297   3e-96   
gb|EYU19990.1|  hypothetical protein MIMGU_mgv1a0100892mg               293   4e-96   
ref|NP_001239676.1|  uncharacterized protein LOC100777482               296   4e-96   
emb|CAN76468.1|  hypothetical protein VITISV_030042                     296   5e-96   Vitis vinifera
emb|CBI25508.3|  unnamed protein product                                295   1e-95   
ref|XP_002268645.1|  PREDICTED: 60S acidic ribosomal protein P0         295   1e-95   Vitis vinifera
ref|XP_003603496.1|  60S acidic ribosomal protein p0                    295   2e-95   
ref|XP_007009051.1|  Ribosomal protein L10 family protein isoform 1     294   5e-95   
gb|AFK39880.1|  unknown                                                 294   5e-95   
ref|XP_007009052.1|  Ribosomal protein L10 family protein isoform 2     294   5e-95   
gb|AFK46889.1|  unknown                                                 293   7e-95   
ref|XP_004149240.1|  PREDICTED: 60S acidic ribosomal protein P0-like    293   7e-95   
ref|XP_003616595.1|  60S acidic ribosomal protein p0                    293   7e-95   
ref|XP_004165071.1|  PREDICTED: 60S acidic ribosomal protein P0-like    293   1e-94   
gb|KHG25720.1|  60S acidic ribosomal P0                                 293   1e-94   
ref|XP_011076719.1|  PREDICTED: 60S acidic ribosomal protein P0         292   2e-94   
gb|EYU43502.1|  hypothetical protein MIMGU_mgv1a010103mg                290   2e-94   
gb|EYU43500.1|  hypothetical protein MIMGU_mgv1a010103mg                292   2e-94   
gb|EYU43501.1|  hypothetical protein MIMGU_mgv1a010103mg                292   2e-94   
gb|KHG08087.1|  60S acidic ribosomal P0                                 292   2e-94   
ref|XP_008463223.1|  PREDICTED: 60S acidic ribosomal protein P0         292   3e-94   
dbj|BAE71263.1|  putative 60S acidic ribosomal protein P0               292   3e-94   Trifolium pratense [peavine clover]
ref|XP_004501267.1|  PREDICTED: 60S acidic ribosomal protein P0-like    291   3e-94   
ref|XP_010067511.1|  PREDICTED: 60S acidic ribosomal protein P0         291   7e-94   
gb|ABK94988.1|  unknown                                                 291   7e-94   Populus trichocarpa [western balsam poplar]
gb|AFK38760.1|  unknown                                                 291   8e-94   
gb|ACJ84880.1|  unknown                                                 291   9e-94   Medicago truncatula
ref|XP_004490967.1|  PREDICTED: 60S acidic ribosomal protein P0-like    290   1e-93   
ref|XP_004490966.1|  PREDICTED: 60S acidic ribosomal protein P0-like    290   1e-93   
ref|XP_002315165.1|  60S acidic ribosomal protein P0-A                  290   1e-93   Populus trichocarpa [western balsam poplar]
ref|XP_009399833.1|  PREDICTED: 60S acidic ribosomal protein P0-like    290   2e-93   
gb|ADR71236.1|  60S acidic ribosomal protein P0B                        290   2e-93   
emb|CAN80537.1|  hypothetical protein VITISV_003812                     289   2e-93   Vitis vinifera
gb|ADR71235.1|  60S acidic ribosomal protein P0A                        289   3e-93   
ref|XP_009389889.1|  PREDICTED: 60S acidic ribosomal protein P0         289   4e-93   
emb|CBI31491.3|  unnamed protein product                                288   5e-93   
ref|XP_002276842.1|  PREDICTED: 60S acidic ribosomal protein P0         288   1e-92   Vitis vinifera
ref|XP_007153264.1|  hypothetical protein PHAVU_003G020600g             288   1e-92   
gb|AGV54296.1|  60S acidic ribosomal protein P0                         288   1e-92   
ref|XP_009608105.1|  PREDICTED: 60S acidic ribosomal protein P0         288   1e-92   
ref|XP_009791710.1|  PREDICTED: 60S acidic ribosomal protein P0         288   1e-92   
ref|XP_009409427.1|  PREDICTED: 60S acidic ribosomal protein P0-like    288   1e-92   
emb|CDP14047.1|  unnamed protein product                                288   1e-92   
ref|XP_011035984.1|  PREDICTED: 60S acidic ribosomal protein P0         288   1e-92   
ref|XP_010554654.1|  PREDICTED: 60S acidic ribosomal protein P0         288   1e-92   
ref|XP_010534571.1|  PREDICTED: 60S acidic ribosomal protein P0-like    287   2e-92   
ref|XP_007016138.1|  Ribosomal protein L10 family protein               287   2e-92   
ref|XP_011072152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    287   2e-92   
gb|AAF34767.1|AF227622_1  60S acidic ribosomal protein PO               287   2e-92   Euphorbia esula [wolf's milk]
gb|AAD56335.1|AC009326_22  putative 60S acidic ribosomal protein,...    283   3e-92   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010926952.1|  PREDICTED: 60S acidic ribosomal protein P0         287   3e-92   
emb|CDY07906.1|  BnaC03g36170D                                          286   3e-92   
gb|KDP44812.1|  hypothetical protein JCGZ_01312                         286   4e-92   
ref|NP_001078125.1|  60S acidic ribosomal protein P0-2                  285   4e-92   Arabidopsis thaliana [mouse-ear cress]
gb|AID52928.1|  60S acidic ribosomal protein P0                         286   5e-92   
ref|NP_187531.1|  60S acidic ribosomal protein P0-2                     286   6e-92   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67524.1|  BnaAnng24540D                                          282   6e-92   
gb|ABK95701.1|  unknown                                                 286   6e-92   Populus trichocarpa [western balsam poplar]
emb|CDX73962.1|  BnaA03g30850D                                          286   6e-92   
ref|XP_007157498.1|  hypothetical protein PHAVU_002G074600g             286   7e-92   
gb|AAM63644.1|  putative 60S acidic ribosomal protein P0                286   7e-92   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799093.1|  PREDICTED: 60S acidic ribosomal protein P0         285   1e-91   
ref|XP_004307662.1|  PREDICTED: 60S acidic ribosomal protein P0-1...    285   1e-91   
emb|CDY53103.1|  BnaCnng24330D                                          285   1e-91   
ref|XP_004307622.1|  PREDICTED: 60S acidic ribosomal protein P0-1...    285   1e-91   
ref|XP_002884720.1|  60S acidic ribosomal protein P0                    285   1e-91   
ref|XP_009135066.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    285   1e-91   
ref|XP_011042597.1|  PREDICTED: 60S acidic ribosomal protein P0-like    285   1e-91   
ref|XP_010689885.1|  PREDICTED: 60S acidic ribosomal protein P0         285   2e-91   
ref|XP_009123454.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    285   2e-91   
ref|XP_006848156.1|  hypothetical protein AMTR_s00029p00231170          285   2e-91   
ref|XP_009146942.1|  PREDICTED: 60S acidic ribosomal protein P0-2       285   2e-91   
ref|XP_010486480.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    285   2e-91   
ref|XP_009619762.1|  PREDICTED: 60S acidic ribosomal protein P0-like    285   2e-91   
ref|XP_010469822.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    284   3e-91   
ref|XP_002312149.1|  60S acidic ribosomal protein P0-A                  284   3e-91   Populus trichocarpa [western balsam poplar]
ref|XP_008779152.1|  PREDICTED: 60S acidic ribosomal protein P0-like    280   3e-91   
ref|XP_006298147.1|  hypothetical protein CARUB_v10014197mg             284   3e-91   
ref|XP_007222847.1|  hypothetical protein PRUPE_ppa008800mg             284   4e-91   
ref|XP_004239781.1|  PREDICTED: 60S acidic ribosomal protein P0         283   5e-91   
ref|XP_010095082.1|  60S acidic ribosomal protein P0                    283   5e-91   
ref|XP_010464557.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    283   6e-91   
ref|XP_009350848.1|  PREDICTED: 60S acidic ribosomal protein P0-like    283   7e-91   
ref|XP_008360784.1|  PREDICTED: 60S acidic ribosomal protein P0         283   7e-91   
ref|NP_001275012.1|  60S acidic ribosomal protein P0-like               283   8e-91   
ref|XP_010941551.1|  PREDICTED: 60S acidic ribosomal protein P0         283   8e-91   
ref|XP_009344598.1|  PREDICTED: 60S acidic ribosomal protein P0         283   8e-91   
ref|XP_006407706.1|  hypothetical protein EUTSA_v10021147mg             283   9e-91   
ref|XP_006298124.1|  hypothetical protein CARUB_v10014186mg             283   1e-90   
ref|NP_187734.1|  60S acidic ribosomal protein P0-3                     283   1e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464828.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    283   1e-90   
ref|XP_002882720.1|  60S acidic ribosomal protein P0                    283   1e-90   
ref|XP_006360336.1|  PREDICTED: 60S acidic ribosomal protein P0-like    282   1e-90   
ref|XP_010534676.1|  PREDICTED: 60S acidic ribosomal protein P0-like    282   1e-90   
ref|XP_010247657.1|  PREDICTED: 60S acidic ribosomal protein P0-like    282   1e-90   
gb|AAM65265.1|  60S acidic ribosomal protein P0-C                       282   2e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010256605.1|  PREDICTED: 60S acidic ribosomal protein P0         282   2e-90   
ref|XP_008392940.1|  PREDICTED: 60S acidic ribosomal protein P0         282   2e-90   
gb|EPS69246.1|  p0 ribosomal protein-like protein                       282   3e-90   
ref|XP_004287422.1|  PREDICTED: 60S acidic ribosomal protein P0-1...    281   3e-90   
ref|XP_006435697.1|  hypothetical protein CICLE_v10032141mg             281   4e-90   
gb|KDO69054.1|  hypothetical protein CISIN_1g020952mg                   281   4e-90   
ref|XP_010486703.1|  PREDICTED: 60S acidic ribosomal protein P0-3       281   4e-90   
ref|XP_004247949.1|  PREDICTED: 60S acidic ribosomal protein P0-like    281   5e-90   
ref|XP_010486773.1|  PREDICTED: 60S acidic ribosomal protein P0-3...    281   6e-90   
ref|XP_006411245.1|  hypothetical protein EUTSA_v10016954mg             281   6e-90   
gb|EMS52841.1|  60S acidic ribosomal protein P0                         278   8e-90   
gb|KFK36893.1|  hypothetical protein AALP_AA4G185700                    280   9e-90   
gb|KHN34735.1|  60S acidic ribosomal protein P0                         280   1e-89   
gb|KHN36391.1|  60S acidic ribosomal protein P0                         280   2e-89   
gb|KFK38515.1|  hypothetical protein AALP_AA3G123100                    279   4e-89   
ref|XP_009764939.1|  PREDICTED: 60S acidic ribosomal protein P0-like    278   5e-89   
ref|XP_003538454.1|  PREDICTED: 60S acidic ribosomal protein P0-like    278   7e-89   
ref|XP_004145258.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    278   9e-89   
ref|XP_010508934.1|  PREDICTED: 60S acidic ribosomal protein P0-1       278   1e-88   
emb|CDP16385.1|  unnamed protein product                                278   1e-88   
ref|NP_181530.1|  60S acidic ribosomal protein P0-1                     277   1e-88   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38306.1|  hypothetical protein AALP_AA3G096900                    277   2e-88   
emb|CDY24932.1|  BnaC03g22400D                                          276   3e-88   
ref|XP_011084927.1|  PREDICTED: 60S acidic ribosomal protein P0-like    276   3e-88   
ref|XP_002881693.1|  60S acidic ribosomal protein P0                    276   5e-88   
ref|XP_002525622.1|  60S acidic ribosomal protein P0, putative          276   5e-88   Ricinus communis
ref|XP_010517390.1|  PREDICTED: 60S acidic ribosomal protein P0-1...    276   5e-88   
emb|CDY60988.1|  BnaA03g56530D                                          275   8e-88   
ref|XP_009133397.1|  PREDICTED: 60S acidic ribosomal protein P0-1       275   9e-88   
ref|XP_002440235.1|  hypothetical protein SORBIDRAFT_09g028230          275   1e-87   Sorghum bicolor [broomcorn]
gb|EMT02739.1|  60S acidic ribosomal protein P0                         274   3e-87   
ref|XP_008457380.1|  PREDICTED: 60S acidic ribosomal protein P0-like    273   5e-87   
gb|KHG21849.1|  60S acidic ribosomal P0-2 -like protein                 270   7e-87   
gb|EEC82854.1|  hypothetical protein OsI_27702                          269   7e-87   Oryza sativa Indica Group [Indian rice]
gb|KHG01938.1|  60S acidic ribosomal P0-2 -like protein                 270   9e-87   
gb|KDO69055.1|  hypothetical protein CISIN_1g020952mg                   271   2e-86   
ref|XP_003573632.1|  PREDICTED: 60S acidic ribosomal protein P0-like    271   3e-86   
gb|ABR26209.1|  60S acidic ribosomal protein p0                         268   3e-86   Oryza sativa Indica Group [Indian rice]
ref|XP_008351783.1|  PREDICTED: uncharacterized protein LOC103415220    283   4e-86   
ref|NP_001060923.1|  Os08g0130500                                       270   7e-86   Oryza sativa Japonica Group [Japonica rice]
gb|EYU22330.1|  hypothetical protein MIMGU_mgv1a019166mg                267   7e-86   
gb|EAZ41410.1|  hypothetical protein OsJ_25932                          267   8e-86   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007163525.1|  hypothetical protein PHAVU_001G241400g             270   1e-85   
ref|XP_004972933.1|  PREDICTED: 60S acidic ribosomal protein P0-like    269   2e-85   
ref|XP_006659092.1|  PREDICTED: 60S acidic ribosomal protein P0-like    269   3e-85   
ref|XP_004958562.1|  PREDICTED: 60S acidic ribosomal protein P0-like    268   3e-85   
gb|ABA91328.1|  60S acidic ribosomal protein P0, putative, expressed    268   4e-85   Oryza sativa Japonica Group [Japonica rice]
gb|EAY82182.1|  hypothetical protein OsI_37384                          268   4e-85   Oryza sativa Indica Group [Indian rice]
emb|CBX25428.1|  hypothetical_protein                                   268   4e-85   
gb|ABA95724.1|  60S acidic ribosomal protein P0, putative, expressed    268   5e-85   Oryza sativa Japonica Group [Japonica rice]
gb|ADE76171.1|  unknown                                                 266   7e-85   
ref|XP_006296009.1|  hypothetical protein CARUB_v10025153mg             267   9e-85   
ref|XP_010234277.1|  PREDICTED: 60S acidic ribosomal protein P0         266   3e-84   
ref|XP_002445000.1|  hypothetical protein SORBIDRAFT_07g002560          265   6e-84   Sorghum bicolor [broomcorn]
gb|KDO69056.1|  hypothetical protein CISIN_1g036252mg                   265   1e-83   
ref|XP_006435696.1|  hypothetical protein CICLE_v10033862mg             265   1e-83   
gb|ACF83717.1|  unknown                                                 265   1e-83   Zea mays [maize]
ref|NP_001105482.1|  60S acidic ribosomal protein P0                    265   1e-83   Zea mays [maize]
gb|ACL52455.1|  unknown                                                 264   3e-83   Zea mays [maize]
ref|NP_001141489.1|  hypothetical protein                               264   3e-83   Zea mays [maize]
ref|XP_009799989.1|  PREDICTED: 60S acidic ribosomal protein P0-like    262   1e-82   
gb|KDP46515.1|  hypothetical protein JCGZ_08487                         262   1e-82   
emb|CDP06275.1|  unnamed protein product                                259   1e-82   
ref|XP_009592351.1|  PREDICTED: 60S acidic ribosomal protein P0-like    260   7e-82   
dbj|BAJ92405.1|  predicted protein                                      259   1e-81   
gb|EMT17099.1|  60S acidic ribosomal protein P0                         259   1e-81   
dbj|BAJ94456.1|  predicted protein                                      259   1e-81   
ref|XP_010685586.1|  PREDICTED: 60S acidic ribosomal protein P0         256   2e-80   
ref|XP_002983859.1|  hypothetical protein SELMODRAFT_268802             256   2e-80   
ref|XP_002974292.1|  hypothetical protein SELMODRAFT_149765             256   3e-80   
ref|XP_004241171.1|  PREDICTED: 60S acidic ribosomal protein P0-like    256   4e-80   
ref|XP_002960810.1|  hypothetical protein SELMODRAFT_437282             254   2e-79   
ref|XP_001759592.1|  predicted protein                                  253   4e-79   
sp|P50345.1|RLA0_LUPLU  RecName: Full=60S acidic ribosomal protei...    253   4e-79   Lupinus luteus
ref|XP_004296403.1|  PREDICTED: 60S acidic ribosomal protein P0-like    252   1e-78   
ref|XP_001759851.1|  predicted protein                                  251   2e-78   
ref|XP_006350830.1|  PREDICTED: 60S acidic ribosomal protein P0-like    250   4e-78   
ref|XP_002279500.1|  PREDICTED: 60S acidic ribosomal protein P0-2...    244   4e-76   Vitis vinifera
emb|CBI15980.3|  unnamed protein product                                242   6e-76   
emb|CAN65663.1|  hypothetical protein VITISV_014917                     244   4e-75   Vitis vinifera
ref|XP_002960261.1|  hypothetical protein SELMODRAFT_229877             239   2e-73   
ref|XP_002967451.1|  hypothetical protein SELMODRAFT_87354              239   2e-73   
gb|ADU04571.1|  60S acidic ribosomal protein PO                         238   5e-73   
ref|XP_005850392.1|  hypothetical protein CHLNCDRAFT_59607              228   2e-69   
ref|XP_006407705.1|  hypothetical protein EUTSA_v10021147mg             226   6e-69   
sp|P29764.1|RLA0_OXYRB  RecName: Full=60S acidic ribosomal protei...    226   1e-68   Oxybasis rubra [pigweed]
gb|KDD72928.1|  hypothetical protein H632_c2720p0                       222   1e-67   
ref|XP_005987234.1|  PREDICTED: 60S acidic ribosomal protein P0         209   3e-62   
ref|XP_001697060.1|  acidic ribosomal protein P0                        208   8e-62   Chlamydomonas reinhardtii
ref|XP_006640161.1|  PREDICTED: 60S acidic ribosomal protein P0-like    208   9e-62   
sp|Q9DG68.1|RLA0_RANSY  RecName: Full=60S acidic ribosomal protei...    207   2e-61   Rana sylvatica
ref|XP_005650079.1|  hypothetical protein COCSUDRAFT_52908              207   3e-61   
ref|XP_010740439.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    205   4e-61   
ref|NP_001187030.1|  60S acidic ribosomal protein P0                    206   4e-61   
ref|XP_010740438.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    205   1e-60   
gb|EKC26031.1|  60S acidic ribosomal protein P0                         205   2e-60   
gb|AHB33743.1|  60S acidic ribosomal protein P0                         204   2e-60   
gb|ACH70801.1|  acidic ribosomal protein P0                             204   3e-60   Salmo salar
gb|ABZ04250.1|  ribosomal protein rplp0                                 204   3e-60   Lineus viridis
gb|KFM29126.1|  60S acidic ribosomal protein P0-2                       202   4e-60   
ref|XP_006784596.1|  PREDICTED: 60S acidic ribosomal protein P0-like    204   4e-60   
emb|CDQ67134.1|  unnamed protein product                                204   4e-60   
gb|ACI68961.1|  60S acidic ribosomal protein P0                         204   4e-60   Salmo salar
ref|NP_989067.1|  ribosomal protein, large, P0                          204   4e-60   Xenopus tropicalis [western clawed frog]
ref|NP_001080134.1|  ribosomal protein, large, P0                       204   4e-60   Xenopus laevis [clawed frog]
gb|KFZ54738.1|  60S acidic ribosomal protein P0                         202   5e-60   
dbj|BAF98695.1|  ribosomal protein LP0                                  204   5e-60   Solea senegalensis
ref|XP_008318611.1|  PREDICTED: 60S acidic ribosomal protein P0         204   5e-60   
ref|XP_008639852.1|  PREDICTED: 60S acidic ribosomal protein P0         202   5e-60   
gb|KFO65132.1|  60S acidic ribosomal protein P0                         202   6e-60   
emb|CDQ63253.1|  unnamed protein product                                203   7e-60   
gb|KFQ10333.1|  60S acidic ribosomal protein P0                         202   7e-60   
gb|ABB29594.1|  ribosomal protein P0 large subunit                      202   7e-60   Platynereis dumerilii
gb|ABU63975.1|  ribosomal protein large P0-like protein                 203   7e-60   Perca flavescens
ref|XP_008501040.1|  PREDICTED: 60S acidic ribosomal protein P0         203   9e-60   
ref|XP_002958097.1|  hypothetical protein VOLCADRAFT_84328              203   9e-60   
ref|XP_007434308.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    203   9e-60   
ref|XP_010396743.1|  PREDICTED: 60S acidic ribosomal protein P0         202   9e-60   
ref|XP_003226041.1|  PREDICTED: 60S acidic ribosomal protein P0         203   1e-59   
gb|KFQ53080.1|  60S acidic ribosomal protein P0                         201   1e-59   
ref|XP_005107960.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    202   1e-59   
gb|AAT44430.1|  ribosomal protein large P0-like protein                 202   1e-59   Sparus aurata [gilthead bream]
ref|XP_005421617.1|  PREDICTED: 60S acidic ribosomal protein P0         202   2e-59   
gb|ADF97607.1|  large ribosomal protein P0                              202   2e-59   
gb|AAU84931.1|  putative acidic p0 ribosomal protein                    202   2e-59   Aphis citricidus
ref|NP_571655.2|  60S acidic ribosomal protein P0                       202   2e-59   Danio rerio [leopard danio]
gb|ADV40160.1|  60S acidic ribosomal protein P0                         201   2e-59   
ref|XP_010879645.1|  PREDICTED: 60S acidic ribosomal protein P0         202   2e-59   
ref|XP_002199561.1|  PREDICTED: 60S acidic ribosomal protein P0         202   2e-59   Taeniopygia guttata
ref|XP_005524479.1|  PREDICTED: 60S acidic ribosomal protein P0         202   2e-59   
ref|XP_005493516.1|  PREDICTED: 60S acidic ribosomal protein P0         202   2e-59   
ref|XP_008924020.1|  PREDICTED: 60S acidic ribosomal protein P0         202   2e-59   
gb|AAS49563.1|  ribosomal protein Large P0                              200   2e-59   Latimeria chalumnae
ref|XP_005054917.1|  PREDICTED: 60S acidic ribosomal protein P0         202   3e-59   
gb|ABF69531.1|  acidic ribosomal protein P0                             202   3e-59   Strongyloides ratti
ref|XP_010572856.1|  PREDICTED: 60S acidic ribosomal protein P0         202   3e-59   
ref|XP_010080334.1|  PREDICTED: 60S acidic ribosomal protein P0         200   3e-59   
gb|AAY66850.1|  60S acidic ribosomal protein P0                         202   3e-59   Ixodes scapularis [blacklegged tick]
ref|XP_008292997.1|  PREDICTED: 60S acidic ribosomal protein P0         201   4e-59   
ref|XP_002399611.1|  60S acidic ribosomal protein P0, putative          201   4e-59   Ixodes scapularis [blacklegged tick]
ref|XP_010016668.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    201   4e-59   
ref|XP_003211127.2|  PREDICTED: 60S acidic ribosomal protein P0         201   4e-59   
ref|XP_009948467.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    201   5e-59   
ref|XP_004664195.1|  PREDICTED: 60S acidic ribosomal protein P0         201   5e-59   
dbj|BAH70543.1|  ACYPI000079                                            201   5e-59   Acyrthosiphon pisum
ref|NP_001119687.1|  ribosomal protein LP0                              201   5e-59   Acyrthosiphon pisum
ref|XP_005445335.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    201   5e-59   
gb|ELT92567.1|  hypothetical protein CAPTEDRAFT_167366                  201   6e-59   
gb|ABM55512.1|  putative ribosomal protein P0                           201   6e-59   Maconellicoccus hirsutus [pink hibiscus mealybug]
gb|KFH71275.1|  large subunit ribosomal protein LP0                     201   7e-59   
ref|XP_005288756.1|  PREDICTED: 60S acidic ribosomal protein P0         201   7e-59   
gb|AHK09710.1|  60S acidic ribosomal protein P0                         199   8e-59   
gb|EHH21238.1|  hypothetical protein EGK_04254                          200   1e-58   
gb|AAH49058.1|  Rplp0 protein                                           200   1e-58   Danio rerio [leopard danio]
ref|XP_010133581.1|  PREDICTED: 60S acidic ribosomal protein P0         200   1e-58   
ref|XP_004346242.1|  ribosomal protein P0                               200   1e-58   
ref|XP_006019892.1|  PREDICTED: 60S acidic ribosomal protein P0         200   1e-58   
emb|CBV76074.1|  60S acidic ribosomal protein P0                        200   1e-58   
ref|XP_009685789.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    200   1e-58   
gb|EJW87043.1|  60S acidic ribosomal protein P0                         199   1e-58   
gb|AHW68491.1|  60S acidic ribosomal protein P0                         199   2e-58   
gb|AEA51110.1|  60S acidic ribosomal protein P0                         199   2e-58   
ref|XP_003441603.1|  PREDICTED: 60S acidic ribosomal protein P0         199   2e-58   
ref|XP_005336874.1|  PREDICTED: 60S acidic ribosomal protein P0         199   2e-58   
ref|XP_003973625.1|  PREDICTED: 60S acidic ribosomal protein P0-like    199   2e-58   
dbj|BAH70537.1|  ACYPI000079                                            199   2e-58   Acyrthosiphon pisum
ref|XP_003743791.1|  PREDICTED: 60S acidic ribosomal protein P0-like    199   2e-58   
gb|AAI51696.1|  RPLP0 protein                                           199   2e-58   Bos taurus [bovine]
gb|AFM87695.1|  ribosomal protein, large, P0                            198   2e-58   
ref|XP_003763170.1|  PREDICTED: 60S acidic ribosomal protein P0-like    199   2e-58   
ref|XP_005918671.1|  PREDICTED: 60S acidic ribosomal protein P0-like    199   2e-58   
ref|XP_010306195.1|  PREDICTED: 60S acidic ribosomal protein P0         199   2e-58   
gb|ABO31368.1|  60S ribosomal protein                                   196   2e-58   Gossypium hirsutum [American cotton]
dbj|BAG65447.1|  unnamed protein product                                198   2e-58   Homo sapiens [man]
ref|XP_008067488.1|  PREDICTED: 60S acidic ribosomal protein P0         199   2e-58   
ref|XP_004888210.1|  PREDICTED: 60S acidic ribosomal protein P0         199   3e-58   
ref|XP_009246581.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    199   3e-58   
ref|XP_004591942.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    199   3e-58   
ref|XP_004658356.1|  PREDICTED: 60S acidic ribosomal protein P0-like    199   3e-58   
ref|XP_006129131.1|  PREDICTED: 60S acidic ribosomal protein P0         199   3e-58   
gb|KHN76000.1|  60S acidic ribosomal protein P0                         199   3e-58   
gb|ABW16870.1|  ribosomal protein P0                                    199   4e-58   
ref|XP_009886897.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    199   4e-58   
ref|XP_002719840.1|  PREDICTED: 60S acidic ribosomal protein P0         199   4e-58   
ref|XP_006053033.1|  PREDICTED: 60S acidic ribosomal protein P0         199   4e-58   
ref|XP_005709583.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    199   4e-58   
gb|AFM88893.1|  ribosomal protein, large, P0                            199   4e-58   
gb|AAH03833.1|  Ribosomal protein, large, P0                            199   4e-58   
ref|XP_005344377.1|  PREDICTED: 60S acidic ribosomal protein P0         199   4e-58   
ref|XP_004545259.1|  PREDICTED: 60S acidic ribosomal protein P0-like    199   4e-58   
ref|NP_990318.1|  60S acidic ribosomal protein P0                       199   4e-58   
gb|AHK09711.1|  60S acidic ribosomal protein P0                         198   5e-58   
ref|XP_004017462.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    199   5e-58   
dbj|BAD96188.1|  ribosomal protein P0 variant                           199   5e-58   
gb|AIS76467.1|  large ribosomal protein P0                              199   5e-58   
ref|NP_000993.1|  60S acidic ribosomal protein P0                       199   5e-58   
gb|AAI02075.1|  Ribosomal protein, large, P0                            199   5e-58   
ref|NP_001182357.1|  acidic ribosomal phosphoprotein PO                 199   5e-58   
ref|NP_001012700.1|  60S acidic ribosomal protein P0                    199   5e-58   
ref|XP_010602365.1|  PREDICTED: 60S acidic ribosomal protein P0         198   5e-58   
ref|XP_008582193.1|  PREDICTED: 60S acidic ribosomal protein P0         198   6e-58   
gb|AFM89459.1|  ribosomal protein, large, P0                            198   6e-58   
ref|XP_006890483.1|  PREDICTED: 60S acidic ribosomal protein P0         198   6e-58   
ref|XP_010366585.1|  PREDICTED: 60S acidic ribosomal protein P0         198   6e-58   
gb|ACO09070.1|  60S acidic ribosomal protein P0                         198   7e-58   
gb|AFM89518.1|  ribosomal protein, large, P0                            198   7e-58   
gb|AFM85775.1|  ribosomal protein, large, P0                            198   7e-58   
gb|AFM86948.1|  ribosomal protein, large, P0                            198   7e-58   
gb|AFM89484.1|  ribosomal protein, large, P0                            198   7e-58   
gb|AFM85484.1|  ribosomal protein, large, P0                            198   7e-58   
ref|XP_010967878.1|  PREDICTED: 60S acidic ribosomal protein P0         198   7e-58   
gb|AFM87161.1|  ribosomal protein, large, P0                            198   7e-58   
gb|AFM86580.1|  ribosomal protein, large, P0                            198   7e-58   
ref|NP_001239066.1|  ribosomal protein, large, P0                       198   7e-58   
gb|AEA51182.1|  acidic ribosomal protein P0                             195   7e-58   
gb|AFM86819.1|  ribosomal protein, large, P0                            198   7e-58   
ref|XP_004636304.1|  PREDICTED: 60S acidic ribosomal protein P0         198   7e-58   
ref|NP_001092068.1|  60S acidic ribosomal protein P0                    198   8e-58   
ref|XP_003478429.1|  PREDICTED: 60S acidic ribosomal protein P0         198   8e-58   
emb|CAA33199.1|  unnamed protein product                                198   8e-58   
ref|NP_001279963.1|  ribosomal protein, large, P0                       198   8e-58   
gb|AFM89472.1|  ribosomal protein, large, P0                            198   8e-58   
gb|AFM87759.1|  ribosomal protein, large, P0                            198   8e-58   
ref|XP_010996948.1|  PREDICTED: 60S acidic ribosomal protein P0         198   8e-58   
ref|XP_008838692.1|  PREDICTED: 60S acidic ribosomal protein P0         198   8e-58   
ref|XP_001115939.2|  PREDICTED: 60S acidic ribosomal protein P0-like    197   8e-58   
gb|AHK09709.1|  60S acidic ribosomal protein P0                         197   8e-58   
gb|AFM85937.1|  ribosomal protein, large, P0                            198   8e-58   
ref|XP_003789970.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    198   9e-58   
ref|XP_006192755.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    198   9e-58   
ref|XP_001363537.1|  PREDICTED: 60S acidic ribosomal protein P0         198   9e-58   
gb|AIW62441.1|  60S acidic ribosomal protein                            198   9e-58   
ref|XP_004611130.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    198   9e-58   
ref|XP_005876332.1|  PREDICTED: 60S acidic ribosomal protein P0-like    198   9e-58   
ref|XP_004429976.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    198   9e-58   
gb|AGX29497.1|  60S acidic ribosomal protein P0                         195   9e-58   
gb|AFM90832.1|  ribosomal protein, large, P0                            197   1e-57   
gb|AGQ49465.1|  acidic ribosomal protein P0                             198   1e-57   
gb|AHW80376.1|  ribosomol protein P0L10e                                197   1e-57   
ref|XP_006895246.1|  PREDICTED: 60S acidic ribosomal protein P0-like    196   1e-57   
ref|XP_001897742.1|  60S acidic ribosomal protein P0                    197   1e-57   
ref|XP_006204865.1|  PREDICTED: 60S acidic ribosomal protein P0         197   1e-57   
gb|ABW90371.1|  putative ribosomal protein P0                           194   1e-57   
gb|AFM86446.1|  ribosomal protein, large, P0                            197   1e-57   
ref|XP_008141153.1|  PREDICTED: 60S acidic ribosomal protein P0         196   1e-57   
gb|AFM87081.1|  ribosomal protein, large, P0                            197   1e-57   
gb|EHH66765.1|  hypothetical protein EGM_03817                          196   2e-57   
emb|CCA22079.1|  60S acidic ribosomal protein P0 putative               197   2e-57   
gb|AHW68488.1|  60S acidic ribosomal protein P0                         196   2e-57   
ref|XP_008407632.1|  PREDICTED: 60S acidic ribosomal protein P0         197   2e-57   
ref|NP_031501.1|  60S acidic ribosomal protein P0                       197   2e-57   
gb|AHW68489.1|  60S acidic ribosomal protein P0                         196   2e-57   
ref|XP_007554302.1|  PREDICTED: 60S acidic ribosomal protein P0         197   2e-57   
emb|CAD29995.1|  ribosomal P0 protein                                   197   2e-57   
ref|NP_001037123.1|  ribosomal protein P0                               197   2e-57   
gb|AAH01127.1|  Ribosomal protein, large, P0                            197   2e-57   
ref|XP_004691044.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    197   2e-57   
sp|Q9PV90.1|RLA0_DANRE  RecName: Full=60S acidic ribosomal protei...    197   2e-57   
ref|XP_002128891.1|  PREDICTED: 60S acidic ribosomal protein P0         196   2e-57   
gb|ADD21620.1|  ribosomal protein P0                                    195   2e-57   
gb|AFM86828.1|  ribosomal protein, large, P0                            197   2e-57   
gb|AAB65436.1|  acidic ribosomal phosphoprotein PO                      196   3e-57   
gb|AFM85590.1|  ribosomal protein, large, P0                            196   3e-57   
gb|AFM85706.1|  ribosomal protein, large, P0                            196   3e-57   
gb|AFM87342.1|  ribosomal protein, large, P0                            196   3e-57   
gb|AFM86675.1|  ribosomal protein, large, P0                            196   3e-57   
gb|AFM86528.1|  ribosomal protein, large, P0                            196   3e-57   
gb|AFM86570.1|  ribosomal protein, large, P0                            196   3e-57   
gb|ABW04139.1|  ribosomal protein LP0                                   195   3e-57   
ref|XP_005863834.1|  PREDICTED: 60S acidic ribosomal protein P0         196   4e-57   
ref|XP_004709621.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    196   4e-57   
ref|XP_010127000.1|  PREDICTED: 60S acidic ribosomal protein P0         194   4e-57   
gb|EFB17077.1|  hypothetical protein PANDA_020357                       196   4e-57   
gb|ACQ57902.1|  60S acidic ribosomal protein P0                         196   4e-57   
ref|XP_003907291.1|  PREDICTED: 60S acidic ribosomal protein P0         196   4e-57   
dbj|BAF83798.1|  unnamed protein product                                196   5e-57   
gb|KFP45896.1|  60S acidic ribosomal protein P0                         194   5e-57   
ref|XP_005962035.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    196   5e-57   
ref|XP_003380825.1|  60S acidic ribosomal protein P0                    196   6e-57   
gb|EHH54874.1|  hypothetical protein EGM_03973                          196   6e-57   
ref|XP_009582133.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    194   6e-57   
gb|AFX73002.1|  deoxyribonuclease                                       196   6e-57   
ref|XP_007643381.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    195   6e-57   
ref|XP_005396575.1|  PREDICTED: 60S acidic ribosomal protein P0         196   6e-57   
gb|EYC13195.1|  hypothetical protein Y032_0044g1026                     196   7e-57   
ref|XP_010177042.1|  PREDICTED: 60S acidic ribosomal protein P0         195   7e-57   
gb|AAL62465.1|  60S acidic ribosomal protein P0                         196   7e-57   
ref|XP_005798004.1|  PREDICTED: 60S acidic ribosomal protein P0-like    195   9e-57   
ref|XP_005352132.1|  PREDICTED: 60S acidic ribosomal protein P0-like    195   9e-57   
gb|EFN79997.1|  60S acidic ribosomal protein P0                         195   9e-57   
ref|XP_002930016.1|  PREDICTED: 60S acidic ribosomal protein P0-like    195   9e-57   
ref|XP_006865510.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    195   9e-57   
ref|XP_009285795.1|  PREDICTED: 60S acidic ribosomal protein P0         195   9e-57   
gb|AFM86008.1|  ribosomal protein, large, P0                            195   1e-56   
gb|AFK10546.1|  ribosomal protein, large, P0                            195   1e-56   
ref|XP_009869989.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    193   1e-56   
gb|AFM86966.1|  ribosomal protein, large, P0                            195   1e-56   
dbj|BAD96291.1|  ribosomal protein P0 variant                           195   1e-56   
ref|XP_003495963.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    195   1e-56   
ref|XP_623106.1|  PREDICTED: 60S acidic ribosomal protein P0 isof...    195   1e-56   
ref|XP_004996745.1|  arbp-prov protein                                  195   1e-56   
ref|XP_006612127.1|  PREDICTED: 60S acidic ribosomal protein P0-like    195   1e-56   
ref|XP_007936405.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    195   1e-56   
ref|XP_003135972.1|  60S acidic ribosomal protein P0                    195   1e-56   
gb|AFM88521.1|  ribosomal protein, large, P0                            194   1e-56   
ref|XP_002425010.1|  ribosomal P0 protein, putative                     195   2e-56   
ref|XP_006745368.1|  PREDICTED: 60S acidic ribosomal protein P0         194   2e-56   
ref|XP_007130059.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    194   2e-56   
gb|EFN61067.1|  60S acidic ribosomal protein P0                         194   2e-56   
ref|XP_005503982.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    194   2e-56   
gb|AFD93389.1|  ribosomal protein P0                                    193   3e-56   
gb|AEL28833.1|  ribosomal protein P0                                    194   3e-56   
ref|XP_004069033.1|  PREDICTED: 60S acidic ribosomal protein P0-like    193   4e-56   
gb|EHJ75936.1|  ribosomal protein P0                                    194   4e-56   
ref|XP_005026768.1|  PREDICTED: translational activator GCN1            206   4e-56   
gb|EDL10286.1|  mCG121637                                               193   4e-56   
ref|XP_003419310.1|  PREDICTED: 60S acidic ribosomal protein P0         194   4e-56   
emb|CAG01875.1|  unnamed protein product                                193   5e-56   
emb|CCI41647.1|  unnamed protein product                                198   5e-56   
ref|XP_003398378.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    193   6e-56   
gb|ABF69517.1|  acidic ribosomal protein P0                             191   6e-56   
gb|EZA49150.1|  60S acidic ribosomal protein P0                         193   6e-56   
ref|XP_007170980.1|  PREDICTED: 60S acidic ribosomal protein P0         193   6e-56   
ref|XP_006893187.1|  PREDICTED: 60S acidic ribosomal protein P0-like    191   6e-56   
ref|XP_007513516.1|  60S acidic ribosomal protein P0                    193   7e-56   
ref|XP_003488353.1|  PREDICTED: 60S acidic ribosomal protein P0-like    193   7e-56   
ref|XP_009708350.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    192   7e-56   
ref|XP_002114931.1|  expressed hypothetical protein                     192   8e-56   
ref|XP_001352888.1|  GA20389                                            192   8e-56   
emb|CBN08637.1|  ribosomal protein, large, P0                           192   9e-56   
ref|XP_007071837.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    192   9e-56   
ref|XP_009440587.1|  PREDICTED: 60S acidic ribosomal protein P0-like    192   1e-55   
ref|XP_009178294.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    195   1e-55   
emb|CBM69268.1|  venom protein Ci-40b                                   192   1e-55   
ref|XP_004464729.1|  PREDICTED: 60S acidic ribosomal protein P0         191   1e-55   
ref|XP_002068394.1|  GK20443                                            192   1e-55   
ref|XP_004379079.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    192   1e-55   
gb|EMP24441.1|  60S acidic ribosomal protein P0                         192   1e-55   
gb|KDO34134.1|  hypothetical protein SPRG_01404                         192   1e-55   
gb|AFD93397.1|  ribosomal protein P0                                    192   1e-55   
ref|XP_004281477.1|  PREDICTED: 60S acidic ribosomal protein P0         192   1e-55   
ref|XP_004315986.1|  PREDICTED: 60S acidic ribosomal protein P0         192   2e-55   
gb|ETN75251.1|  ribosomal protein L10                                   197   2e-55   
gb|EFZ19789.1|  hypothetical protein SINV_09784                         192   2e-55   
ref|XP_001973718.1|  GG16244                                            192   2e-55   
ref|XP_008612085.1|  50S ribosomal protein LP0                          192   2e-55   
ref|XP_313349.1|  AGAP003592-PA                                         192   2e-55   
ref|XP_004396730.1|  PREDICTED: 60S acidic ribosomal protein P0         192   2e-55   
gb|ACY95307.1|  ribosomal protein P0                                    192   2e-55   
ref|NP_524211.1|  ribosomal protein LP0, isoform A                      192   2e-55   
gb|AHW68492.1|  60S acidic ribosomal protein P0                         191   2e-55   
gb|ACO14779.1|  60S acidic ribosomal protein P0                         191   2e-55   
ref|XP_002639809.1|  C. briggsae CBR-RPA-0 protein                      191   2e-55   
dbj|BAM17678.1|  ribosomal protein LP0                                  191   2e-55   
gb|ACH73063.1|  ribosomal protein LP0-like protein                      187   3e-55   
gb|AFD93398.1|  ribosomal protein P0                                    191   3e-55   
ref|XP_007528636.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    190   3e-55   
ref|XP_011064775.1|  PREDICTED: 60S acidic ribosomal protein P0         191   3e-55   
ref|XP_002040897.1|  GM22429                                            191   3e-55   
gb|ABV60317.1|  60S acidic ribosomal protein P0-like protein            191   3e-55   
gb|ACO12290.1|  60S acidic ribosomal protein P0                         191   3e-55   
gb|AAS49564.1|  ribosomal protein Large P0                              189   3e-55   
ref|XP_003384811.1|  PREDICTED: 60S acidic ribosomal protein P0-like    191   3e-55   
ref|XP_006970918.1|  PREDICTED: 60S acidic ribosomal protein P0         191   3e-55   
ref|XP_001515492.2|  PREDICTED: 60S acidic ribosomal protein P0         190   3e-55   
ref|XP_005147936.1|  PREDICTED: 60S acidic ribosomal protein P0         191   3e-55   
ref|XP_007635361.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    190   3e-55   
ref|XP_009045933.1|  hypothetical protein LOTGIDRAFT_237709             191   4e-55   
dbj|BAM18929.1|  ribosomal protein LP0                                  191   4e-55   
sp|Q8NHW5.1|RLA0L_HUMAN  RecName: Full=60S acidic ribosomal prote...    191   4e-55   
ref|XP_008865510.1|  hypothetical protein H310_03433                    191   4e-55   
gb|EFN80029.1|  60S acidic ribosomal protein P0                         191   4e-55   
gb|ESA18298.1|  hypothetical protein GLOINDRAFT_344659                  191   4e-55   
gb|AAF31449.1|AF220939_1  60S acidic ribosomal protein P0               191   4e-55   
gb|EGT39704.1|  hypothetical protein CAEBREN_29720                      191   4e-55   
gb|KFP24372.1|  60S acidic ribosomal protein P0                         189   4e-55   
ref|XP_006982441.1|  PREDICTED: 60S acidic ribosomal protein P0-like    191   4e-55   
ref|XP_002505583.1|  predicted protein                                  191   5e-55   
gb|KFW77971.1|  60S acidic ribosomal protein P0                         189   5e-55   
gb|KFO70360.1|  60S acidic ribosomal protein P0                         189   5e-55   
ref|XP_010194334.1|  PREDICTED: 60S acidic ribosomal protein P0         189   5e-55   
gb|KDR14762.1|  60S acidic ribosomal protein P0                         191   5e-55   
ref|XP_007642894.1|  PREDICTED: 60S acidic ribosomal protein P0-l...    189   5e-55   
ref|XP_975936.1|  PREDICTED: 60S acidic ribosomal protein P0            191   5e-55   
ref|XP_001958489.1|  GF10946                                            191   5e-55   
ref|XP_007528628.1|  PREDICTED: 60S acidic ribosomal protein P0 i...    191   6e-55   
ref|XP_008151673.1|  PREDICTED: LOW QUALITY PROTEIN: 60S acidic r...    191   6e-55   
gb|EGV93157.1|  60S acidic ribosomal protein P0                         189   6e-55   
ref|XP_002753119.1|  PREDICTED: 60S acidic ribosomal protein P0         190   7e-55   
gb|KHJ98883.1|  ribosomal protein L10                                   195   7e-55   
gb|ADT80652.1|  ribosomal protein P0                                    190   7e-55   
ref|XP_003112032.1|  CRE-RPA-0 protein                                  190   8e-55   
gb|ABG74704.1|  putative acidic p0 ribosomal protein                    187   8e-55   
ref|NP_492766.1|  Protein RLA-0                                         190   8e-55   
ref|XP_009513921.1|  hypothetical protein PHYSODRAFT_353332             190   8e-55   
ref|XP_009641177.1|  PREDICTED: 60S acidic ribosomal protein P0         190   8e-55   
ref|XP_003706895.1|  PREDICTED: 60S acidic ribosomal protein P0-like    190   9e-55   
ref|XP_004522331.1|  PREDICTED: 60S acidic ribosomal protein P0-like    190   9e-55   
ref|XP_001607606.1|  PREDICTED: 60S acidic ribosomal protein P0         190   1e-54   
ref|XP_002095795.1|  RpLP0                                              190   1e-54   
ref|XP_001626294.1|  predicted protein                                  190   1e-54   



>ref|XP_002526873.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF35504.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=320

 Score =   300 bits (769),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL+VLSVYDNG+VFSPEVLDLTEDDLIGKFA+GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLIVLSVYDNGSVFSPEVLDLTEDDLIGKFAIGVSMVTSLALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV TEY+FP A+KVKEYLEDPSKF
Sbjct  241  PHMFINAYKNALAIAVATEYTFPQAEKVKEYLEDPSKF  278



>ref|NP_001238374.1| 60S acidic ribosomal protein P0 [Glycine max]
 sp|P50346.1|RLA0_SOYBN RecName: Full=60S acidic ribosomal protein P0 [Glycine max]
 gb|AAB63814.1| acidic ribosomal protein P0 [Glycine max]
Length=320

 Score =   299 bits (765),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDLIGKFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIGKFAAGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+AVET+YSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFVNAYKNVLAVAVETDYSFPEADKVKEYLKDPSKF  278



>gb|EYU18304.1| hypothetical protein MIMGU_mgv1a010092mg [Erythranthe guttata]
Length=322

 Score =   297 bits (761),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELIKKGDKVGSSEAALL+K
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVL VYDNG+VFSPEVLDLTEDDL+GKFAMGVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLKVYDNGSVFSPEVLDLTEDDLVGKFAMGVSMVTSLALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV T+YSFPLADKVKEYL DPSKF
Sbjct  241  PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  278



>gb|KHG25462.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   297 bits (760),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDLI KFA GVSMVT+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFASGVSMVTALSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM INGYKN LA+AV TEYSFP ADKVKEYL DPSKF
Sbjct  241  PHMFINGYKNVLAVAVATEYSFPQADKVKEYLADPSKF  278



>gb|EYU19990.1| hypothetical protein MIMGU_mgv1a0100892mg, partial [Erythranthe 
guttata]
Length=213

 Score =   293 bits (749),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELIKKGDKVGSSEAALL+K
Sbjct  12   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALLSK  71

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDLIGKFAMGVSMVTSL+LAISYPTLAAA
Sbjct  72   LGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIGKFAMGVSMVTSLALAISYPTLAAA  131

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV T+YSFPLADKVKEYL DPSKF
Sbjct  132  PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  169



>ref|NP_001239676.1| uncharacterized protein LOC100777482 [Glycine max]
 gb|ACU20858.1| unknown [Glycine max]
 gb|KHN20859.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=319

 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDLI KFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+AVET+YSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFVNAYKNVLAVAVETDYSFPEADKVKEYLKDPSKF  278



>emb|CAN76468.1| hypothetical protein VITISV_030042 [Vitis vinifera]
Length=303

 Score =   296 bits (757),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  104  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  163

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTE+DLI KFA GVSMVTSLSLAISYPTLAAA
Sbjct  164  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFAAGVSMVTSLSLAISYPTLAAA  223

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV TEYSFP ADKVKEYL+DPSKF
Sbjct  224  PHMFINAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF  261



>emb|CBI25508.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  93   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  152

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTE+DLI KFA GVSMVTSLSLAISYPTLAAA
Sbjct  153  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFAAGVSMVTSLSLAISYPTLAAA  212

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV TEYSFP ADKVKEYL+DPSKF
Sbjct  213  PHMFINAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF  250



>ref|XP_002268645.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTE+DLI KFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV TEYSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFINAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF  278



>ref|XP_003603496.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES73747.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   295 bits (755),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA AV TEYSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPSKF  278



>ref|XP_007009051.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
 gb|EOY17861.1| Ribosomal protein L10 family protein isoform 1 [Theobroma cacao]
Length=320

 Score =   294 bits (752),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDL+ KFA GVSMVT+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMVTALSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEYSFP ADKVKEYL DPSKF
Sbjct  241  PHMFINAYKNVLALAIATEYSFPQADKVKEYLADPSKF  278



>gb|AFK39880.1| unknown [Medicago truncatula]
Length=323

 Score =   294 bits (752),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGT EIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTAEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA AV TEYSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPSKF  278



>ref|XP_007009052.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
 gb|EOY17862.1| Ribosomal protein L10 family protein isoform 2 [Theobroma cacao]
Length=321

 Score =   294 bits (752),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  122  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  181

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDL+ KFA GVSMVT+LSLAISYPTLAAA
Sbjct  182  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMVTALSLAISYPTLAAA  241

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEYSFP ADKVKEYL DPSKF
Sbjct  242  PHMFINAYKNVLALAIATEYSFPQADKVKEYLADPSKF  279



>gb|AFK46889.1| unknown [Medicago truncatula]
Length=323

 Score =   293 bits (751),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VF+PEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFNPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+AV TEYSFP ADKVKE+L+DPSKF
Sbjct  241  PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKF  278



>ref|XP_004149240.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
 gb|KGN50643.1| 60S acidic ribosomal protein PO [Cucumis sativus]
Length=320

 Score =   293 bits (751),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSP+VLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPQVLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHMLIN YKN LA+AV T+YSFP A+KVKEYL DPSKF
Sbjct  241  PHMLINAYKNLLAVAVATDYSFPQAEKVKEYLADPSKF  278



>ref|XP_003616595.1| 60S acidic ribosomal protein p0 [Medicago truncatula]
 gb|AES99553.1| 60S acidic ribosomal protein P0-1 [Medicago truncatula]
Length=323

 Score =   293 bits (751),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VF+PEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFNPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+AV TEYSFP ADKVKE+L+DPSKF
Sbjct  241  PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKF  278



>ref|XP_004165071.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis sativus]
Length=320

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSP+VLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPQVLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHMLIN YKN LA+AV T+YSFP A+KVKEYL DPSKF
Sbjct  241  PHMLINAYKNLLAVAVATDYSFPQAEKVKEYLADPSKF  278



>gb|KHG25720.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=320

 Score =   293 bits (749),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDLI KFA GVSMVT+LSLAISYPTLAA 
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFASGVSMVTALSLAISYPTLAAV  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM INGYKN LA+AV TEYSF  ADKVKEYL DPSKF
Sbjct  241  PHMFINGYKNVLAVAVATEYSFRQADKVKEYLADPSKF  278



>ref|XP_011076719.1| PREDICTED: 60S acidic ribosomal protein P0 [Sesamum indicum]
Length=321

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV+SVYDNG+VFSPEVLDLTEDDLI KFAMGVSMVTSLSLAI+YPTLAAA
Sbjct  181  LGIRPFSYGLVVISVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLSLAIAYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV T+YSFP ADKVKEYL DPSKF
Sbjct  241  PHMFINAYKNVLAVAVATDYSFPQADKVKEYLADPSKF  278



>gb|EYU43502.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=242

 Score =   290 bits (741),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELIKKGDKVGSSEAALL+K
Sbjct  41   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALLSK  100

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDLI KFAMGVSMVTSL+LAISYPTLAAA
Sbjct  101  LGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIVKFAMGVSMVTSLALAISYPTLAAA  160

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV T+YSFPLADKVKEYL DPSKF
Sbjct  161  PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  198



>gb|EYU43500.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=322

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELIKKGDKVGSSEAALL+K
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDLI KFAMGVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIVKFAMGVSMVTSLALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV T+YSFPLADKVKEYL DPSKF
Sbjct  241  PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  278



>gb|EYU43501.1| hypothetical protein MIMGU_mgv1a010103mg [Erythranthe guttata]
Length=321

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELIKKGDKVGSSEAALL+K
Sbjct  120  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALLSK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDLI KFAMGVSMVTSL+LAISYPTLAAA
Sbjct  180  LGIRPFSYGLVVTKVYDNGSVFSPEVLDLTEDDLIVKFAMGVSMVTSLALAISYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV T+YSFPLADKVKEYL DPSKF
Sbjct  240  PHMFINAYKNVLAVAVATDYSFPLADKVKEYLADPSKF  277



>gb|KHG08087.1| 60S acidic ribosomal P0 [Gossypium arboreum]
Length=321

 Score =   292 bits (748),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTE+DLI KFA GVSMVT+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFATGVSMVTALSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN L++AV TEYSFP ADKVKEYL DPSKF
Sbjct  241  PHMFINAYKNVLSVAVATEYSFPQADKVKEYLADPSKF  278



>ref|XP_008463223.1| PREDICTED: 60S acidic ribosomal protein P0 [Cucumis melo]
Length=320

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSP+VLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPQVLDLTEDDLLEKFALGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHMLIN YKN LA+AV T+YSFP A+KVKEYL DPSKF
Sbjct  241  PHMLINAYKNLLAVAVATDYSFPEAEKVKEYLADPSKF  278



>dbj|BAE71263.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
 dbj|BAE71276.1| putative 60S acidic ribosomal protein P0 [Trifolium pratense]
Length=321

 Score =   292 bits (747),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L IRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LAIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN L+IAV TEYSFP ADKVKE+L+DPSKF
Sbjct  241  PHMFVNAYKNVLSIAVVTEYSFPEADKVKEFLKDPSKF  278



>ref|XP_004501267.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=322

 Score =   291 bits (746),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTED LI KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDALIEKFAIGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHML+N YKN LA+AV TEYS P ADKVKEYL+DPSKF
Sbjct  241  PHMLVNAYKNVLAVAVATEYSSPEADKVKEYLKDPSKF  278



>ref|XP_010067511.1| PREDICTED: 60S acidic ribosomal protein P0 [Eucalyptus grandis]
 gb|KCW65656.1| hypothetical protein EUGRSUZ_G03042 [Eucalyptus grandis]
Length=320

 Score =   291 bits (744),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  120  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTEDDL+ KFA+GVSMVT+LSLAISYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLMEKFALGVSMVTALSLAISYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AVETEYS+P AD+VKE+L+DPSKF
Sbjct  240  PHMFINAYKNVLAVAVETEYSYPHADEVKEFLKDPSKF  277



>gb|ABK94988.1| unknown [Populus trichocarpa]
 gb|ABK95694.1| unknown [Populus trichocarpa]
Length=320

 Score =   291 bits (744),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLS YDNG+VFSPEVLDLTEDDLI KFA GVSM+ SLSLA SYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLIDKFAAGVSMIASLSLATSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV TEYSFP A+KVKE+LEDPSKF
Sbjct  241  PHMFINAYKNVLAVAVATEYSFPQAEKVKEFLEDPSKF  278



>gb|AFK38760.1| unknown [Lotus japonicus]
Length=322

 Score =   291 bits (744),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  120  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+V SPEVLDLTEDDL+GKFA+GVSMVT+LSLAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVLSVYDNGSVLSPEVLDLTEDDLVGKFAIGVSMVTALSLAISFPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+A+ TEYSFP AD+VKEYL+DPSKF
Sbjct  240  PHMFVNAYKNILAVALATEYSFPQADEVKEYLKDPSKF  277



>gb|ACJ84880.1| unknown [Medicago truncatula]
Length=323

 Score =   291 bits (744),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGT EIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTAEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGI PFSYGLVVLSVYDNG+VFSPEVLDLTEDDL+ KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGITPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVAKFAIGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA AV TEYSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFVNAYKNVLAFAVATEYSFPEADKVKEYLKDPSKF  278



>ref|XP_004490967.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VF+PEVLDLTED LI KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFTPEVLDLTEDALIEKFAIGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+AV TEYSFP ADKVKE+L+DPSKF
Sbjct  241  PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKF  278



>ref|XP_004490966.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum]
Length=321

 Score =   290 bits (743),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VF+PEVLDLTED LI KFA+GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFTPEVLDLTEDALIEKFAIGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+AV TEYSFP ADKVKE+L+DPSKF
Sbjct  241  PHMFVNAYKNVLAVAVATEYSFPEADKVKEFLKDPSKF  278



>ref|XP_002315165.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEF01336.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=320

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLS YDNG+VFSPEVLDLTEDDLI KFA GVSM+ SLSLA SYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLIDKFAAGVSMIASLSLATSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV TEYSFP A+KVKE+LEDPSKF
Sbjct  241  PHMFINAYKNVLAVAVATEYSFPQAEKVKEFLEDPSKF  278



>ref|XP_009399833.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL++LSVYDNG+VFSPEVLDLTEDDLI KFA GVSMVTSLSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLIILSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSMVTSLSLAVSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEY+FP A+K+KEYL+DPSKF
Sbjct  241  PHMFINAYKNVLAVAIATEYTFPQAEKIKEYLKDPSKF  278



>gb|ADR71236.1| 60S acidic ribosomal protein P0B [Hevea brasiliensis]
Length=320

 Score =   290 bits (741),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLS YDNG+VFSPEVLDLTEDDL+ KFA GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLVEKFATGVSMVTSLALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LAIAV TEYSFP A+ V+EYL+DPSKF
Sbjct  241  PHMFVNAYKNVLAIAVATEYSFPRAETVREYLKDPSKF  278



>emb|CAN80537.1| hypothetical protein VITISV_003812 [Vitis vinifera]
Length=320

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTE+DL+ KFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLMEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN L++AV TEYSFP ADKVKE+L+DPSKF
Sbjct  241  PHMFVNAYKNVLSVAVATEYSFPQADKVKEFLKDPSKF  278



>gb|ADR71235.1| 60S acidic ribosomal protein P0A [Hevea brasiliensis]
Length=320

 Score =   289 bits (740),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLS YDNG+VFSPEVLDLTEDDL+ KFA GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLVEKFATGVSMVTSLALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LAIAV TEYSFP A+ V+EYL+DPSKF
Sbjct  241  PHMFVNAYKNVLAIAVATEYSFPRAETVREYLKDPSKF  278



>ref|XP_009389889.1| PREDICTED: 60S acidic ribosomal protein P0 [Musa acuminata subsp. 
malaccensis]
Length=319

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLV+LSVYDNG+VFSPEVLDL+EDDLI KFA G+SMVTSLSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVILSVYDNGSVFSPEVLDLSEDDLIEKFAAGISMVTSLSLAVSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEY+FP A+KVKEYL+DPSKF
Sbjct  241  PHMFINAYKNVLAVAIATEYTFPQAEKVKEYLKDPSKF  278



>emb|CBI31491.3| unnamed protein product [Vitis vinifera]
Length=292

 Score =   288 bits (736),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  93   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  152

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTE+DL+ KFA GVSMVTSLSLAISYPTLAAA
Sbjct  153  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLMEKFAAGVSMVTSLSLAISYPTLAAA  212

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN L++AV T+YSFP ADKVKE+L+DPSKF
Sbjct  213  PHMFVNAYKNVLSVAVATDYSFPQADKVKEFLKDPSKF  250



>ref|XP_002276842.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera]
Length=320

 Score =   288 bits (737),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTE+DL+ KFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLMEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN L++AV T+YSFP ADKVKE+L+DPSKF
Sbjct  241  PHMFVNAYKNVLSVAVATDYSFPQADKVKEFLKDPSKF  278



>ref|XP_007153264.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
 gb|ESW25258.1| hypothetical protein PHAVU_003G020600g [Phaseolus vulgaris]
Length=320

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDL+ KFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLLEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN L++A+ T+YSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKDPSKF  278



>gb|AGV54296.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDL+ KFA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLLEKFAAGVSMVTSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN L++A+ T+YSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKDPSKF  278



>ref|XP_009608105.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana tomentosiformis]
Length=320

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLVVLSVYDNG+VFSPEVLDLTEDDLI KFAMGVSMVTSLSLAISYPTLAAAPHM  N Y
Sbjct  189  GLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLSLAISYPTLAAAPHMFTNAY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LAIAVET+YSFPLADKVKEYLEDPSKF
Sbjct  249  KNVLAIAVETDYSFPLADKVKEYLEDPSKF  278



>ref|XP_009791710.1| PREDICTED: 60S acidic ribosomal protein P0 [Nicotiana sylvestris]
Length=321

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/150 (95%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLVVLSVYDNG+VFSPEVLDLTEDDLI KFAMGVSMVTSLSLAISYPTLAAAPHM  N Y
Sbjct  189  GLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLSLAISYPTLAAAPHMFTNAY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LAIAVET+YSFPLADKVKEYLEDPSKF
Sbjct  249  KNVLAIAVETDYSFPLADKVKEYLEDPSKF  278



>ref|XP_009409427.1| PREDICTED: 60S acidic ribosomal protein P0-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLV+LSVYDNG+VFSPEVLDLTEDDLI KFA GVS+VTSLSLAISYPTL AA
Sbjct  181  LGIRPFSYGLVILSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSLVTSLSLAISYPTLVAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEYSFP A+KVKEYL+DPSKF
Sbjct  241  PHMFINAYKNVLAVAIATEYSFPHAEKVKEYLKDPSKF  278



>emb|CDP14047.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLVVLSVYDNG+VFSPEVLDLTEDDLI KFA+GVSMVTSLSLAISYPTLAAAPHM INGY
Sbjct  189  GLVVLSVYDNGSVFSPEVLDLTEDDLIEKFALGVSMVTSLSLAISYPTLAAAPHMFINGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LAIAVET+YSFP ADKVKEYLEDPSKF
Sbjct  249  KNVLAIAVETDYSFPQADKVKEYLEDPSKF  278



>ref|XP_011035984.1| PREDICTED: 60S acidic ribosomal protein P0 [Populus euphratica]
Length=320

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLS YDNG+VFSPEVLDLTEDDL+ KFA GVSM+ SLSLA SYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSAYDNGSVFSPEVLDLTEDDLVEKFAAGVSMIASLSLATSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV TEYS+P A+KVKE+LEDPSKF
Sbjct  241  PHMFINAYKNILAVAVATEYSYPQAEKVKEFLEDPSKF  278



>ref|XP_010554654.1| PREDICTED: 60S acidic ribosomal protein P0 [Tarenaya hassleriana]
Length=320

 Score =   288 bits (736),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL+V SVYDNG+VFSPEVLDLTEDDL+ KFA GVSMVT+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLIVQSVYDNGSVFSPEVLDLTEDDLMEKFAAGVSMVTALSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEY+FP A+KVKEYL+DPSK 
Sbjct  241  PHMFINAYKNVLAVAIATEYTFPQAEKVKEYLKDPSKL  278



>ref|XP_010534571.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=321

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL+V SVYDNG+VFSPEVLDLTEDDL+ KFA GVSMVT+LSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLIVQSVYDNGSVFSPEVLDLTEDDLMEKFAAGVSMVTALSLAVSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV TEY+FP A+KVKEYL+DPSKF
Sbjct  241  PHMFINAYKNVLAVAVATEYTFPQAEKVKEYLKDPSKF  278



>ref|XP_007016138.1| Ribosomal protein L10 family protein [Theobroma cacao]
 gb|EOY33757.1| Ribosomal protein L10 family protein [Theobroma cacao]
Length=321

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYD+G+VFSPEVLDLTEDDL+ KFA GVSM  SLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDSGSVFSPEVLDLTEDDLVEKFANGVSMAASLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKNALA+AV ++YSFP A+KVKEYL+DPSKF
Sbjct  241  PHMFVNAYKNALAVAVASDYSFPQAEKVKEYLKDPSKF  278



>ref|XP_011072152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=330

 Score =   287 bits (735),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL+VLSVY++G+VFSPEVLDLTEDDL+ KFAMGVSMV SLSLAI+YPTLAAA
Sbjct  181  LGIRPFSYGLIVLSVYESGSVFSPEVLDLTEDDLVEKFAMGVSMVASLSLAITYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN L++AVET+YSFP ADKVKEYL DPSKF
Sbjct  241  PHMFINAYKNLLSVAVETDYSFPQADKVKEYLADPSKF  278



>gb|AAF34767.1|AF227622_1 60S acidic ribosomal protein PO [Euphorbia esula]
Length=317

 Score =   287 bits (734),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  118  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV +VYD+GTVFSPEVL+LTEDDL+ KFA+GVSM+TSL+L++SYPTLAAA
Sbjct  178  LGIRPFSYGLVVQTVYDSGTVFSPEVLNLTEDDLMAKFAIGVSMITSLALSVSYPTLAAA  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LAIAV T+YSFP ADKVKEYL DPSKF
Sbjct  238  PHMFINAYKNVLAIAVSTDYSFPQADKVKEYLADPSKF  275



>gb|AAD56335.1|AC009326_22 putative 60S acidic ribosomal protein, 5' partial [Arabidopsis 
thaliana]
Length=230

 Score =   283 bits (725),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  30   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  89

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  90   LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  149

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV TEY+FP A+KVKEYL+DPSKF
Sbjct  150  PHMFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKF  187



>ref|XP_010926952.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=320

 Score =   287 bits (734),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLV+ SVYDNG+VFSPEVLDLTEDDLI KFA GVSMVTSLSLA+SYPT+AAA
Sbjct  181  LGIRPFSYGLVIQSVYDNGSVFSPEVLDLTEDDLIEKFAAGVSMVTSLSLALSYPTVAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEY+FP A K+KE+LEDPSKF
Sbjct  241  PHMFINAYKNVLAVAIATEYTFPQAKKLKEFLEDPSKF  278



>emb|CDY07906.1| BnaC03g36170D [Brassica napus]
Length=323

 Score =   286 bits (733),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTEDDL+ KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAI V TEY+FP A+KVKEYL+DPSKF
Sbjct  240  PHMFINAYKNALAICVATEYTFPQAEKVKEYLKDPSKF  277



>gb|KDP44812.1| hypothetical protein JCGZ_01312 [Jatropha curcas]
Length=321

 Score =   286 bits (732),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDL+ KFA GVSMVTSL+LA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFATGVSMVTSLALAVSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            P+M IN YKN LA++V T+Y+FP A+KVKEYLEDPSKF
Sbjct  241  PYMFINAYKNVLAVSVATDYTFPQAEKVKEYLEDPSKF  278



>ref|NP_001078125.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 gb|AEE74737.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=287

 Score =   285 bits (729),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  87   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  146

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  147  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  206

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV TEY+FP A+KVKEYL+DPSKF
Sbjct  207  PHMFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKF  244



>gb|AID52928.1| 60S acidic ribosomal protein P0 [Carthamus tinctorius]
Length=321

 Score =   286 bits (732),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/150 (94%), Positives = 147/150 (98%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY
Sbjct  128  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  187

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLVVL+VYDNG+VFSPEVLDLTEDDLI KFA+GVSMVTSL+LAI YPT+AAAPHMLIN Y
Sbjct  188  GLVVLTVYDNGSVFSPEVLDLTEDDLIEKFALGVSMVTSLALAIHYPTIAAAPHMLINAY  247

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KNALAIAVET+YSFPLADKVKEYLEDPSKF
Sbjct  248  KNALAIAVETDYSFPLADKVKEYLEDPSKF  277



>ref|NP_187531.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
 sp|Q42112.2|RLA02_ARATH RecName: Full=60S acidic ribosomal protein P0-2 [Arabidopsis 
thaliana]
 gb|AAF14020.1|AC011436_4 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAK44040.1|AF370225_1 putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAL15223.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEE74736.1| 60S acidic ribosomal protein P0-2 [Arabidopsis thaliana]
Length=320

 Score =   286 bits (731),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV TEY+FP A+KVKEYL+DPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKF  277



>emb|CDY67524.1| BnaAnng24540D [Brassica napus]
 emb|CDY67517.1| BnaAnng24470D [Brassica napus]
Length=222

 Score =   282 bits (722),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  19   PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  78

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTEDDL+ KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  79   LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  138

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAI+V TEY+FP A+KVKE+L+DPSKF
Sbjct  139  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  176



>gb|ABK95701.1| unknown [Populus trichocarpa]
Length=322

 Score =   286 bits (731),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSP VLDLTEDDL+ KFA G++M+TSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPTVLDLTEDDLVEKFATGITMITSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHMLIN YKN L++AV TEYS+P A++VKE+L+DPSKF
Sbjct  241  PHMLINAYKNILSVAVATEYSYPQAEEVKEFLKDPSKF  278



>emb|CDX73962.1| BnaA03g30850D [Brassica napus]
Length=323

 Score =   286 bits (731),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTEDDL+ KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAI + TEY+FP A+KVKEYL+DPSKF
Sbjct  240  PHMFINAYKNALAICIATEYTFPQAEKVKEYLKDPSKF  277



>ref|XP_007157498.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
 gb|ESW29492.1| hypothetical protein PHAVU_002G074600g [Phaseolus vulgaris]
Length=321

 Score =   286 bits (731),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDLI KF  GVS+VTSLSLAIS+PTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLIEKFVSGVSIVTSLSLAISFPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN L++AVET+YS+P ADKVKEYL+DPSKF
Sbjct  241  PHMFVNAYKNVLSVAVETDYSYPEADKVKEYLKDPSKF  278



>gb|AAM63644.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
Length=320

 Score =   286 bits (731),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV TEY+FP A+KVKEYL+DPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEYLKDPSKF  277



>ref|XP_008799093.1| PREDICTED: 60S acidic ribosomal protein P0 [Phoenix dactylifera]
Length=320

 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLV+ SVY+NG+VFSPEVLDLTEDDLI KFA G+SMVTSLSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVIQSVYENGSVFSPEVLDLTEDDLIEKFAAGLSMVTSLSLALSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEY+FP A+KVKE+LEDPSKF
Sbjct  241  PHMFINAYKNVLAVAIATEYTFPQAEKVKEFLEDPSKF  278



>ref|XP_004307662.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  120  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDL+ KFA GVS VT+L+LAISYPT+AAA
Sbjct  180  LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMIKFASGVSNVTALALAISYPTIAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LAIAV TEYSFP ADKVKEYLEDPSKF
Sbjct  240  PHMFLNAYKNVLAIAVATEYSFPQADKVKEYLEDPSKF  277



>emb|CDY53103.1| BnaCnng24330D [Brassica napus]
Length=323

 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTEDDL+ KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAI+V TEY+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_004307622.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  120  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDL+ KFA GVS VT+L+LAISYPT+AAA
Sbjct  180  LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMIKFASGVSNVTALALAISYPTIAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LAIAV TEYSFP ADKVKEYLEDPSKF
Sbjct  240  PHMFLNAYKNVLAIAVATEYSFPQADKVKEYLEDPSKF  277



>ref|XP_002884720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LAISYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAISYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV TEY+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_009135066.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTEDDL+ KFA G+SMVTSL+LAIS+PT+AAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTIAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAI + TEY+FP A+KVKEYL+DPSKF
Sbjct  240  PHMFINAYKNALAICIATEYTFPQAEKVKEYLKDPSKF  277



>ref|XP_011042597.1| PREDICTED: 60S acidic ribosomal protein P0-like [Populus euphratica]
Length=321

 Score =   285 bits (729),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL+VLSVYDNG+VFSP VLDLTEDDL+ KFA G++M+TSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLIVLSVYDNGSVFSPTVLDLTEDDLVEKFATGIAMITSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+AV TEYS+P A++VKE+L+DPSKF
Sbjct  241  PHMFINAYKNILAVAVATEYSYPQAEEVKEFLKDPSKF  278



>ref|XP_010689885.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=321

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIT VELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITAVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL + SVYDNG+VFSPEVLDLTE+DL+ KFA GVSMVTSL LAISYPTLAAA
Sbjct  181  LGIRPFSYGLAIESVYDNGSVFSPEVLDLTEEDLLAKFASGVSMVTSLCLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM INGYKN LAIA+ET+Y FP A+KVKEYL+DPSKF
Sbjct  241  PHMFINGYKNVLAIALETDYDFPEAEKVKEYLKDPSKF  278



>ref|XP_009123454.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Brassica rapa]
Length=323

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTEDDL+ KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAI+V TEY+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_006848156.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
 gb|ERN09737.1| hypothetical protein AMTR_s00029p00231170 [Amborella trichopoda]
Length=322

 Score =   285 bits (729),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTE+DLI KF +GVSMVT+LSL+ISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEEDLIEKFDIGVSMVTALSLSISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM INGYKNALAIAV T+Y+F  A++VKEYL+DP+KF
Sbjct  241  PHMFINGYKNALAIAVATDYTFAQAEQVKEYLKDPTKF  278



>ref|XP_009146942.1| PREDICTED: 60S acidic ribosomal protein P0-2 [Brassica rapa]
 emb|CDY44688.1| BnaA05g29180D [Brassica napus]
Length=323

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTEDDL+ KFA G+SMVTSL+LAIS+PTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDDLVQKFAAGISMVTSLALAISFPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAI+V TEY+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_010486480.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV TEY+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_009619762.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=323

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P+DV+VP GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PVDVIVPTGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV+SVYDNG+VFSPEVLDLTEDDL+ KFA GVSMVT+LSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVVVSVYDNGSVFSPEVLDLTEDDLMEKFATGVSMVTTLSLAVSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            P+M + GYKN LA+ VETEYS+P AD+VKEYL+DPSKF
Sbjct  241  PYMFVKGYKNVLAVTVETEYSYPQADQVKEYLKDPSKF  278



>ref|XP_010469822.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV TEY+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_002312149.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
 gb|EEE89516.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa]
Length=322

 Score =   284 bits (727),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSP VLDLTEDDL+ KFA G++M+TSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPTVLDLTEDDLVEKFATGITMITSLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN L++AV TEYS+P A++VKE+L+DPSKF
Sbjct  241  PHMFINAYKNILSVAVATEYSYPQAEEVKEFLKDPSKF  278



>ref|XP_008779152.1| PREDICTED: 60S acidic ribosomal protein P0-like [Phoenix dactylifera]
Length=221

 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALLAK
Sbjct  22   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  81

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL++ SVYDNG+VFSPEVLDLTEDDL+ +FA GVS+VTSLSLA+SYPT+AAA
Sbjct  82   LGIRPFSYGLIIQSVYDNGSVFSPEVLDLTEDDLVERFAAGVSIVTSLSLALSYPTIAAA  141

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEY+FP A+KVKE+L+DPSKF
Sbjct  142  PHMFINAYKNVLAVAIATEYTFPQAEKVKEFLKDPSKF  179



>ref|XP_006298147.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
 gb|EOA31045.1| hypothetical protein CARUB_v10014197mg [Capsella rubella]
Length=322

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV TEY+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAIAVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_007222847.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
 ref|XP_008222707.1| PREDICTED: 60S acidic ribosomal protein P0 [Prunus mume]
 gb|EMJ24046.1| hypothetical protein PRUPE_ppa008800mg [Prunus persica]
Length=319

 Score =   284 bits (726),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV +VYDNG+VFSPEVLDLTEDDL+ KFA+GVSMVTSL+LAI+YPTLAAA
Sbjct  181  LGIRPFSYGLVVQTVYDNGSVFSPEVLDLTEDDLMVKFALGVSMVTSLALAIAYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+++ TEY+FP A+KVKEYL+DPSKF
Sbjct  241  PHMFLNAYKNVLAVSLATEYTFPQAEKVKEYLKDPSKF  278



>ref|XP_004239781.1| PREDICTED: 60S acidic ribosomal protein P0 [Solanum lycopersicum]
Length=321

 Score =   283 bits (725),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLVVLSVYDNG+VFSPEVLDLTEDDLI KFAMGVSMVTSL+LAISYPTLAAAPHM  N Y
Sbjct  189  GLVVLSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLALAISYPTLAAAPHMFTNAY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LAIA+ET+YSFPLADKVKEYL DPSKF
Sbjct  249  KNVLAIAIETDYSFPLADKVKEYLADPSKF  278



>ref|XP_010095082.1| 60S acidic ribosomal protein P0 [Morus notabilis]
 gb|EXB58188.1| 60S acidic ribosomal protein P0 [Morus notabilis]
Length=320

 Score =   283 bits (725),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALL+K
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VFSPEVLDLTEDDL+ KFA GVS+VTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSLVTSLALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH   N YKN LA+AV TEY+FP A+KVKE+LEDPSKF
Sbjct  241  PHFFTNAYKNVLAVAVATEYTFPQAEKVKEFLEDPSKF  278



>ref|XP_010464557.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
 ref|XP_010464558.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=321

 Score =   283 bits (725),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV TEY+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAIAVVTEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_009350848.1| PREDICTED: 60S acidic ribosomal protein P0-like [Pyrus x bretschneideri]
Length=321

 Score =   283 bits (724),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDL+ KFA GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMEKFASGVSMVTSLALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+++ TEYSFP A+KVKE+L+DPSKF
Sbjct  241  PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>ref|XP_008360784.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   283 bits (724),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDL+ KFA GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMEKFASGVSMVTSLALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+++ TEYSFP A+KVKE+L+DPSKF
Sbjct  241  PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>ref|NP_001275012.1| 60S acidic ribosomal protein P0-like [Solanum tuberosum]
 gb|ABB29933.1| P0 ribosomal protein-like [Solanum tuberosum]
 gb|ABB87111.1| P0 ribosomal protein-like [Solanum tuberosum]
Length=320

 Score =   283 bits (724),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 140/150 (93%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLVV+SVYDNG+VFSPEVLDLTEDDLI KFAMGVSMVTSL+LAISYPTLAAAPHM  N Y
Sbjct  189  GLVVVSVYDNGSVFSPEVLDLTEDDLIEKFAMGVSMVTSLALAISYPTLAAAPHMFTNAY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LAIAVET+YSFPLADKVKEYL DPSKF
Sbjct  249  KNVLAIAVETDYSFPLADKVKEYLADPSKF  278



>ref|XP_010941551.1| PREDICTED: 60S acidic ribosomal protein P0 [Elaeis guineensis]
Length=321

 Score =   283 bits (724),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLV+ +VYDNG+VFSPEVLDLTEDDL+ KFA GVSMVTSLSLA+SYPTL AA
Sbjct  181  LGIRPFSYGLVIQAVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMVTSLSLALSYPTLVAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEY+F  A+KVKEYL+DPSKF
Sbjct  241  PHMFINAYKNVLAVAIATEYTFEQAEKVKEYLKDPSKF  278



>ref|XP_009344598.1| PREDICTED: 60S acidic ribosomal protein P0 [Pyrus x bretschneideri]
Length=321

 Score =   283 bits (724),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDL+ KFA GVSMVTSL+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVEMVYDNGSVFSPEVLDLTEDDLMEKFASGVSMVTSLALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+++ TEYSFP A+KVKE+L+DPSKF
Sbjct  241  PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>ref|XP_006407706.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49159.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=322

 Score =   283 bits (724),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVL+LTEDDL+ KFA G+SMVTSL+LA+SYPT+AAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLNLTEDDLVEKFAAGISMVTSLALAVSYPTIAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAI+V TEY+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_006298124.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
 gb|EOA31022.1| hypothetical protein CARUB_v10014186mg [Capsella rubella]
Length=323

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV T+Y+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|NP_187734.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
 sp|P57691.1|RLA03_ARATH RecName: Full=60S acidic ribosomal protein P0-3 [Arabidopsis 
thaliana]
 gb|AAG50973.1|AC073395_15 60S acidic ribosomal protein, putative; 58619-59992 [Arabidopsis 
thaliana]
 gb|AAL07229.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AAM14140.1| putative 60S acidic ribosomal protein [Arabidopsis thaliana]
 gb|AEE75020.1| 60S acidic ribosomal protein P0-3 [Arabidopsis thaliana]
Length=323

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV T+Y+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|XP_010464828.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV T+Y+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|XP_002882720.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58979.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=323

 Score =   283 bits (723),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV T+Y+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|XP_006360336.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=320

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P+DV+VPPGNTGLDPSQTSFFQVLNIPTKIN+GTVEIITPVELIKKGDKVGSSEAALL+K
Sbjct  121  PVDVIVPPGNTGLDPSQTSFFQVLNIPTKINRGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV+SVYDNG+VFSPEVLDLT++DL+ KFA GV+M+T+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVISVYDNGSVFSPEVLDLTDEDLVEKFAAGVAMMTTLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM++NGYKN L +A+ETEY++P A +VKEYL+DPSKF
Sbjct  241  PHMIVNGYKNVLCVALETEYTYPQAQQVKEYLKDPSKF  278



>ref|XP_010534676.1| PREDICTED: 60S acidic ribosomal protein P0-like [Tarenaya hassleriana]
Length=320

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALLAK
Sbjct  120  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL+V SVYDNG+VFSPEVLDLTEDDL+ KFA GVSMVT+L+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLIVESVYDNGSVFSPEVLDLTEDDLMEKFAAGVSMVTALALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN L++A+ TEYSFP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNVLSVALATEYSFPQAEKVKEFLKDPSKF  277



>ref|XP_010247657.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nelumbo nucifera]
Length=320

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL +LSVYDNG+VFSPEVLDLTEDDL+ KF  GVSMVT+LSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLNILSVYDNGSVFSPEVLDLTEDDLMEKFVSGVSMVTALSLAVSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+AV TEYS+P A++VKEYL+DPSKF
Sbjct  241  PHMFVNAYKNVLAVAVATEYSYPQAEQVKEYLKDPSKF  278



>gb|AAM65265.1| 60S acidic ribosomal protein P0-C [Arabidopsis thaliana]
Length=323

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAIAV T Y+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAIAVATNYTFPQAEKVKEFLKDPSKF  277



>ref|XP_010256605.1| PREDICTED: 60S acidic ribosomal protein P0 [Nelumbo nucifera]
Length=319

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL++ SVYDNG+VFSPEVLDLTEDDL+ KFA GVSM T+L+LA+SYP LAAA
Sbjct  181  LGIRPFSYGLIIQSVYDNGSVFSPEVLDLTEDDLVEKFAAGVSMATALALAVSYPMLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+AV T+YSFP A+KVKEYL+DPSKF
Sbjct  241  PHMFVNAYKNVLAVAVATDYSFPQAEKVKEYLKDPSKF  278



>ref|XP_008392940.1| PREDICTED: 60S acidic ribosomal protein P0 [Malus domestica]
Length=321

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDL+ KFA GVSMVTSL+LA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVVEMVYDNGSVFSPEVLDLTEDDLMVKFASGVSMVTSLALAVSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+++ TEYSFP A+KVKE+L+DPSKF
Sbjct  241  PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  278



>gb|EPS69246.1| p0 ribosomal protein-like protein, partial [Genlisea aurea]
Length=329

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALLAK
Sbjct  128  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAK  187

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL+V  VYDNG+VFSPEVL+LTEDDLI KFA G+SMVT+LSL ISYPTLAAA
Sbjct  188  LGIRPFSYGLIVTIVYDNGSVFSPEVLNLTEDDLIEKFASGISMVTALSLGISYPTLAAA  247

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN L++A+ET+YSFP ADKVKEYL DPSKF
Sbjct  248  PHMFINAYKNVLSLALETDYSFPQADKVKEYLADPSKF  285



>ref|XP_004287422.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEII PVELIKKGDKVGSSEAALLAK
Sbjct  120  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIMPVELIKKGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDL+ KFA GVS VT+L++A+SYPT+AAA
Sbjct  180  LGIRPFSYGLVVQMVYDNGSVFSPEVLDLTEDDLMIKFASGVSNVTALAMAVSYPTIAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LAIAV TEYSFP ADKVKEYLEDPSKF
Sbjct  240  PHMFLNAYKNVLAIAVATEYSFPQADKVKEYLEDPSKF  277



>ref|XP_006435697.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
 ref|XP_006486350.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48937.1| hypothetical protein CICLE_v10032141mg [Citrus clementina]
Length=319

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVY+NG+V+SPEVLDL+EDDL+ KFA  VSMVT+L+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDDLVEKFASSVSMVTALALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN +A+A+ TEYSFP ADKVKEYL DPSKF
Sbjct  241  PHMFVNAYKNVVAVALATEYSFPQADKVKEYLADPSKF  278



>gb|KDO69054.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=319

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVY+NG+V+SPEVLDL+EDDL+ KFA  VSMVT+L+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDDLVEKFASSVSMVTALALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN +A+A+ TEYSFP ADKVKEYL DPSKF
Sbjct  241  PHMFVNAYKNVVAVALATEYSFPQADKVKEYLADPSKF  278



>ref|XP_010486703.1| PREDICTED: 60S acidic ribosomal protein P0-3 [Camelina sativa]
Length=323

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LAIAV T+Y+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNVLAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|XP_004247949.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=320

 Score =   281 bits (718),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P+DV+VPPGNTGLDPSQTSFFQVLNI TKINKGTVEIITPVELIKKGDKVGSSEAALL+K
Sbjct  121  PVDVIVPPGNTGLDPSQTSFFQVLNIATKINKGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV+SVYDNG+VFSP+VLDLT++DL+ KFA GV+M+T+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVISVYDNGSVFSPQVLDLTDEDLVEKFAAGVTMITTLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM++NGYKN L +AVETEY++P A +VKEYL+DPSKF
Sbjct  241  PHMIVNGYKNVLGVAVETEYTYPQAQQVKEYLKDPSKF  278



>ref|XP_010486773.1| PREDICTED: 60S acidic ribosomal protein P0-3-like [Camelina sativa]
Length=324

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSPEVLDLTED L+ KFA G+SMVTSL+LA+SYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFSPEVLDLTEDQLVEKFASGISMVTSLALAVSYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LAIAV T+Y+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNVLAIAVATDYTFPQAEKVKEFLKDPSKF  277



>ref|XP_006411245.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
 gb|ESQ52698.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum]
Length=317

 Score =   281 bits (718),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL+V SVYDNG+VFSPEVL+LTEDDL+ KFA GVS++T+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLIVESVYDNGSVFSPEVLNLTEDDLVEKFAAGVSLITALSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LAIA+ TEYSFP AD VKE+L+DPSKF
Sbjct  241  PHMFLNAYKNVLAIALATEYSFPQADNVKEFLKDPSKF  278



>gb|EMS52841.1| 60S acidic ribosomal protein P0 [Triticum urartu]
Length=263

 Score =   278 bits (712),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG+VEI+  V+LIKKGDKVGSSEAALLAK
Sbjct  63   PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGSVEIVAHVDLIKKGDKVGSSEAALLAK  122

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLV+ +VYD+G+VFSPEVLDLTE+DL+ KFA GVSMV SLSLA+SYPTLAAA
Sbjct  123  LGIRPFSYGLVITNVYDDGSVFSPEVLDLTEEDLMEKFACGVSMVASLSLAVSYPTLAAA  182

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +NGYKN LA+AVETEYSFP AD++KEYL+DPSKF
Sbjct  183  PHMFLNGYKNVLALAVETEYSFPHADQIKEYLKDPSKF  220



>gb|KFK36893.1| hypothetical protein AALP_AA4G185700 [Arabis alpina]
Length=318

 Score =   280 bits (717),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VFSP+VL+LTED L+ KFA+GVSM+T+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFSPDVLNLTEDSLVEKFAVGVSMITALSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEYSFP A+ VKE+L+DPSKF
Sbjct  241  PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>gb|KHN34735.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=320

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELI KGDKVGSSEAALL+K
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIMKGDKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L IRPFSYGL V+SVYDNG+VFSPEVLDLTEDDL+ KFA GV MV+SLSLAISYP++AAA
Sbjct  181  LAIRPFSYGLAVVSVYDNGSVFSPEVLDLTEDDLVVKFAEGVCMVSSLSLAISYPSIAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+AV TEYSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPSKF  278



>gb|KHN36391.1| 60S acidic ribosomal protein P0 [Glycine soja]
Length=321

 Score =   280 bits (715),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI KGDKVGSSEAALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIMKGDKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L IRPFSYGL V+SVY+NG+VFSPEVLDLTEDDL+ KFA GV MV+SLSLAISYP++AAA
Sbjct  181  LAIRPFSYGLAVVSVYENGSVFSPEVLDLTEDDLVVKFAEGVCMVSSLSLAISYPSIAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+AV TEYSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPSKF  278



>gb|KFK38515.1| hypothetical protein AALP_AA3G123100 [Arabis alpina]
Length=324

 Score =   279 bits (713),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VF P+VL+LTED L+ KFA+G+SMVTSL+LAISYPTLAAA
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFKPDVLNLTEDALVEKFAVGISMVTSLALAISYPTLAAA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAI+V TEY+FP A+KVKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  277



>ref|XP_009764939.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=323

 Score =   278 bits (712),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P+DV+VP GNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELIKKGDKVGSSEAALLAK
Sbjct  121  PVDVIVPTGNTGLDPSQTSFFQVLNIPTKINKGTVEIMTPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLV++SVYDNG+VFSPEVL+LTEDDL+ KFA GVSMVT+LSLA+SYPTLAAA
Sbjct  181  LGIRPFSYGLVMVSVYDNGSVFSPEVLELTEDDLMEKFATGVSMVTTLSLAVSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            P+M + GY+N LA+AVET+YS+P AD+VKEYL+DPSKF
Sbjct  241  PYMFVKGYENVLAVAVETDYSYPQADQVKEYLKDPSKF  278



>ref|XP_003538454.1| PREDICTED: 60S acidic ribosomal protein P0-like [Glycine max]
Length=320

 Score =   278 bits (711),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+TPVELI KGDKVGSSEA LL+K
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTPVELIMKGDKVGSSEAVLLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L IRPFSYGL V+SVYDNG+VFSPEVLDLTEDDL+ KFA GV MV+SLSLAISYP++AAA
Sbjct  181  LAIRPFSYGLAVVSVYDNGSVFSPEVLDLTEDDLVVKFAEGVCMVSSLSLAISYPSIAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+AV TEYSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFVNSYKNILAVAVATEYSFPEADKVKEYLKDPSKF  278



>ref|XP_004145258.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004152959.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 ref|XP_004168551.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Cucumis sativus]
 gb|KGN65800.1| hypothetical protein Csa_1G530120 [Cucumis sativus]
Length=320

 Score =   278 bits (710),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL+K
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL+V+SVYDNG+VFSP VLDL+E+DL+ KF  GVSMV SLSLA+S+PTLAAA
Sbjct  181  LGIRPFSYGLIVVSVYDNGSVFSPAVLDLSEEDLLEKFLAGVSMVASLSLAVSFPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHMLIN YKNALAIAV TEYSF  AD++KE+L+DPSKF
Sbjct  241  PHMLINAYKNALAIAVATEYSFSEADEIKEFLKDPSKF  278



>ref|XP_010508934.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Camelina sativa]
Length=318

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VF+PEVL+LTEDDL+ KFA GVSM T+LSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMTTALSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
             HM +N YKNALA+A+ TEYSFP A+ VKE+L+DPSKF
Sbjct  241  THMFLNAYKNALAVALATEYSFPQAENVKEFLKDPSKF  278



>emb|CDP16385.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIT VELIKKGDKVGSSE+ALL+K
Sbjct  121  PDDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITAVELIKKGDKVGSSESALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LG+RPFSYGL+V +VY+NG+VFSPEVLDLTEDDL  KF +G+SM TSLSL ISYP L+AA
Sbjct  181  LGVRPFSYGLIVQAVYENGSVFSPEVLDLTEDDLAVKFLVGLSMATSLSLEISYPALSAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHMLINGYKNALAIAVETEYSFP AD+VKEYL+DPSKF
Sbjct  241  PHMLINGYKNALAIAVETEYSFPQADEVKEYLKDPSKF  278



>ref|NP_181530.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
 sp|O04204.1|RLA01_ARATH RecName: Full=60S acidic ribosomal protein P0-1 [Arabidopsis 
thaliana]
 gb|AAB95286.1| 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AAN71918.1| putative 60S acidic ribosomal protein P0 [Arabidopsis thaliana]
 gb|AEC09763.1| 60S acidic ribosomal protein P0-1 [Arabidopsis thaliana]
Length=317

 Score =   277 bits (709),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VF+PEVL+LTEDDL+ KFA GVSM+T+LSLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMITALSLAISYPTVAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+A+ TEYSFP A+ VKE+L+DP+KF
Sbjct  241  PHMFLNAYKNVLAVALATEYSFPQAENVKEFLKDPTKF  278



>gb|KFK38306.1| hypothetical protein AALP_AA3G096900 [Arabis alpina]
Length=323

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDKVGSSEAALLAK
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDKVGSSEAALLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VF+P+VL+LTED L+ KFA+G+SMVTSL+LAISYPTLA+A
Sbjct  180  LGIRPFSYGLVVQSVYDNGSVFNPDVLNLTEDALVEKFAVGISMVTSLALAISYPTLASA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAI+V TEY+FP A++VKE+L+DPSKF
Sbjct  240  PHMFINAYKNALAISVATEYTFPQAEQVKEFLKDPSKF  277



>emb|CDY24932.1| BnaC03g22400D [Brassica napus]
Length=319

 Score =   276 bits (707),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VF PEVL+LTEDDL+ KFA GVS+VT+LSLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDDLVEKFAAGVSLVTALSLAISYPTIAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEYSFP A+ VKE+L+DPSKF
Sbjct  241  PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>ref|XP_011084927.1| PREDICTED: 60S acidic ribosomal protein P0-like [Sesamum indicum]
Length=315

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 146/152 (96%), Gaps = 0/152 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL+VLSVY++G+VFSPEVLDLTEDDL+ KFAMGVSMV SLSLAI+YPTLAAA
Sbjct  181  LGIRPFSYGLIVLSVYESGSVFSPEVLDLTEDDLVEKFAMGVSMVASLSLAITYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYL  318
            PHM IN YKN L++AVET+YSFP ADKVKEYL
Sbjct  241  PHMFINAYKNLLSVAVETDYSFPQADKVKEYL  272



>ref|XP_002881693.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57952.1| 60S acidic ribosomal protein P0 [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VF+PEVL+LTEDDL+ KFA GVSM+T++SLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMITAISLAISYPTVAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+A+ TEYSFP A+ VKE+L+DP+KF
Sbjct  241  PHMFLNAYKNVLAVALATEYSFPQAENVKEFLKDPTKF  278



>ref|XP_002525622.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
 gb|EEF36740.1| 60S acidic ribosomal protein P0, putative [Ricinus communis]
Length=323

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPV++IKKG+KVGSSE+ALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVDIIKKGEKVGSSESALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVL+VYD+G+VFSPEVLDLT+DDL+ KFA GVSMV SLSL++S+PT+AAA
Sbjct  181  LGIRPFSYGLVVLTVYDSGSVFSPEVLDLTDDDLVAKFASGVSMVASLSLSLSFPTIAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +NGYKN L++A+ +EYSFP A+KVKEYL+DPSKF
Sbjct  241  PHMFVNGYKNVLSVAMVSEYSFPQAEKVKEYLKDPSKF  278



>ref|XP_010517390.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Camelina sativa]
Length=318

 Score =   276 bits (705),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VF+PEVL+LTEDDL+ KFA GVSM+T+LSLA SYPTLAAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFNPEVLNLTEDDLVEKFAAGVSMITALSLAASYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKNAL +A+ TEYSFP A+ VKE+++DPSKF
Sbjct  241  PHMFLNAYKNALVVALATEYSFPQAENVKEFVKDPSKF  278



>emb|CDY60988.1| BnaA03g56530D [Brassica napus]
Length=318

 Score =   275 bits (704),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VF PEVL+LTEDDL+ KFA GVS+VT+ SLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDDLVEKFAAGVSLVTAFSLAISYPTIAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEYSFP A+ VKE+L+DPSKF
Sbjct  241  PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>ref|XP_009133397.1| PREDICTED: 60S acidic ribosomal protein P0-1 [Brassica rapa]
Length=319

 Score =   275 bits (703),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVYDNG+VF PEVL+LTEDDL+ KFA GVS+VT+ SLAISYPT+AAA
Sbjct  181  LGIRPFSYGLVVESVYDNGSVFDPEVLNLTEDDLVEKFAAGVSLVTAFSLAISYPTIAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA+A+ TEYSFP A+ VKE+L+DPSKF
Sbjct  241  PHMFINAYKNVLAVALATEYSFPQAENVKEFLKDPSKF  278



>ref|XP_002440235.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
 gb|EES18665.1| hypothetical protein SORBIDRAFT_09g028230 [Sorghum bicolor]
Length=319

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P+DVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAK
Sbjct  121  PVDVVVSPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL +++VY++G+VFSPEVLDLTE+DL+ KF+ GVSMV SLSL +SYPTLAAA
Sbjct  181  LGIRPFSYGLQIVNVYEDGSVFSPEVLDLTEEDLVEKFSAGVSMVASLSLVVSYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM INGYKN LA+AVET+YS+P AD++KEYL+DPSKF
Sbjct  241  PHMFINGYKNVLAVAVETDYSYPHADEIKEYLKDPSKF  278



>gb|EMT02739.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=322

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKG+VEI+  V+LIKKGDKVGSSEA LLAK
Sbjct  122  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGSVEIVAHVDLIKKGDKVGSSEATLLAK  181

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLV+ +VY +G+VFSPEVLDLTE+DL+ KFA GVSMV SLSLA+SYPTLAAA
Sbjct  182  LGIRPFSYGLVITNVYGDGSVFSPEVLDLTEEDLMEKFACGVSMVASLSLAVSYPTLAAA  241

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +NGYKN LA+AVET+YSFP AD++KEYL+DPSKF
Sbjct  242  PHMFLNGYKNVLALAVETDYSFPHADQIKEYLKDPSKF  279



>ref|XP_008457380.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cucumis melo]
Length=320

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL+K
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL+V+SVYDNG+VFSP VLDLTE+DL+ KF  GVSMV SLSLA+S+PTLAAA
Sbjct  181  LGIRPFSYGLIVVSVYDNGSVFSPAVLDLTEEDLLEKFLAGVSMVASLSLAVSFPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDP  309
            PHMLIN YKNALAIAV TEYSF  AD++KE+L+DP
Sbjct  241  PHMLINAYKNALAIAVATEYSFSEADEIKEFLKDP  275



>gb|KHG21849.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=237

 Score =   270 bits (690),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+T VELI+KG+KVGSSEAALL+K
Sbjct  37   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTAVELIRKGEKVGSSEAALLSK  96

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV+SVYDNGTVFSPEVLDLTEDDL+ KF   +S VTSLSLA+S+PTLAAA
Sbjct  97   LGIRPFSYGLVVVSVYDNGTVFSPEVLDLTEDDLMEKFRSWLSNVTSLSLAVSFPTLAAA  156

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YK AL++AV TEY+FP A+K+KEYL+DP+KF
Sbjct  157  PHMFINAYKTALSLAVATEYTFPQAEKIKEYLKDPTKF  194



>gb|EEC82854.1| hypothetical protein OsI_27702 [Oryza sativa Indica Group]
Length=216

 Score =   269 bits (688),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  26   GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  85

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTEDDL+ KFA GVSMV S+SLAISYPT+AAAPHM +NGY
Sbjct  86   GLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGY  145

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVETEYS+P ADK+KEYL+DPSKF
Sbjct  146  KNVLAVAVETEYSYPHADKIKEYLKDPSKF  175



>gb|KHG01938.1| 60S acidic ribosomal P0-2 -like protein [Gossypium arboreum]
Length=253

 Score =   270 bits (691),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI+T VELI+KG+KVGSSEAALL+K
Sbjct  53   PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIVTAVELIRKGEKVGSSEAALLSK  112

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV+SVYDNGTVFSPEVLDLTEDDL+ KF   +S VTSLSLA+S+PTLAAA
Sbjct  113  LGIRPFSYGLVVVSVYDNGTVFSPEVLDLTEDDLMEKFRSWLSNVTSLSLAVSFPTLAAA  172

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YK AL++AV TEY+FP A+K+KEYL+DP+KF
Sbjct  173  PHMFINAYKTALSLAVATEYTFPQAEKIKEYLKDPTKF  210



>gb|KDO69055.1| hypothetical protein CISIN_1g020952mg [Citrus sinensis]
Length=318

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV SVY+NG+V+SPEVLDL+EDDL+ KFA  VSMVT+L+LAISYPTLAAA
Sbjct  181  LGIRPFSYGLVVQSVYENGSVYSPEVLDLSEDDLVEKFASSVSMVTALALAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYL  318
            PHM +N YKN +A+A+ TEYSFP ADKVKEYL
Sbjct  241  PHMFVNAYKNVVAVALATEYSFPQADKVKEYL  272



>ref|XP_003573632.1| PREDICTED: 60S acidic ribosomal protein P0-like [Brachypodium 
distachyon]
Length=323

 Score =   271 bits (694),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVP GNTGLDP+QTSFFQVLNIPTKINKGTVEII  V+LIKKGDKVGSSEAALLAK
Sbjct  124  PIDVVVPAGNTGLDPTQTSFFQVLNIPTKINKGTVEIIANVDLIKKGDKVGSSEAALLAK  183

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLV+  VYD+G+VFSPEVLDLTE+DL+ +FA GVSMV SLSLA+SYPT+AAA
Sbjct  184  LGIRPFSYGLVITQVYDDGSVFSPEVLDLTEEDLMERFASGVSMVASLSLAVSYPTMAAA  243

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +NGYKN LA+A+ET+YS+P AD++KEYL+DPSKF
Sbjct  244  PHMFLNGYKNVLAVALETDYSYPHADQIKEYLKDPSKF  281



>gb|ABR26209.1| 60S acidic ribosomal protein p0 [Oryza sativa Indica Group]
Length=238

 Score =   268 bits (686),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  48   GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  107

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTEDDL+ KFA GVSMV S+SLAISYPT+AAAPHM +NGY
Sbjct  108  GLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGY  167

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVETEYS+P ADK+KEYL+DPSKF
Sbjct  168  KNVLAVAVETEYSYPHADKIKEYLKDPSKF  197



>ref|XP_008351783.1| PREDICTED: uncharacterized protein LOC103415220 [Malus domestica]
Length=762

 Score =   283 bits (724),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  562  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  621

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYDNG+VFSPEVLDLTEDDL+ KFA GVSMVTSL+LA+SYPTLAAA
Sbjct  622  LGIRPFSYGLVVEMVYDNGSVFSPEVLDLTEDDLMVKFASGVSMVTSLALAVSYPTLAAA  681

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN LA+++ TEYSFP A+KVKE+L+DPSKF
Sbjct  682  PHMFLNAYKNVLAVSIATEYSFPQAEKVKEFLKDPSKF  719



>ref|NP_001060923.1| Os08g0130500 [Oryza sativa Japonica Group]
 sp|P41095.3|RLA0_ORYSJ RecName: Full=60S acidic ribosomal protein P0 [Oryza sativa Japonica 
Group]
 pdb|3J61|QQ Chain q, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAA04668.1| acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAC66723.1| 60S acidic ribosomal protein P0 [Oryza sativa Japonica Group]
 dbj|BAF22837.1| Os08g0130500 [Oryza sativa Japonica Group]
 dbj|BAG89244.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   270 bits (691),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTEDDL+ KFA GVSMV S+SLAISYPT+AAAPHM +NGY
Sbjct  189  GLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVETEYS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>gb|EYU22330.1| hypothetical protein MIMGU_mgv1a019166mg, partial [Erythranthe 
guttata]
Length=230

 Score =   267 bits (683),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 135/152 (89%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VP GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALL+K
Sbjct  15   PIDVIVPRGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGNKVGSSEAALLSK  74

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+V+SPEVL L  DDL+ KFAMGVSMV SLSLAISYPTLAAA
Sbjct  75   LGIRPFSYGLVVLSVYDNGSVYSPEVLHLPVDDLVAKFAMGVSMVNSLSLAISYPTLAAA  134

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYL  318
             HM INGYKN LA AVET YSFPLADKVKEYL
Sbjct  135  LHMFINGYKNVLAAAVETGYSFPLADKVKEYL  166



>gb|EAZ41410.1| hypothetical protein OsJ_25932 [Oryza sativa Japonica Group]
Length=235

 Score =   267 bits (683),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  45   GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  104

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTEDDL+ KFA GVSMV S+SLAISYPT+AAAPHM +NGY
Sbjct  105  GLVITNVYDSGSVFSPEVLDLTEDDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGY  164

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVETEYS+P ADK+KEYL+DPSKF
Sbjct  165  KNVLAVAVETEYSYPHADKIKEYLKDPSKF  194



>ref|XP_007163525.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
 gb|ESW35519.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris]
Length=317

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSEAALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSEAALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L IRPFSYGLVV+SVYDNG+VFSP VL+LT+DDL+  FA GVSMV+SLSLAISYPT+AAA
Sbjct  181  LAIRPFSYGLVVVSVYDNGSVFSPAVLNLTDDDLVNMFANGVSMVSSLSLAISYPTIAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
             HM  N YKN LA+AV TEYSFP AD+VKE+L+DPSKF
Sbjct  241  LHMFANSYKNVLAVAVVTEYSFPEADEVKEFLKDPSKF  278



>ref|XP_004972933.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GL +++VY++G+VFSPEVLDLTEDDL+ KFA GVSMV SLSLA+SYPTLAAAPHM INGY
Sbjct  189  GLQIVNVYEDGSVFSPEVLDLTEDDLVEKFATGVSMVASLSLALSYPTLAAAPHMFINGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVET+YS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>ref|XP_006659092.1| PREDICTED: 60S acidic ribosomal protein P0-like [Oryza brachyantha]
Length=319

 Score =   269 bits (687),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTE+DL+ KFA GVSMV S+SLAISYPT+AAAPHM +NGY
Sbjct  189  GLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVETEYS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>ref|XP_004958562.1| PREDICTED: 60S acidic ribosomal protein P0-like [Setaria italica]
Length=319

 Score =   268 bits (686),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GL V++VY++G+VFSPEVLDLTE+DLI KFA GVSMV SLSLA+SYPTLAAAPHM INGY
Sbjct  189  GLQVINVYEDGSVFSPEVLDLTEEDLIEKFATGVSMVASLSLALSYPTLAAAPHMFINGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVET+YS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>gb|ABA91328.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAY79838.1| hypothetical protein OsI_34997 [Oryza sativa Indica Group]
 gb|EAZ41411.1| hypothetical protein OsJ_25933 [Oryza sativa Japonica Group]
Length=320

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTE+DL+ KFA GVSMV S+SLAISYPT+AAAPHM +NGY
Sbjct  189  GLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVETEYS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>gb|EAY82182.1| hypothetical protein OsI_37384 [Oryza sativa Indica Group]
 emb|CBX24392.1| hypothetical_protein [Oryza glaberrima]
Length=320

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTE+DL+ KFA GVSMV S+SLAISYPT+AAAPHM +NGY
Sbjct  189  GLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVETEYS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>emb|CBX25428.1| hypothetical_protein [Oryza glaberrima]
Length=322

 Score =   268 bits (686),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  131  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  190

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTE+DL+ KFA GVSMV S+SLAISYPT+AAAPHM +NGY
Sbjct  191  GLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGY  250

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVETEYS+P ADK+KEYL+DPSKF
Sbjct  251  KNVLAVAVETEYSYPHADKIKEYLKDPSKF  280



>gb|ABA95724.1| 60S acidic ribosomal protein P0, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ19563.1| hypothetical protein OsJ_35136 [Oryza sativa Japonica Group]
Length=320

 Score =   268 bits (685),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 143/150 (95%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTE+DL+ KFA GVSMV S+SLAISYPT+AAAPHM +NGY
Sbjct  189  GLVITNVYDSGSVFSPEVLDLTEEDLMEKFASGVSMVASVSLAISYPTIAAAPHMFLNGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVETEYS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETEYSYPHADKIKEYLKDPSKF  278



>gb|ADE76171.1| unknown [Picea sitchensis]
Length=266

 Score =   266 bits (679),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSEAALLAKLGIRPFSY
Sbjct  74   GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSEAALLAKLGIRPFSY  133

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLVV SVYDNG+VF PEVLDLTEDDLI KFA G+S VT+LSLAISYPT+AA PH +INGY
Sbjct  134  GLVVQSVYDNGSVFDPEVLDLTEDDLIEKFAAGISTVTALSLAISYPTIAAVPHAIINGY  193

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LAIA+E +YSFPLA+KVKEYL+DPSKF
Sbjct  194  KNVLAIAIELDYSFPLAEKVKEYLKDPSKF  223



>ref|XP_006296009.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
 gb|EOA28907.1| hypothetical protein CARUB_v10025153mg [Capsella rubella]
Length=319

 Score =   267 bits (683),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL V SVYDNG+VF+PEVL+LTEDDL+ KFA GVSM+T+LSLA SYPTLAAA
Sbjct  181  LGIRPFSYGLAVESVYDNGSVFNPEVLNLTEDDLVDKFAAGVSMITALSLAASYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN +A+A  TEYSFP ++ VKE L+DP+ +
Sbjct  241  PHMFLNAYKNVVAVAFATEYSFPRSENVKECLKDPTSW  278



>ref|XP_010234277.1| PREDICTED: 60S acidic ribosomal protein P0 [Brachypodium distachyon]
Length=321

 Score =   266 bits (680),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTE+DL+ KFA GVSMV SLSLAISYPT+AAAPHM IN Y
Sbjct  189  GLVINNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTIAAAPHMFINAY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LAIAVET+YS+P  DK+KEYL+DPSKF
Sbjct  249  KNVLAIAVETDYSYPHGDKIKEYLKDPSKF  278



>ref|XP_002445000.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
 gb|EES14495.1| hypothetical protein SORBIDRAFT_07g002560 [Sorghum bicolor]
Length=319

 Score =   265 bits (678),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GL V +VY++G+VFSPEVLDL+E+DLI KFA GVSMV SLSLAISYPTLAA PHM INGY
Sbjct  189  GLQVTNVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLAISYPTLAAVPHMFINGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVET+YS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>gb|KDO69056.1| hypothetical protein CISIN_1g036252mg [Citrus sinensis]
Length=318

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGD+VGSSE+ALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDRVGSSESALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I+PFSYGL+V+SVY+NG+V+SPEVLDLTEDD+  KF   VS V SL+L+I YPT+AAA
Sbjct  181  LAIKPFSYGLIVMSVYENGSVYSPEVLDLTEDDIATKFLEAVSRVASLALSIRYPTIAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH  INGYKN L+ AV TEYSF  ADKVKEYL+DPSKF
Sbjct  241  PHFFINGYKNVLSFAVATEYSFSQADKVKEYLKDPSKF  278



>ref|XP_006435696.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
 ref|XP_006486351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Citrus sinensis]
 gb|ESR48936.1| hypothetical protein CICLE_v10033862mg [Citrus clementina]
Length=318

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGD+VGSSE+ALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDRVGSSESALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I+PFSYGL+V+SVY+NG+V+SPEVLDLTEDD+  KF   VS V SL+L+I YPT+AAA
Sbjct  181  LAIKPFSYGLIVMSVYENGSVYSPEVLDLTEDDIATKFLEAVSRVASLALSIRYPTIAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH  INGYKN L+ AV TEYSF  ADKVKEYL+DPSKF
Sbjct  241  PHFFINGYKNVLSFAVATEYSFSQADKVKEYLKDPSKF  278



>gb|ACF83717.1| unknown [Zea mays]
 gb|AFW74477.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GL V SVY++G+VFSPEVLDL+E+DLI KFA GVSMV SLSLAISYPTLAA PHM INGY
Sbjct  189  GLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLAISYPTLAAVPHMFINGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVET+YS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>ref|NP_001105482.1| 60S acidic ribosomal protein P0 [Zea mays]
 sp|O24573.3|RLA0_MAIZE RecName: Full=60S acidic ribosomal protein P0 [Zea mays]
 emb|CAA69256.1| 60S acidic ribosomal protein P0 [Zea mays]
Length=319

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GL V SVY++G+VFSPEVLDL+E+DLI KFA GVSMV SLSLAISYPTLAA PHM INGY
Sbjct  189  GLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLAISYPTLAAVPHMFINGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVET+YS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>gb|ACL52455.1| unknown [Zea mays]
Length=319

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GL V SVY++G+VFSPEVLDL+E+DLI KFA GVSMV SLSLA+SYPTLAA PHM INGY
Sbjct  189  GLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLALSYPTLAAVPHMFINGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVET+YS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>ref|NP_001141489.1| hypothetical protein [Zea mays]
 gb|ACF86473.1| unknown [Zea mays]
 gb|AFW61287.1| hypothetical protein ZEAMMB73_391125 [Zea mays]
Length=319

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKG+KVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGEKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GL V SVY++G+VFSPEVLDL+E+DLI KFA GVSMV SLSLA+SYPTLAA PHM INGY
Sbjct  189  GLQVTSVYEDGSVFSPEVLDLSEEDLIEKFATGVSMVASLSLALSYPTLAAVPHMFINGY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AVET+YS+P ADK+KEYL+DPSKF
Sbjct  249  KNVLAVAVETDYSYPHADKIKEYLKDPSKF  278



>ref|XP_009799989.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana sylvestris]
Length=319

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEI  PVE+IKKG+KVGSSE+ALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEITIPVEIIKKGEKVGSSESALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGI+PFSYGL+V  VYD+G+VFSPEVLDLTEDDLI KFA G+S V  LS+ +SYPTLAA 
Sbjct  181  LGIKPFSYGLIVQFVYDSGSVFSPEVLDLTEDDLIAKFAAGLSNVVGLSMLLSYPTLAAI  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM INGYKN L+ A+ TEYSFP A+KVKEYL+DPSKF
Sbjct  241  PHMFINGYKNVLSFAIATEYSFPQAEKVKEYLKDPSKF  278



>gb|KDP46515.1| hypothetical protein JCGZ_08487 [Jatropha curcas]
Length=319

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPG TGLDPS TSFFQ LNIPTKINKG+VEI+T V+LIKKG+KVGSSE+ALLAK
Sbjct  121  PIDVVVPPGPTGLDPSMTSFFQALNIPTKINKGSVEIVTAVDLIKKGEKVGSSESALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L IRPFSYGL+V SVYDNG+VFSPEVLDLTEDDL+ +F  GVSMVTSLSL+IS+PTLAAA
Sbjct  181  LQIRPFSYGLIVFSVYDNGSVFSPEVLDLTEDDLVERFVNGVSMVTSLSLSISFPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN L+++V TEY+FP A++VKE+LEDPSKF
Sbjct  241  PHMFLNAYKNVLSVSVATEYTFPQAEQVKEFLEDPSKF  278



>emb|CDP06275.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  770  IDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKL  591
            +DVVVPPGNTG DPSQTSFFQVLNIPT INKGTVEIIT VELIK GDK GSSE+ALL+KL
Sbjct  67   VDVVVPPGNTGPDPSQTSFFQVLNIPTNINKGTVEIITAVELIKNGDKDGSSESALLSKL  126

Query  590  GIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAP  411
            GIRPFSYGL+V SV+DNG+VFSP+VL+LTEDD++ KF++G+SM TSL+L ISYP+L+AAP
Sbjct  127  GIRPFSYGLIVPSVFDNGSVFSPDVLNLTEDDVVEKFSLGLSMATSLALGISYPSLSAAP  186

Query  410  HMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            H+LINGYKNAL IAVETEYSF  ADKV EYL+DPS+F
Sbjct  187  HILINGYKNALVIAVETEYSFSQADKVNEYLKDPSEF  223



>ref|XP_009592351.1| PREDICTED: 60S acidic ribosomal protein P0-like [Nicotiana tomentosiformis]
Length=319

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKIN+GTVEI  PVE+IKKG+KVGSSE+ALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINRGTVEITIPVEIIKKGEKVGSSESALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGI+PFSYGL+V  VYD+G+VFSPEVLDLTE+DLI KFA G+S V  LS+ +SYPTLAA 
Sbjct  181  LGIKPFSYGLIVQFVYDSGSVFSPEVLDLTENDLIAKFAAGLSNVVGLSMLLSYPTLAAI  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM INGYKN L+ A+ TEYSFP A+KVKEYL+DPSKF
Sbjct  241  PHMFINGYKNVLSFAIATEYSFPQAEKVKEYLKDPSKF  278



>dbj|BAJ92405.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEI  PVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEITIPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTE+DL+ KFA GVSMV SLSLAISYPT+AAAPHM +N Y
Sbjct  189  GLVICNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTMAAAPHMFLNAY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+A+ET+YS+  ADK+KEYL+DPSKF
Sbjct  249  KNVLAVALETDYSYDHADKIKEYLKDPSKF  278



>gb|EMT17099.1| 60S acidic ribosomal protein P0 [Aegilops tauschii]
Length=320

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEI  PVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEITIPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTE+DL+ KFA GVSMV SLSLAISYPT+AAAPHM +N Y
Sbjct  189  GLVICNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTMAAAPHMFLNAY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+A+ET+YS+  ADK+KEYL+DPSKF
Sbjct  249  KNVLAVALETDYSYDHADKIKEYLKDPSKF  278



>dbj|BAJ94456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   259 bits (663),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEI  PVELIKKGDKVGSSE+ALLAKLGIRPFSY
Sbjct  129  GNTGLDPSQTSFFQVLNIPTKINKGTVEITIPVELIKKGDKVGSSESALLAKLGIRPFSY  188

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLV+ +VYD+G+VFSPEVLDLTE+DL+ KFA GVSMV SLSLAISYPT+AAAPHM +N Y
Sbjct  189  GLVICNVYDSGSVFSPEVLDLTEEDLMDKFASGVSMVASLSLAISYPTMAAAPHMFLNAY  248

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+A+ET+YS+  ADK+KEYL+DPSKF
Sbjct  249  KNVLAVALETDYSYDHADKIKEYLKDPSKF  278



>ref|XP_010685586.1| PREDICTED: 60S acidic ribosomal protein P0 [Beta vulgaris subsp. 
vulgaris]
Length=324

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVV+PPGNTGLDPSQTSFFQ LNIPTKINKGTVEIITPVE+IKKGDKVGSSEA LL+K
Sbjct  125  PIDVVIPPGNTGLDPSQTSFFQALNIPTKINKGTVEIITPVEIIKKGDKVGSSEAMLLSK  184

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I+PFSYGLVV  V+++G+V+ PE+LDLTEDDL  KFA GV+ VT+L+LAISYPT+AAA
Sbjct  185  LAIKPFSYGLVVQKVFEDGSVYDPEILDLTEDDLALKFAAGVANVTALALAISYPTIAAA  244

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKN LA++V T+Y+FP A+++KEYL+DPSKF
Sbjct  245  PHMFINAYKNVLAVSVATDYTFPEAEEIKEYLKDPSKF  282



>ref|XP_002983859.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
 gb|EFJ14871.1| hypothetical protein SELMODRAFT_268802 [Selaginella moellendorffii]
Length=322

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV +PPG+TGLDPSQTSFFQVLNIPTKINKGTVEI++ VELIKKG+KVGSSEAALLAK
Sbjct  121  PIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKGTVEIVSSVELIKKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYD+G+VF P VLDLTEDDL+G+FA GVS V +LSLAI YPTLAAA
Sbjct  181  LGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDDLVGRFAAGVSAVAALSLAIGYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
             H  +N YKN LA+A+ T+YS+P A+ VKEYL+DPSKF
Sbjct  241  THCFLNSYKNVLAVALATDYSYPHAETVKEYLKDPSKF  278



>ref|XP_002974292.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
 ref|XP_002985667.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ13245.1| hypothetical protein SELMODRAFT_181962 [Selaginella moellendorffii]
 gb|EFJ24514.1| hypothetical protein SELMODRAFT_149765 [Selaginella moellendorffii]
Length=318

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV +PPG+TGLDPSQTSFFQVLNIPTKINKGTVEI++ VELIKKG+KVGSSEAALLAK
Sbjct  121  PIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKGTVEIVSSVELIKKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYD+G+VF P VLDLTEDDL+G+FA GVS V +LSLAI YPTLAAA
Sbjct  181  LGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDDLVGRFAAGVSAVAALSLAIGYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
             H  +N YKN LA+A+ T+YS+P A+ VKEYL+DPSKF
Sbjct  241  SHYFLNSYKNVLAVALATDYSYPQAETVKEYLKDPSKF  278



>ref|XP_004241171.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum lycopersicum]
Length=318

 Score =   256 bits (653),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVE+IKKG+KVGSSE+ALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVEIIKKGEKVGSSESALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I+PFSYGL+V SVYDNG+VFSPEVL+LT++DL+ +FA G++ V  LS+ ++YPTLAA 
Sbjct  181  LLIKPFSYGLIVQSVYDNGSVFSPEVLELTDNDLVARFAAGLTNVVGLSMTLNYPTLAAI  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH+ IN YKN L+ A+ TEYSFP A+KVKEYL+DPSKF
Sbjct  241  PHIFINSYKNVLSFAIATEYSFPQAEKVKEYLKDPSKF  278



>ref|XP_002960810.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
 gb|EFJ38349.1| hypothetical protein SELMODRAFT_437282 [Selaginella moellendorffii]
Length=321

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV +PPG+TGLDPSQTSFFQVLNIPTKINKGTVEI++ VELIKKG+KVGSSEAALLAK
Sbjct  121  PIDVTIPPGSTGLDPSQTSFFQVLNIPTKINKGTVEIVSSVELIKKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV  VYD+G+VF P VLDLTEDDL+G+FA GVS V +LSLAI YPTLAAA
Sbjct  181  LGIRPFSYGLVVQMVYDDGSVFDPAVLDLTEDDLVGRFATGVSAVAALSLAIGYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
             H  +N YKN LA+A+ T+YS+P A+  KEYL+DPSKF
Sbjct  241  THYFLNSYKNVLAVALATDYSYPHAETAKEYLKDPSKF  278



>ref|XP_001759592.1| predicted protein [Physcomitrella patens]
 gb|EDQ75504.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEII PVEL+ KGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIAPVELVHKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV+++YDNG+VF+PEVLDLTEDDL+ KFA GVS V ++SLA++YPTLAA 
Sbjct  181  LGIRPFSYGLVVVNIYDNGSVFAPEVLDLTEDDLLDKFAAGVSTVAAVSLALNYPTLAAV  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH  +N YKN LAIAVETEYSFPLA+K KEYL+DPSKF
Sbjct  241  PHSFVNSYKNLLAIAVETEYSFPLAEKTKEYLKDPSKF  278



>sp|P50345.1|RLA0_LUPLU RecName: Full=60S acidic ribosomal protein P0 [Lupinus luteus]
 emb|CAA63786.1| P0 ribosomal protein [Lupinus luteus]
Length=322

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVVLSVYDNG+VF PEVLDLTEDDL+ KFA+GVS       +   P  +AA
Sbjct  181  LGIRPFSYGLVVLSVYDNGSVFKPEVLDLTEDDLLEKFAIGVSQCYFSDTSHFIPNPSAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDP  309
            PH+ IN YKN LA+AV TEYSFP AD+VKEYL+DP
Sbjct  241  PHVFINAYKNVLAVAVATEYSFPQADEVKEYLKDP  275



>ref|XP_004296403.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -2

Query  749  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLGIRPFSY  570
            GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALL+KL IRPFSY
Sbjct  128  GNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLSKLAIRPFSY  187

Query  569  GLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPHMLINGY  390
            GLVV  VYDNG+VFSPEVLDLTE+DL  KFA   S V +L+LAISYPT+ AAPHM +N Y
Sbjct  188  GLVVQMVYDNGSVFSPEVLDLTEEDLAVKFASSASNVAALALAISYPTVVAAPHMFLNAY  247

Query  389  KNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            KN LA+AV TE+SFP ADKVKEYL+DPSKF
Sbjct  248  KNVLAVAVATEFSFPQADKVKEYLKDPSKF  277



>ref|XP_001759851.1| predicted protein [Physcomitrella patens]
 gb|EDQ75355.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV+VPPGNTGLDPSQTSFFQVLNIPTKINKGTVEII PVEL+ KGDKVGSSEAALLAK
Sbjct  121  PIDVIVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIAPVELVHKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGLVV+++YDNG++F+PEVLDLTEDDL+ KFA GVS V ++SLA++YPTLAA 
Sbjct  181  LGIRPFSYGLVVVNIYDNGSLFAPEVLDLTEDDLLDKFAAGVSTVAAVSLALNYPTLAAV  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH  +N YKN LAIAVETEYSFPLA+K KEYL+DPSKF
Sbjct  241  PHSFVNAYKNLLAIAVETEYSFPLAEKTKEYLKDPSKF  278



>ref|XP_006350830.1| PREDICTED: 60S acidic ribosomal protein P0-like [Solanum tuberosum]
Length=318

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 140/156 (90%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVE+IKKG+KVGSSE+ALL+K
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVEIIKKGEKVGSSESALLSK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I+PFSYGL+V SVYDNG+VFSPEVL+LT++DL+ +FA G++ V  LS+ + YPTLAA 
Sbjct  181  LLIKPFSYGLIVQSVYDNGSVFSPEVLELTDNDLVARFAAGLTNVVGLSMILDYPTLAAI  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PHM IN YKN L+ A+ TEYSFP A+KVKEYL++PS
Sbjct  241  PHMFINSYKNVLSFAIATEYSFPQAEKVKEYLKNPS  276



>ref|XP_002279500.1| PREDICTED: 60S acidic ribosomal protein P0-2-like [Vitis vinifera]
Length=286

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVV+ PG+TGLDP+ TSFFQVLNIPTKINKG VEI+ PV+L+KKGDKVGSSEAALLAK
Sbjct  86   PIDVVIQPGSTGLDPALTSFFQVLNIPTKINKGAVEIVVPVQLVKKGDKVGSSEAALLAK  145

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LG + FSYGLVVLSV DNG+VFSP+VLDLT+DDL  KF+ GVSM  SLSLAISYPTLAAA
Sbjct  146  LGKKSFSYGLVVLSVSDNGSVFSPKVLDLTDDDLAEKFSAGVSMKASLSLAISYPTLAAA  205

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
             HM IN   N L +AV  EYSFP A +VKEYL+DPSKF
Sbjct  206  LHMFINACNNVLTVAVVAEYSFPQAQQVKEYLKDPSKF  243



>emb|CBI15980.3| unnamed protein product [Vitis vinifera]
Length=245

 Score =   242 bits (618),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVV+ PG+TGLDP+ TSFFQVLNIPTKINKG VEI+ PV+L+KKGDKVGSSEAALLAK
Sbjct  45   PIDVVIQPGSTGLDPALTSFFQVLNIPTKINKGAVEIVVPVQLVKKGDKVGSSEAALLAK  104

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LG + FSYGLVVLSV DNG+VFSP+VLDLT+DDL  KF+ GVSM  SLSLAISYPTLAAA
Sbjct  105  LGKKSFSYGLVVLSVSDNGSVFSPKVLDLTDDDLAEKFSAGVSMKASLSLAISYPTLAAA  164

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
             HM IN   N L +AV  EYSFP A +VKEYL+DPSKF
Sbjct  165  LHMFINACNNVLTVAVVAEYSFPQAQQVKEYLKDPSKF  202



>emb|CAN65663.1| hypothetical protein VITISV_014917 [Vitis vinifera]
Length=379

 Score =   244 bits (624),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVV+ PG+TGLDP+ TSFFQVLNIPTKINKG VEI+ PV+L+KKGDKVGSSEAALLAK
Sbjct  121  PIDVVIQPGSTGLDPAXTSFFQVLNIPTKINKGAVEIVVPVQLVKKGDKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LG + FSYGLVVLSV DNG+VFSP+VLDLT+DDL  KF+ GVSM  SLSLAISYPTLAAA
Sbjct  181  LGKKXFSYGLVVLSVXDNGSVFSPKVLDLTDDDLAEKFSAGVSMKASLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
             HM IN   N L +AV  EYSFP A +VKEYL+DPSKF
Sbjct  241  LHMFINACNNVLTVAVVAEYSFPQAQQVKEYLKDPSKF  278



>ref|XP_002960261.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
 gb|EFJ37800.1| hypothetical protein SELMODRAFT_229877 [Selaginella moellendorffii]
Length=323

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV + PG+TGLDPS TSFFQ LNIPTKINKGTVEI++ VELI KG KVGSSEAALLAK
Sbjct  121  PIDVTIQPGSTGLDPSHTSFFQALNIPTKINKGTVEIVSSVELISKGTKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L IRPFSYGLVV  VYD+G+VF P VLDLT+DDL+ KFA GVS V ++SLA+ YPTLAAA
Sbjct  181  LRIRPFSYGLVVRRVYDSGSVFDPAVLDLTDDDLVAKFAEGVSAVAAISLALGYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
             H  +N YKN LAIA+ T+YS+P A+  KEYL+DPSKF
Sbjct  241  AHFFLNSYKNVLAIALSTDYSYPQAENAKEYLKDPSKF  278



>ref|XP_002967451.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
 gb|EFJ32050.1| hypothetical protein SELMODRAFT_87354 [Selaginella moellendorffii]
Length=323

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV + PG+TGLDPS TSFFQ LNIPTKINKGTVEI++ VELI KG KVGSSEAALLAK
Sbjct  121  PIDVTIQPGSTGLDPSHTSFFQALNIPTKINKGTVEIVSSVELISKGTKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L IRPFSYGLVV  VYD+G+VF P VLDLT+DDL+ KFA GVS V ++SLA+ YPTLAAA
Sbjct  181  LRIRPFSYGLVVRRVYDSGSVFDPAVLDLTDDDLVAKFAEGVSAVAAISLALGYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
             H  +N YKN LAIA+ T+YS+P A+  KEYL+DPSKF
Sbjct  241  AHFFLNSYKNVLAIALSTDYSYPQAENAKEYLKDPSKF  278



>gb|ADU04571.1| 60S acidic ribosomal protein PO [Phaseolus vulgaris]
 gb|AGV54610.1| 60S acidic ribosomal protein P0 [Phaseolus vulgaris]
Length=320

 Score =   238 bits (606),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELI+KG+KVGSSE   LA 
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIRKGEKVGSSELHCLAS  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L  RP   GL  L       VFSPE  DLTEDDL+ KFA GVSMVT LSLAISYPTLAAA
Sbjct  181  LAFRPSHMGLGALLFIKMAPVFSPEGPDLTEDDLLEKFAAGVSMVTFLSLAISYPTLAAA  240

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM +N YKN L++A+ T+YSFP ADKVKEYL+DPSKF
Sbjct  241  PHMFVNAYKNLLSVAIATDYSFPEADKVKEYLKDPSKF  278



>ref|XP_005850392.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
 gb|EFN58290.1| hypothetical protein CHLNCDRAFT_59607 [Chlorella variabilis]
Length=314

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV +P GNTG+DPSQTSFFQVLNIPTKINKG+VEI   V LIK GDKVG+SEA LLAK
Sbjct  120  PNDVTIPGGNTGMDPSQTSFFQVLNIPTKINKGSVEITADVHLIKTGDKVGASEATLLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGI+PFSYGLV+L VYDNG+++ P+VLD+T+DDL      G+  V +  L +SYPT+A+ 
Sbjct  180  LGIKPFSYGLVILQVYDNGSLYDPKVLDITDDDLGNLITAGLRNVAAACLELSYPTIASV  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH LINGYKN LAIAVET+YSFPLA+KVK +L DPS F
Sbjct  240  PHSLINGYKNVLAIAVETDYSFPLAEKVKAFLADPSAF  277



>ref|XP_006407705.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
 gb|ESQ49158.1| hypothetical protein EUTSA_v10021147mg [Eutrema salsugineum]
Length=298

 Score =   226 bits (576),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 127/158 (80%), Gaps = 24/158 (15%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVV PGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIK+GDK           
Sbjct  120  PIDVVVQPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKQGDK-----------  168

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
                         SVYDNG+VFSPEVL+LTEDDL+ KFA G+SMVTSL+LA+SYPT+AAA
Sbjct  169  -------------SVYDNGSVFSPEVLNLTEDDLVEKFAAGISMVTSLALAVSYPTIAAA  215

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHM IN YKNALAI+V TEY+FP A+KVKE+L+DPSKF
Sbjct  216  PHMFINAYKNALAISVATEYTFPQAEKVKEFLKDPSKF  253



>sp|P29764.1|RLA0_OXYRB RecName: Full=60S acidic ribosomal protein P0; AltName: Full=Light-induced 
34 kDa protein [Oxybasis rubra]
 emb|CAA33276.1| 34kD light-induced protein [Oxybasis rubra]
Length=321

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIIT VELIKKG+KVGSSEAALLAK
Sbjct  121  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITAVELIKKGEKVGSSEAALLAK  180

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGIRPFSYGL V SVYD+G+VFSPEVLDLTEDDL+ +FA GVSMVTSLSLAISYPTLAAA
Sbjct  181  LGIRPFSYGLNVESVYDDGSVFSPEVLDLTEDDLLARFATGVSMVTSLSLAISYPTLAAA  240

Query  413  PH  408
            PH
Sbjct  241  PH  242



>gb|KDD72928.1| hypothetical protein H632_c2720p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=273

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV +  GNTG+DPSQTSFFQ LN+PTKINKGTVEI++ + LI  GDKVG+S+A LLAK
Sbjct  116  PTDVTIYAGNTGMDPSQTSFFQALNVPTKINKGTVEIVSDMHLITAGDKVGASQATLLAK  175

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGI+PF+YGLV+ +VYDNG +++P+VLD+TEDDL+   + G++ V + SL +++PTLA+A
Sbjct  176  LGIKPFTYGLVLRNVYDNGALYNPKVLDITEDDLVAAMSRGIANVAAASLQLNFPTLASA  235

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +++G+KN L++AV T+YSFPLADKVK YL DPS F
Sbjct  236  PHSIVHGFKNVLSVAVATDYSFPLADKVKAYLADPSAF  273



>ref|XP_005987234.1| PREDICTED: 60S acidic ribosomal protein P0 [Latimeria chalumnae]
Length=314

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSNVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL+++ VYDNG+V+SPEVLD+TED L  +F  GV  + S+ L I YPT+A+ 
Sbjct  178  LNISPFSYGLIIMQVYDNGSVYSPEVLDITEDTLHKRFLEGVRNIASVCLQIGYPTVASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+ VET+YSFPLADKVK +L DPS F
Sbjct  238  PHSVINGYKRVLAVCVETDYSFPLADKVKAFLADPSSF  275



>ref|XP_001697060.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
 gb|EDP00752.1| acidic ribosomal protein P0 [Chlamydomonas reinhardtii]
Length=320

 Score =   208 bits (530),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DVV+  G TG+DPSQTSFFQ L I TKINKGT+EI++ V ++K G++VG S+A LLAK
Sbjct  126  PEDVVIKAGGTGMDPSQTSFFQALGIATKINKGTIEIVSDVVVVKAGERVGPSQATLLAK  185

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LG++PF YGL++L V ++G V+ P+V+D+T++D++     G+  V +LSL   YPTLAAA
Sbjct  186  LGVKPFKYGLLILKVIESGAVYDPKVMDITDEDMMASVIAGIREVAALSLGAQYPTLAAA  245

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH++I+GYKN LAIAVET+Y+FPLA KVK+YL DPSKF
Sbjct  246  PHVIIDGYKNVLAIAVETDYTFPLAQKVKDYLADPSKF  283



>ref|XP_006640161.1| PREDICTED: 60S acidic ribosomal protein P0-like [Lepisosteus 
oculatus]
Length=316

 Score =   208 bits (530),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  VYDNG+V+SPEVLD+TED L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLIIQQVYDNGSVYSPEVLDITEDALQQRFLEGVRNVASVCLQIGYPTVASI  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+YSFPLADKVKE+L DPS
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPLADKVKEFLADPS  273



>sp|Q9DG68.1|RLA0_RANSY RecName: Full=60S acidic ribosomal protein P0; AltName: Full=60S 
ribosomal protein L10E [Rana sylvatica]
 gb|AAG09233.1| brain acidic ribosomal phosphoprotein P0 [Rana sylvatica]
Length=315

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  VYDNG+++SPEVLD+TED L  +F  GV  + S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLIIQQVYDNGSIYSPEVLDITEDALRARFLEGVRNIASVCLQIGYPTVASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NGYK  LA+AVET+YSFPLADKVK +L DPS F
Sbjct  238  PHSVVNGYKRVLALAVETDYSFPLADKVKAFLADPSAF  275



>ref|XP_005650079.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25535.1| hypothetical protein COCSUDRAFT_52908 [Coccomyxa subellipsoidea 
C-169]
Length=319

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 125/158 (79%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P  VVVP GNTGLDPSQTSFFQ LNIPTKIN+GTVEI++ V LIK  +KVG SEA LL+K
Sbjct  122  PNSVVVPAGNTGLDPSQTSFFQALNIPTKINRGTVEIVSDVHLIKASEKVGGSEATLLSK  181

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGI+PFSYGLV+L V+++G ++ P+VLD+ ++DL+      ++ + + SL + YPTLA+ 
Sbjct  182  LGIKPFSYGLVLLKVFEDGAMYDPKVLDIKDEDLMDSVMTAITRIAAASLELGYPTLASI  241

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYKN LAI+V T+Y FPLA+KVK +L DPS F
Sbjct  242  PHSVINGYKNVLAISVATDYDFPLAEKVKAFLADPSAF  279



>ref|XP_010740439.1| PREDICTED: 60S acidic ribosomal protein P0 isoform X2 [Larimichthys 
crocea]
Length=275

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI+KGT+EI++ V LIK GDKVG+SEA LL  
Sbjct  79   PCDVTVPSQNTGLGPEKTSFFQALGITTKISKGTIEILSDVSLIKTGDKVGASEATLLNM  138

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+V+SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  139  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNIASVCLEIGYPTLASV  198

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+YSFPLADKVK +L DPS
Sbjct  199  PHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  234



>ref|NP_001187030.1| 60S acidic ribosomal protein P0 [Ictalurus punctatus]
 sp|Q90YX1.1|RLA0_ICTPU RecName: Full=60S acidic ribosomal protein P0; AltName: Full=60S 
ribosomal protein L10E [Ictalurus punctatus]
 gb|AAK95123.1|AF401551_1 ribosomal protein P0 [Ictalurus punctatus]
Length=317

 Score =   206 bits (525),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P +V VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LI+ GDKVG+SEA LL  
Sbjct  118  PCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIRPGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+V+SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASI  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  L +AVET+YSFP+ADKVK +L DPS+F
Sbjct  238  PHSIINGYKRVLRVAVETDYSFPMADKVKAFLADPSRF  275



>ref|XP_010740438.1| PREDICTED: 60S acidic ribosomal protein P0 isoform X1 [Larimichthys 
crocea]
Length=314

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI+KGT+EI++ V LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPSQNTGLGPEKTSFFQALGITTKISKGTIEILSDVSLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+V+SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNIASVCLEIGYPTLASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+YSFPLADKVK +L DPS
Sbjct  238  PHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>gb|EKC26031.1| 60S acidic ribosomal protein P0 [Crassostrea gigas]
Length=314

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P+DV VP   T L P +TSFFQ L IPTKI +G +EI+  V LIK G+KVGSSE+ LL  
Sbjct  118  PLDVHVPAQATTLGPEKTSFFQALQIPTKITRGCIEILNEVHLIKAGEKVGSSESTLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LG+ PFSYGL V  VYD+GT+F PE+LD+T+DDL  KF MGV  + ++SL I YPT A+A
Sbjct  178  LGVSPFSYGLAVEKVYDSGTIFEPEILDITDDDLKAKFLMGVRNIAAISLTIGYPTAASA  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH + NG+K  LAIAVET+Y+FP A+K KEYL+DPSKF
Sbjct  238  PHSIANGFKRLLAIAVETDYTFPAAEKTKEYLKDPSKF  275



>gb|AHB33743.1| 60S acidic ribosomal protein P0 [Cyprinus carpio]
Length=316

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P +V VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKPGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+V+SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASI  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+YSFPLA+KVK YL DP+
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPLAEKVKAYLADPT  273



>gb|ACH70801.1| acidic ribosomal protein P0 [Salmo salar]
 gb|ACI69835.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN10322.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN12682.1| 60S acidic ribosomal protein P0 [Salmo salar]
Length=315

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 120/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVMLIKPGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  VYDNG+V+SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLLIQQVYDNGSVYSPEVLDITEDALHARFLEGVRNIASVCLEIGYPTLASI  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDP  309
            PH +INGYK  LA+AVET+YSFPLADKVK+YL DP
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKDYLADP  272



>gb|ABZ04250.1| ribosomal protein rplp0 [Lineus viridis]
Length=315

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P+DV VP  NTGL P +TSFFQ LNI TKI KGTVEI+  V+L+  G++VG+SEAALL  
Sbjct  120  PLDVTVPRQNTGLGPEKTSFFQALNIQTKITKGTVEIMNDVKLVTAGERVGASEAALLNM  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL+V  VYD+GTVF+P VLD+T+DDL  KF  GV+ V ++SLAI YPT A+A
Sbjct  180  LKISPFSYGLIVEQVYDSGTVFNPAVLDITDDDLRAKFLEGVANVAAVSLAIGYPTAASA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NG+KN LAI+VET+Y+F  A   KEYL DPSKF
Sbjct  240  PHSIVNGFKNLLAISVETDYTFQEAAMTKEYLADPSKF  277



>gb|KFM29126.1| 60S acidic ribosomal protein P0-2 [Auxenochlorella protothecoides]
Length=273

 Score =   202 bits (515),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 121/147 (82%), Gaps = 0/147 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV V  GNTG+DPSQTSFFQ LNI TKINKGTVEI++ V LIK G+KVG+S+A LLAK
Sbjct  120  PNDVTVYAGNTGMDPSQTSFFQALNISTKINKGTVEIVSDVHLIKPGEKVGASQATLLAK  179

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            LGI+PF+YGLVV  VYDNG+++ P+VLD+T++ L      G+  V + SLA+ +PT+A+A
Sbjct  180  LGIKPFTYGLVVKQVYDNGSLYDPKVLDITDETLGDLLTAGIRNVAAASLALDFPTMASA  239

Query  413  PHMLINGYKNALAIAVETEYSFPLADK  333
            PH LINGYKNALAIAVET+Y+FPLA+K
Sbjct  240  PHSLINGYKNALAIAVETDYTFPLAEK  266



>ref|XP_006784596.1| PREDICTED: 60S acidic ribosomal protein P0-like [Neolamprologus 
brichardi]
Length=315

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVGLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+V+SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNIASVCLEIGYPTLASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+YSFPLADKVK +L DPS
Sbjct  238  PHTVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>emb|CDQ67134.1| unnamed protein product [Oncorhynchus mykiss]
Length=315

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVMLIKPGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  VYDNG+V+SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLLIQQVYDNGSVYSPEVLDITEDALHARFLEGVRNIASVCLEIGYPTLASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDP  309
            PH +INGYK  LA+AVET+YSFPLADKVK YL DP
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>gb|ACI68961.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACI70184.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN09916.1| 60S acidic ribosomal protein P0 [Salmo salar]
 gb|ACN12263.1| 60S acidic ribosomal protein P0 [Salmo salar]
Length=315

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVMLIKPGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  VYDNG+V+SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLLIQQVYDNGSVYSPEVLDITEDALHARFLEGVRNIASVCLEIGYPTLASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDP  309
            PH +INGYK  LA+AVET+YSFPLADKVK YL DP
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>ref|NP_989067.1| ribosomal protein, large, P0 [Xenopus (Silurana) tropicalis]
 gb|AAH61299.1| acidic ribosomal phosphoprotein P0 [Xenopus (Silurana) tropicalis]
Length=314

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P  VVVP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCGVVVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+++SPEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSIYSPEVLDITEEALHVRFLEGVRNVASVCLQIGYPTVASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LAIAVET+YSFPLADKVK +L DPS
Sbjct  238  PHSVINGYKRVLAIAVETDYSFPLADKVKAFLADPS  273



>ref|NP_001080134.1| ribosomal protein, large, P0 [Xenopus laevis]
 gb|AAH42268.1| Arbp-prov protein [Xenopus laevis]
Length=315

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P +V VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+++SPEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSIYSPEVLDITEEALHVRFLEGVRNVASVCLQIGYPTVASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LAIAVET+YSFPLADKVK +L DPS
Sbjct  238  PHSVINGYKRVLAIAVETDYSFPLADKVKAFLADPS  273



>gb|KFZ54738.1| 60S acidic ribosomal protein P0, partial [Podiceps cristatus]
Length=261

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  100  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLTM  159

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  160  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  219

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  220  PHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  257



>dbj|BAF98695.1| ribosomal protein LP0 [Solea senegalensis]
Length=315

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V LIK  DKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVSLIKTNDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+V+SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEDCLHARFLEGVRNIASVCLEIGYPTLASI  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+YSFP+ADKVK +L DPS
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPMADKVKAFLADPS  273



>ref|XP_008318611.1| PREDICTED: 60S acidic ribosomal protein P0 [Cynoglossus semilaevis]
Length=315

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVSLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+V+SPEVLD+TE+ L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLLIQQVYDNGSVYSPEVLDITEESLHVRFLEGVRNIASVCLEIGYPTLASL  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+YSFPLADKVK +L DPS
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>ref|XP_008639852.1| PREDICTED: 60S acidic ribosomal protein P0, partial [Corvus brachyrhynchos]
Length=280

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>gb|KFO65132.1| 60S acidic ribosomal protein P0, partial [Corvus brachyrhynchos]
Length=279

 Score =   202 bits (514),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>emb|CDQ63253.1| unnamed protein product [Oncorhynchus mykiss]
Length=315

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVMLIKPGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  VYDNG+V+SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLLIQQVYDNGSVYSPEVLDITEDALHARFLEGVRNIASVCLEIGYPTLASI  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDP  309
            PH +INGYK  LA+AVET+YSFPLADKVK YL DP
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>gb|KFQ10333.1| 60S acidic ribosomal protein P0, partial [Leptosomus discolor]
Length=279

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>gb|ABB29594.1| ribosomal protein P0 large subunit [Platynereis dumerilii]
Length=273

 Score =   202 bits (513),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 124/158 (78%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV +P  NTGL P +TSFFQ L IPTKI +GT+EI+  V+L++ GDKVG SEA LL  
Sbjct  82   PCDVSIPAQNTGLGPEKTSFFQALAIPTKIARGTIEILNEVKLLRTGDKVGMSEATLLNM  141

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L + PF+YGLV+L VYD+GTVFSP +LD+T+DDL  +F  GV+ ++ ++LAI YPT+A+ 
Sbjct  142  LNVSPFTYGLVILQVYDSGTVFSPAILDITDDDLRARFMQGVTNLSCVALAIGYPTVASV  201

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH++ING+KN LAIA ET+  F  A+++KE+L+DPSKF
Sbjct  202  PHLVINGFKNLLAIAAETDIEFKEAEQMKEFLKDPSKF  239



>gb|ABU63975.1| ribosomal protein large P0-like protein [Perca flavescens]
Length=314

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DVVVP  NTGL P +TSFFQ L I TKI++GT+EI++ V LIK GDKVG+SEA LL  
Sbjct  118  PCDVVVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVGLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL +  VYDNG+V+SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLNIQQVYDNGSVYSPEVLDITEACLHARFLEGVRNIASVCLEIGYPTLASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+YSFPLADKVK +L DPS
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>ref|XP_008501040.1| PREDICTED: 60S acidic ribosomal protein P0 [Calypte anna]
Length=318

 Score =   203 bits (516),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEAALL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEAALLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTVASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_002958097.1| hypothetical protein VOLCADRAFT_84328 [Volvox carteri f. nagariensis]
 gb|EFJ40828.1| hypothetical protein VOLCADRAFT_84328 [Volvox carteri f. nagariensis]
Length=321

 Score =   203 bits (517),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = -2

Query  767  DVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAKLG  588
            DVV+  G TG+DPSQTSFFQ L I TKINKGT+EI++ V ++K GD+VG+S+A LLAKLG
Sbjct  128  DVVIKAGGTGMDPSQTSFFQALGIATKINKGTIEIVSDVVVVKTGDRVGASQATLLAKLG  187

Query  587  IRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAAPH  408
            I+PF YGL +L V ++G V+ P+V+++T++D++      +  V++LSL   YPTL AAPH
Sbjct  188  IKPFKYGLQILKVIESGAVYDPKVMEITDEDILSSVMTAIREVSALSLGARYPTLVAAPH  247

Query  407  MLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            ++I+GYKN LAIA+ET+Y+FPLA KVK+YL DPSKF
Sbjct  248  VIIDGYKNVLAIALETDYTFPLAQKVKDYLADPSKF  283



>ref|XP_007434308.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X1 [Python 
bivittatus]
 ref|XP_007434309.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X2 [Python 
bivittatus]
 ref|XP_007434310.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X3 [Python 
bivittatus]
Length=315

 Score =   203 bits (516),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV+VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVIVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLIIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTVASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+YSFPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPLAEKVKAFLADPSAF  275



>ref|XP_010396743.1| PREDICTED: 60S acidic ribosomal protein P0 [Corvus cornix cornix]
Length=290

 Score =   202 bits (514),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_003226041.1| PREDICTED: 60S acidic ribosomal protein P0 [Anolis carolinensis]
Length=315

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  V+DNG++++PEVLD+TE+ L G+F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLIIQQVFDNGSIYNPEVLDITEETLRGRFLEGVRNVASVCLQIGYPTVASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+YSFPLA+KVK +L DPS
Sbjct  238  PHSIINGYKRVLAVAVETDYSFPLAEKVKAFLADPS  273



>gb|KFQ53080.1| 60S acidic ribosomal protein P0, partial [Nestor notabilis]
Length=270

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  100  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  159

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  160  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  219

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  220  PHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  257



>ref|XP_005107960.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X1 [Aplysia 
californica]
 ref|XP_005107961.1| PREDICTED: 60S acidic ribosomal protein P0-like isoform X2 [Aplysia 
californica]
Length=313

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P+DV VP   T L P +TSFFQ L+IPTKI KGT+EI+  V LIK+G+KVG SE+ LL  
Sbjct  118  PLDVKVPAQTTTLGPEKTSFFQALSIPTKITKGTIEILNEVSLIKEGEKVGQSESTLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PF+YGL++ +VYD+GT+FSP +LD+T DD+I KF  GV  + S+SLAI YPT A+A
Sbjct  178  LNISPFTYGLLIENVYDSGTIFSPAILDITNDDIISKFMSGVRNIASVSLAIGYPTAASA  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +ING+KN LAIAV TEY F  A++ KEYL+DPSKF
Sbjct  238  PHSIINGFKNLLAIAVSTEYDFAEAEQTKEYLKDPSKF  275



>gb|AAT44430.1| ribosomal protein large P0-like protein, partial [Sparus aurata]
Length=314

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P +V VP  NTGL P +TSFFQ L I TKI++GT+EI++ V LIK  DKVG+SEA LL  
Sbjct  118  PCNVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVSLIKTNDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+V+SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEASLHARFLEGVRNIASVCLEIGYPTLASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+YSFPLADKVK +L DPS F
Sbjct  238  PHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPSAF  275



>ref|XP_005421617.1| PREDICTED: 60S acidic ribosomal protein P0 [Geospiza fortis]
Length=312

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  113  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  172

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  173  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  232

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  233  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  270



>gb|ADF97607.1| large ribosomal protein P0 [Hypophthalmichthys molitrix]
Length=316

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P +V VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKPGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+V+SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASI  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+YSFPLA+KVK +L DP+
Sbjct  238  PHSVINGYKRVLAVAVETDYSFPLAEKVKAFLADPT  273



>gb|AAU84931.1| putative acidic p0 ribosomal protein [Aphis citricidus]
Length=314

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P  VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V ++K+GDKVG+SEA LL  
Sbjct  118  PCPVVIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKEGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL V  VYD+GT+F PE+LD+  +DL+  F +GVS VT+  LAISYPT+ +A
Sbjct  178  LNISPFSYGLAVQMVYDSGTIFEPEILDIKPEDLLKTFLIGVSQVTAACLAISYPTIVSA  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHMLING+KN +A+A ETE  F  A   KEYL+DPSKF
Sbjct  238  PHMLINGFKNLVAVAAETEIEFKEATTFKEYLKDPSKF  275



>ref|NP_571655.2| 60S acidic ribosomal protein P0 [Danio rerio]
 gb|AAH62854.1| Rplp0 protein [Danio rerio]
 gb|AAI46739.1| Rplp0 protein [Danio rerio]
Length=316

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P +V VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKPGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++  VYDNG+V+SPEVLD+TED L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSYGLIIQQVYDNGSVYSPEVLDITEDALHKRFLEGVRNIASVCLQIGYPTLASI  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+ VET+Y+FPLA+KVK YL DP+
Sbjct  238  PHTIINGYKRVLAVTVETDYTFPLAEKVKAYLADPT  273



>gb|ADV40160.1| 60S acidic ribosomal protein P0 [Latrodectus hesperus]
Length=298

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV++ P NTGL P +TSFFQ L IPTKI+KGT+EI+  + LIKK DKVG+SEA LL  
Sbjct  118  PCDVILQPQNTGLGPEKTSFFQALQIPTKISKGTIEILNEIHLIKKEDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L + PF+YGL +  VYD+GTVFSPE+LD+T +DL  KF  GV  V S+SL ISYPTLA+ 
Sbjct  178  LNVSPFTYGLKIRQVYDSGTVFSPEILDITSEDLRAKFMEGVLNVASVSLEISYPTLASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NG KN +AIAVET+ +F  A+  KEYL+DP+KF
Sbjct  238  PHSIVNGLKNLIAIAVETDITFEAAEMAKEYLKDPTKF  275



>ref|XP_010879645.1| PREDICTED: 60S acidic ribosomal protein P0 [Esox lucius]
Length=315

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 119/155 (77%), Gaps = 0/155 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKPGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  VYDNG+V+SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLLIQQVYDNGSVYSPEVLDITEAALHARFLEGVRNIASVCLEIGYPTLASI  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDP  309
            PH +INGYK  LA+AVET+YSFPLADKVK YL DP
Sbjct  238  PHTIINGYKRVLAVAVETDYSFPLADKVKAYLADP  272



>ref|XP_002199561.1| PREDICTED: 60S acidic ribosomal protein P0 [Taeniopygia guttata]
Length=318

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_005524479.1| PREDICTED: 60S acidic ribosomal protein P0 [Pseudopodoces humilis]
Length=318

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_005493516.1| PREDICTED: 60S acidic ribosomal protein P0 [Zonotrichia albicollis]
 ref|XP_009090551.1| PREDICTED: 60S acidic ribosomal protein P0 [Serinus canaria]
Length=318

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_008924020.1| PREDICTED: 60S acidic ribosomal protein P0 [Manacus vitellinus]
 gb|KFW82516.1| 60S acidic ribosomal protein P0 [Manacus vitellinus]
Length=318

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>gb|AAS49563.1| ribosomal protein Large P0 [Latimeria chalumnae]
Length=256

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  108  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSNVQLIKTGDKVGASEATLLNM  167

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL++L VYDNG+V+SPEVLD+TED L  +F  GV  + S+ L I YPT+A+ 
Sbjct  168  LNISPFSYGLIILQVYDNGSVYSPEVLDITEDTLHKRFLEGVRNIASVCLQIGYPTVASV  227

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVK  327
            PH +INGYK  LA+ VET+YSFPLADKVK
Sbjct  228  PHSVINGYKRVLAVCVETDYSFPLADKVK  256



>ref|XP_005054917.1| PREDICTED: 60S acidic ribosomal protein P0 [Ficedula albicollis]
Length=324

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASICLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>gb|ABF69531.1| acidic ribosomal protein P0 [Strongyloides ratti]
 emb|CEF70114.1| 60S acidic ribosomal protein P0 [Strongyloides ratti]
Length=313

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV +PP NTG+ P +TSFFQ L IPTKI++GT+EI+  V LI  GDKVG+SEAALL  
Sbjct  118  PCDVKLPPQNTGMGPEKTSFFQALQIPTKISRGTIEILNEVHLISTGDKVGASEAALLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL VL VYDNGT++SP VLD+T++DL  KF  GV+ + SLSL + YPT A+A
Sbjct  178  LNITPFSYGLEVLHVYDNGTIYSPSVLDMTDEDLREKFMEGVTRIASLSLGLGYPTRASA  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NG+KN L+IA  T+ +F  A+ +KEYL DPSKF
Sbjct  238  PHSIVNGFKNLLSIAAVTDVTFKQAETLKEYLADPSKF  275



>ref|XP_010572856.1| PREDICTED: 60S acidic ribosomal protein P0 [Haliaeetus leucocephalus]
Length=318

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_010080334.1| PREDICTED: 60S acidic ribosomal protein P0, partial [Pterocles 
gutturalis]
Length=255

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  100  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  159

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  160  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  219

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS
Sbjct  220  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPS  255



>gb|AAY66850.1| 60S acidic ribosomal protein P0 [Ixodes scapularis]
Length=319

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P+DV++P  NTGL P +TSFFQ L IPTKI+KGT+EI+  + LIKK D+VG+SEA LL  
Sbjct  118  PLDVMIPAQNTGLGPEKTSFFQALQIPTKISKGTIEILNEIHLIKKDDRVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL +L VYD+GTVFSPE+LD+T +DL   F  GV  V S+SLAI YPT+A+A
Sbjct  178  LNISPFSYGLKILQVYDSGTVFSPEILDITPEDLRSAFVEGVRNVASVSLAIGYPTVASA  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NG KN +A+A+ET+ +F  A+  KEYL+DPSKF
Sbjct  238  PHSIVNGLKNLIAVALETDITFKEAEMAKEYLKDPSKF  275



>ref|XP_008292997.1| PREDICTED: 60S acidic ribosomal protein P0 [Stegastes partitus]
Length=315

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVSLIKPGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  VYDNG+V+SPEVLD+TE  L  +F  GV  + S+ L I YPTLA+ 
Sbjct  178  LNISPFSFGLIIQQVYDNGSVYSPEVLDITEASLHTRFLEGVRNIASVCLEIGYPTLASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVET+YSFPLADKVK +L DPS
Sbjct  238  PHSVINGYKRVLAVAVETDYSFPLADKVKAFLADPS  273



>ref|XP_002399611.1| 60S acidic ribosomal protein P0, putative [Ixodes scapularis]
 gb|EEC09184.1| 60S acidic ribosomal protein P0, putative [Ixodes scapularis]
Length=319

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P+DV++P  NTGL P +TSFFQ L IPTKI+KGT+EI+  + LIKK D+VG+SEA LL  
Sbjct  118  PLDVMIPAQNTGLGPEKTSFFQALQIPTKISKGTIEILNEIHLIKKDDRVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL +L VYD+GTVFSPE+LD+T +DL   F  GV  V S+SLAI YPT+A+A
Sbjct  178  LNISPFSYGLKILQVYDSGTVFSPEILDITPEDLRSAFVEGVRNVASVSLAIGYPTVASA  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NG KN +A+A+ET+ +F  A+  KEYL+DPSKF
Sbjct  238  PHSIVNGLKNLIAVALETDITFKEAEMAKEYLKDPSKF  275



>ref|XP_010016668.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0 [Nestor notabilis]
Length=309

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  112  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  171

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  172  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  231

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  232  PHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  269



>ref|XP_003211127.2| PREDICTED: 60S acidic ribosomal protein P0, partial [Meleagris 
gallopavo]
Length=318

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  119  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  178

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  179  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  238

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  239  PHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  276



>ref|XP_009948467.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0 [Leptosomus discolor]
Length=318

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>ref|XP_004664195.1| PREDICTED: 60S acidic ribosomal protein P0 [Jaculus jaculus]
Length=317

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P +V VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCEVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  V+DNG++++PEVLD+TED L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLIIQQVFDNGSIYNPEVLDITEDTLHSRFLEGVRNVASVCLQIGYPTVASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH +INGYK  LA++VETEY+FPLA+KVK +L DPS F
Sbjct  238  PHSIINGYKRVLALSVETEYTFPLAEKVKAFLADPSAF  275



>dbj|BAH70543.1| ACYPI000079 [Acyrthosiphon pisum]
Length=314

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P  VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V ++K+GDKVG+SEA LL  
Sbjct  118  PCPVVIPAQNTGLGPGKTSFFQALSIPTKISKGTIEIINDVHILKEGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PF+YGL V  VYD+GT+F PE+LD+  +DL+  F +GVS VT+  LAISYPT+ +A
Sbjct  178  LNISPFNYGLAVQMVYDSGTIFEPEILDIKPEDLLKTFLIGVSQVTAACLAISYPTIVSA  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHMLING+KN +A+A ETE  F  A   KEYL+DPSKF
Sbjct  238  PHMLINGFKNLVAVAAETEIEFKEATTFKEYLKDPSKF  275



>ref|NP_001119687.1| ribosomal protein LP0 [Acyrthosiphon pisum]
 gb|ABD72685.1| putative acidic p0 ribosomal protein [Acyrthosiphon pisum]
 dbj|BAH70530.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70531.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70532.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70533.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70534.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70535.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70536.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70538.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70539.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70540.1| ACYPI000079 [Acyrthosiphon pisum]
 dbj|BAH70541.1| ACYPI000079 [Acyrthosiphon pisum]
Length=314

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P  VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V ++K+GDKVG+SEA LL  
Sbjct  118  PCPVVIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKEGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PF+YGL V  VYD+GT+F PE+LD+  +DL+  F +GVS VT+  LAISYPT+ +A
Sbjct  178  LNISPFNYGLAVQMVYDSGTIFEPEILDIKPEDLLKTFLIGVSQVTAACLAISYPTIVSA  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHMLING+KN +A+A ETE  F  A   KEYL+DPSKF
Sbjct  238  PHMLINGFKNLVAVAAETEIEFKEATTFKEYLKDPSKF  275



>ref|XP_005445335.1| PREDICTED: LOW QUALITY PROTEIN: 60S acidic ribosomal protein 
P0 [Falco cherrug]
Length=318

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GLV+  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLVIQQVFDNGSIYNPEVLDITEETLHKRFLEGVRNVASVCLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NGYK  LA+AVET+Y+FPLA+KVK +L DPS F
Sbjct  238  PHSIVNGYKRVLAVAVETDYTFPLAEKVKAFLADPSAF  275



>gb|ELT92567.1| hypothetical protein CAPTEDRAFT_167366, partial [Capitella teleta]
Length=320

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 121/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P+ V+V   NTGL P +TSFFQ L IPTKI KGT+EI+  V+LIK+G+KVG+SEA LL  
Sbjct  118  PLSVMVTARNTGLGPEKTSFFQALAIPTKITKGTIEILNDVQLIKEGEKVGASEATLLTM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGLV+  VYD+GTVF P +LD+++DD+ GKF  GVS V SL LAI YPTLA+ 
Sbjct  178  LKIMPFSYGLVIQQVYDSGTVFHPSILDMSDDDIRGKFMSGVSRVASLCLAIGYPTLASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PH ++NG+KN LA+A  T+  F  A+ VKE+L+DPSKF
Sbjct  238  PHSVVNGFKNLLAVAAATDVEFKEAETVKEFLKDPSKF  275



>gb|ABM55512.1| putative ribosomal protein P0 [Maconellicoccus hirsutus]
Length=317

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P  VV+P  NTGL P +TSFFQ L+IPTKI+KGT+EII  V ++K+GDKVG+SEA LL  
Sbjct  118  PCPVVIPAQNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHILKEGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFSYGL V  VYD+GT+F P +LD+  +DL+ KF+ GV+ V +L LAISYP++A+ 
Sbjct  178  LNISPFSYGLGVQMVYDSGTIFEPRILDIKPEDLLAKFSEGVANVAALCLAISYPSVASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPSKF  300
            PHMLING KN LAIA ETE  F  A+ +KEYL+DPSKF
Sbjct  238  PHMLINGLKNLLAIAAETEIEFKEAETMKEYLKDPSKF  275



>gb|KFH71275.1| large subunit ribosomal protein LP0 [Mortierella verticillata 
NRRL 6337]
Length=308

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            PIDV +P GNTG++P +TSFFQ L +PTKI +GT+EII  V LIK G +VG+SEAALL  
Sbjct  115  PIDVFIPAGNTGMEPGKTSFFQALGVPTKIARGTIEIINDVHLIKVGFRVGASEAALLNM  174

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PF+YGL V+ VYDNGTVF P VLD+ ED L+ +F  G+  + ++SL I YPT+A+ 
Sbjct  175  LNISPFTYGLTVVQVYDNGTVFHPSVLDIEEDSLVAQFVAGIKNIAAISLQIGYPTVASV  234

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +IN YKN LA+++ TEY+FP A+K+K YL DPS
Sbjct  235  PHSIINSYKNLLAVSIATEYTFPGAEKIKAYLADPS  270



>ref|XP_005288756.1| PREDICTED: 60S acidic ribosomal protein P0 [Chrysemys picta bellii]
Length=314

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = -2

Query  773  PIDVVVPPGNTGLDPSQTSFFQVLNIPTKINKGTVEIITPVELIKKGDKVGSSEAALLAK  594
            P DV VP  NTGL P +TSFFQ L I TKI++GT+EI++ V+LIK GDKVG+SEA LL  
Sbjct  118  PCDVTVPAQNTGLGPEKTSFFQALGITTKISRGTIEILSDVQLIKTGDKVGASEATLLNM  177

Query  593  LGIRPFSYGLVVLSVYDNGTVFSPEVLDLTEDDLIGKFAMGVSMVTSLSLAISYPTLAAA  414
            L I PFS+GL++  V+DNG++++PEVLD+TE+ L  +F  GV  V S+ L I YPT+A+ 
Sbjct  178  LNISPFSFGLIIQQVFDNGSIYNPEVLDITEETLHRRFLEGVRNVASVCLQIGYPTIASV  237

Query  413  PHMLINGYKNALAIAVETEYSFPLADKVKEYLEDPS  306
            PH +INGYK  LA+AVETEY+FPLA+KVK +L DPS
Sbjct  238  PHSIINGYKRVLAVAVETEYTFPLAEKVKAFLADPS  273



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1376900468608