BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10263_g2_i1 len=244 path=[222:0-243]

Length=244
                                                                      Score     E

gb|KHG29841.1|  putative aquaporin PIP2-2                             81.6    9e-17   
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                 81.3    1e-16   
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg           81.3    1e-16   
tpg|DAA33865.1|  TPA: aquaporin PIP2;10                               81.3    1e-16   
ref|NP_001105639.1|  aquaporin PIP2-7                                 80.9    2e-16   Zea mays [maize]
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1             80.9    2e-16   
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg           80.5    2e-16   
ref|NP_001237286.1|  PIP2,2                                           80.5    2e-16   
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...  80.5    2e-16   
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2              80.1    3e-16   
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                      80.1    3e-16   
emb|CAB45651.1|  putative plasma membrane intrinsic protein           80.1    3e-16   Pisum sativum [garden pea]
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg              80.1    4e-16   
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                 80.1    4e-16   
gb|ACU19125.1|  unknown                                               80.1    4e-16   Glycine max [soybeans]
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                        80.1    4e-16   
gb|KHG08488.1|  putative aquaporin PIP2-2                             80.1    4e-16   
emb|CAC82712.1|  major intrinsic protein 1                            79.7    5e-16   Populus tremula x Populus tremuloides
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                 79.7    5e-16   
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2              79.3    5e-16   Populus trichocarpa x Populus deltoides
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g           79.3    7e-16   
gb|ABK60196.1|  PIP2 protein                                          79.3    7e-16   Gossypium hirsutum [American cotton]
ref|XP_002322877.1|  major intrinsic protein 1                        79.0    9e-16   Populus trichocarpa [western balsam poplar]
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg              79.0    1e-15   
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                      78.6    1e-15   
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg              78.6    1e-15   
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                 78.2    1e-15   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                 78.2    1e-15   
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg           78.2    1e-15   
ref|XP_006428787.1|  hypothetical protein CICLE_v10012633mg           77.8    2e-15   
gb|AJF34896.1|  plasma membrane intrinsic protein 2-2                 75.9    2e-15   
gb|KDP44053.1|  hypothetical protein JCGZ_05520                       77.8    2e-15   
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                       77.8    2e-15   Ricinus communis
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2-like                 77.8    2e-15   
gb|KCW51391.1|  hypothetical protein EUGRSUZ_J00930                   77.0    3e-15   
gb|ACU21481.1|  unknown                                               77.8    3e-15   Glycine max [soybeans]
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2             77.4    3e-15   
ref|NP_001105616.1|  aquaporin PIP2-5                                 77.4    3e-15   Zea mays [maize]
gb|KHG00060.1|  putative aquaporin PIP2-2                             77.4    3e-15   
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                 77.4    3e-15   
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                 77.4    3e-15   
gb|ACR56613.1|  plasma intrinsic protein 2;3                          77.4    3e-15   Juglans regia
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                        77.4    3e-15   
emb|CAH60724.1|  putative plasma membrane intrinsic protein           77.4    3e-15   Populus tremula x Populus tremuloides
gb|AFH36337.1|  aquaporin PIP2;2                                      77.0    4e-15   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1      77.0    4e-15   
gb|AAL32127.1|  aquaporin                                             77.0    5e-15   Medicago truncatula
ref|NP_001047491.1|  Os02g0629200                                     76.6    5e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EAY86778.1|  hypothetical protein OsI_08158                        76.6    5e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_003606384.1|  Aquaporin PIP2-7                                 76.3    6e-15   
gb|KDP44363.1|  hypothetical protein JCGZ_20043                       76.6    6e-15   
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4            76.6    6e-15   
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                        76.6    6e-15   
gb|AAO39007.1|  plasma intrinsic protein 2,1                          76.6    6e-15   Juglans regia
ref|XP_003606383.1|  Aquaporin PIP2-7                                 76.3    7e-15   
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                 76.3    8e-15   
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g           76.3    8e-15   
gb|AAB18227.1|  MipC                                                  76.3    8e-15   Mesembryanthemum crystallinum
gb|ABK60195.2|  PIP2 protein                                          76.3    9e-15   Gossypium hirsutum [American cotton]
gb|KHN05685.1|  Aquaporin PIP2-7                                      75.9    9e-15   
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                      75.9    1e-14   
ref|NP_001240223.1|  prolactin-inducible protein                      75.9    1e-14   
gb|KHN38765.1|  Aquaporin PIP2-7                                      75.9    1e-14   
gb|AFK47400.1|  unknown                                               75.9    1e-14   
gb|ADK25057.1|  plasma membrane intrinsic protein                     75.9    1e-14   
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g           75.9    1e-14   
ref|NP_001275065.1|  major intrinsic protein 2                        75.9    1e-14   
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1              75.9    1e-14   Populus trichocarpa x Populus deltoides
ref|XP_006648854.1|  PREDICTED: probable aquaporin PIP2-2-like        75.9    1e-14   
gb|AEC45513.1|  plasma membrane intrinsic protein                     75.9    1e-14   
gb|ABB13430.2|  plasma membrane intrinsic protein                     75.9    1e-14   Olea europaea
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                               75.9    1e-14   
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                 75.5    1e-14   
ref|XP_010920406.1|  PREDICTED: aquaporin PIP2-4 isoform X2           75.5    1e-14   
ref|NP_001289846.1|  probable aquaporin PIP2-1                        75.5    1e-14   
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                       75.5    1e-14   
gb|AFK35635.1|  unknown                                               74.3    1e-14   
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g           75.5    1e-14   
gb|ABU94630.1|  putative aquaporin PIP2;2                             75.5    1e-14   Phaseolus vulgaris [French bean]
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7             75.5    2e-14   
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                75.5    2e-14   Mimosa pudica [sensitive-plant]
gb|KDP29110.1|  hypothetical protein JCGZ_16499                       75.1    2e-14   
gb|AAO39008.1|  plasma intrinsic protein 2,2                          75.1    2e-14   Juglans regia
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1           75.1    2e-14   
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                 75.1    2e-14   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8             75.1    2e-14   
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                 75.1    2e-14   
gb|AHG32324.1|  PIP2-3                                                75.1    2e-14   
gb|ABU94631.1|  putative aquaporin PIP2;3                             75.1    2e-14   Phaseolus vulgaris [French bean]
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                 75.1    2e-14   
gb|AFQ23186.1|  aquaporin PIP2;1                                      75.1    2e-14   
gb|AAC17529.1|  aquaporin 2                                           75.1    2e-14   Samanea saman [cow-tamarind]
gb|EAZ23886.1|  hypothetical protein OsJ_07605                        75.1    2e-14   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                75.1    2e-14   Pyrus communis
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8             75.1    2e-14   
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2             75.1    2e-14   
gb|AIA83106.1|  putative aquaporin PIP2                               75.1    2e-14   
ref|NP_001235204.1|  Pip1 protein                                     75.1    2e-14   
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1      75.1    2e-14   
gb|ACU23034.1|  unknown                                               73.9    2e-14   Glycine max [soybeans]
gb|AAF61464.1|AF139815_1  plasma membrane intrinsic protein 2         74.7    2e-14   Triticum aestivum [Canadian hard winter wheat]
gb|KEH39328.1|  major intrinsic protein (MIP) family transporter      74.7    3e-14   
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                74.7    3e-14   
gb|AEC45512.1|  plasma membrane intrinsic protein                     74.7    3e-14   
ref|XP_010098191.1|  Aquaporin PIP2-7                                 74.7    3e-14   
gb|ABO69705.2|  aquaporin PIP2                                        74.7    3e-14   Prunus humilis
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                      74.7    3e-14   
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like        74.7    3e-14   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5             74.7    3e-14   
ref|NP_001289823.1|  aquaporin PIP2-1-like                            74.7    3e-14   
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                 74.7    3e-14   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5             74.7    3e-14   
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                 74.7    3e-14   
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5             74.3    3e-14   
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2      74.3    3e-14   
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5             74.3    3e-14   
gb|KHN00691.1|  Aquaporin PIP2-2                                      74.3    3e-14   
gb|AGD98714.1|  aquaporin protein 11                                  74.3    3e-14   
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                 74.3    3e-14   
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                 74.3    4e-14   
ref|NP_001240039.1|  uncharacterized protein LOC100782155             74.3    4e-14   
gb|AEQ29857.1|  aquaporin PIP2                                        74.3    4e-14   
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                       74.3    4e-14   Ricinus communis
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                 74.3    4e-14   
emb|CDP07111.1|  unnamed protein product                              74.3    4e-14   
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                 74.3    4e-14   
ref|XP_008345040.1|  PREDICTED: aquaporin PIP2-1-like                 73.2    4e-14   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2      74.3    4e-14   Solanum chacoense
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5             74.3    4e-14   
dbj|BAE02729.1|  PIP aquaporin                                        74.3    4e-14   Hordeum vulgare [barley]
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                74.3    4e-14   
dbj|BAA23744.1|  HvPIP2;1                                             74.3    4e-14   Hordeum vulgare [barley]
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                 74.3    4e-14   
ref|XP_008345410.1|  PREDICTED: aquaporin PIP2-1-like                 73.9    5e-14   
gb|AIK66515.1|  putative aquaporin                                    73.9    5e-14   
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1      73.9    5e-14   
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2             73.9    5e-14   
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                      73.9    5e-14   
gb|AFO63679.1|  plasma intrinsic protein 2                            73.9    5e-14   
emb|CAN75442.1|  hypothetical protein VITISV_019657                   73.9    5e-14   Vitis vinifera
gb|AAV69744.1|  aquaporin                                             73.9    5e-14   Vitis vinifera
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2             73.9    5e-14   
ref|NP_001289999.1|  aquaporin PIP2-1                                 73.9    5e-14   
gb|AEY75244.1|  plasma membrane intrinsic protein                     73.9    5e-14   
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                 73.9    5e-14   
gb|AEO13898.1|  aquaporin 7                                           73.9    5e-14   
gb|ABH09326.1|  putative aquaporin                                    73.9    5e-14   Vitis vinifera
gb|AAB67868.1|  plasma membrane major intrinsic protein 1             73.9    6e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001268056.1|  aquaporin PIP2                                   73.9    6e-14   
gb|AIA83104.1|  putative aquaporin PIP2                               73.9    6e-14   
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                   73.9    6e-14   Vitis cinerea var. helleri x Vitis rupestris
ref|XP_006367009.1|  PREDICTED: probable aquaporin PIP2-2-like        73.2    6e-14   
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g           73.6    6e-14   
gb|EMT09900.1|  Putative aquaporin PIP2-2                             73.9    7e-14   
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein   73.6    7e-14   Solanum tuberosum [potatoes]
gb|AFK47442.1|  unknown                                               73.6    7e-14   
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                 73.6    7e-14   
gb|AGD98708.1|  aquaporin protein 5                                   73.6    8e-14   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                      73.6    8e-14   
ref|XP_003597235.1|  Aquaporin PIP2-7                                 73.6    8e-14   
gb|ACJ85173.1|  unknown                                               73.2    9e-14   Medicago truncatula
gb|AGD98707.1|  aquaporin protein 4                                   73.2    9e-14   
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5             73.2    9e-14   
gb|AIG92831.1|  aquaporin PIP2                                        73.2    9e-14   
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                 73.2    1e-13   
ref|XP_002316367.1|  putative aquaporin family protein                73.2    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_009413716.1|  PREDICTED: probable aquaporin PIP2-3 isoform X2  73.2    1e-13   
ref|NP_001280185.1|  aquaporin PIP2-2                                 73.2    1e-13   
gb|AGG39693.1|  aquaporin protein AQU15                               73.2    1e-13   
gb|AAY22203.1|  putative aquaporin                                    73.2    1e-13   Phaseolus vulgaris [French bean]
gb|ADJ67992.1|  aquaporin                                             73.2    1e-13   
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                 73.2    1e-13   
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg           73.2    1e-13   
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                 72.8    1e-13   
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                      72.8    1e-13   
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5             72.8    1e-13   
emb|CDP06739.1|  unnamed protein product                              72.8    1e-13   
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g           72.8    1e-13   
gb|ACM50914.1|  aquaporin                                             72.8    1e-13   Medicago falcata [sickle alfalfa]
ref|NP_001267922.1|  aquaporin-like                                   72.8    1e-13   
gb|AHA84284.1|  prolactin-inducible protein                           72.8    2e-13   
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5             72.8    2e-13   
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                      72.8    2e-13   
gb|ACU20229.1|  unknown                                               72.4    2e-13   Glycine max [soybeans]
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg              72.4    2e-13   
gb|AAV80229.1|  aquaporin 2                                           72.4    2e-13   Aegiceras corniculatum
ref|XP_003591905.1|  Aquaporin PIP                                    72.4    2e-13   
gb|ACU87558.1|  PIP protein                                           72.4    2e-13   
ref|NP_001105026.1|  aquaporin PIP2-4                                 72.4    2e-13   Zea mays [maize]
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                72.4    2e-13   Pyrus communis
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                      72.4    2e-13   
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g           72.4    2e-13   
gb|ACZ06859.1|  plasma membrane intrinsic protein                     72.4    2e-13   
gb|KDO44717.1|  hypothetical protein CISIN_1g0196812mg                72.0    2e-13   
gb|AEQ20672.1|  PIP2;1                                                72.4    2e-13   
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg           72.0    2e-13   
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5             72.0    2e-13   
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1       72.0    2e-13   
ref|XP_008359252.1|  PREDICTED: aquaporin PIP2-2-like                 70.1    3e-13   
gb|ABB88840.1|  aquaporin                                             72.0    3e-13   Stevia rebaudiana
gb|ACG33001.1|  aquaporin PIP2.2                                      72.0    3e-13   Zea mays [maize]
emb|CAB46351.1|  major intrinsic protein 2                            72.0    3e-13   Solanum tuberosum [potatoes]
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                 72.0    3e-13   
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1            72.0    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                       72.0    3e-13   Ricinus communis
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5             72.0    3e-13   
ref|NP_001233846.1|  putative PIP-type aquaporin                      72.0    3e-13   
gb|ACU24483.1|  unknown                                               71.6    3e-13   Glycine max [soybeans]
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                 71.6    4e-13   
gb|AAD31846.1|AF133530_1  water channel protein MipH                  71.6    4e-13   Mesembryanthemum crystallinum
gb|ABC69040.1|  aquaporin PIP2-1                                      71.6    4e-13   Rhododendron catawbiense [Catawba rosebay]
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650        71.6    4e-13   Sorghum bicolor [broomcorn]
emb|CDX74983.1|  BnaA05g07290D                                        70.9    4e-13   
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g           71.6    4e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5             71.2    5e-13   
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                 71.2    5e-13   
emb|CAH60723.1|  putative plasma membrane intrinsic protein           71.2    5e-13   Populus tremula x Populus tremuloides
emb|CDX91341.1|  BnaC04g08090D                                        71.2    5e-13   
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8             71.2    5e-13   
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                 71.2    5e-13   
ref|XP_007200557.1|  hypothetical protein PRUPE_ppa009691mg           71.2    5e-13   
gb|ACX37450.1|  plasma membrane intrinsic protein                     71.2    5e-13   Hevea brasiliensis [jebe]
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                 71.2    6e-13   
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                 71.2    6e-13   
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                 71.2    6e-13   
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                      71.2    6e-13   
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270        70.9    6e-13   
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1  70.9    6e-13   
ref|NP_001274381.1|  aquaporin PIP2-7-like                            70.9    7e-13   
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                 70.9    7e-13   
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                 70.9    7e-13   
dbj|BAE06148.1|  PIP aquaporin isoform                                70.9    7e-13   Hordeum vulgare [barley]
ref|NP_001105025.1|  aquaporin PIP2-3                                 70.9    8e-13   Zea mays [maize]
gb|ABI96813.1|  plasma membrane intrinsic protein                     70.9    8e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2  70.9    8e-13   
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840        70.9    8e-13   Sorghum bicolor [broomcorn]
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                      70.5    9e-13   
ref|XP_006481456.1|  PREDICTED: aquaporin PIP2-2-like                 70.1    9e-13   
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                 70.5    9e-13   
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4             70.5    9e-13   
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                 70.5    9e-13   
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg           70.5    9e-13   
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                 70.5    9e-13   
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4             70.5    1e-12   
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4             70.5    1e-12   
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                         70.5    1e-12   Raphanus sativus
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                 70.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABN11917.1|  aquaporin                                             70.5    1e-12   Cucurbita ficifolia [chilacayote]
ref|XP_010100853.1|  Aquaporin PIP2-1                                 70.5    1e-12   
gb|AEY75242.1|  plasma membrane intrinsic protein                     70.5    1e-12   
ref|NP_181254.1|  aquaporin PIP2-2                                    70.1    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ABK93567.1|  unknown                                               70.1    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004307390.1|  PREDICTED: probable aquaporin PIP2-5-like        70.1    1e-12   
gb|ABX83874.1|  plasma membrane intrinsic protein                     70.1    1e-12   Rhododendron catawbiense [Catawba rosebay]
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                 70.1    1e-12   
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg           70.1    1e-12   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                 70.1    1e-12   
gb|AGC24024.1|  plasma membrane intrinsic protein 1                   70.1    1e-12   
emb|CDY13298.1|  BnaC06g14590D                                        70.1    1e-12   
gb|EMS51072.1|  Aquaporin PIP2-5                                      70.1    1e-12   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6             70.1    1e-12   
ref|XP_009600501.1|  PREDICTED: aquaporin PIP2-7-like                 70.1    1e-12   
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3      70.1    2e-12   
ref|XP_009803627.1|  PREDICTED: aquaporin PIP2-7-like                 69.7    2e-12   
gb|AAW80918.1|  putative plasma membrane intrinsic protein            69.7    2e-12   Astragalus penduliflorus
dbj|BAF33069.1|  aquaporin                                            69.7    2e-12   Hordeum vulgare [barley]
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                               69.7    2e-12   
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)      69.7    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                 69.7    2e-12   
ref|XP_010262516.1|  PREDICTED: aquaporin PIP2-7-like                 68.2    2e-12   
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                 69.7    2e-12   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                 69.7    2e-12   
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                   69.3    2e-12   
gb|AHB33479.1|  plasma intrinsic protein 2-3                          69.7    2e-12   
ref|NP_001268058.1|  aquaporin-like                                   69.7    2e-12   
ref|XP_008382110.1|  PREDICTED: probable aquaporin PIP2-8             69.3    2e-12   
ref|XP_006436426.1|  hypothetical protein CICLE_v10032302mg           68.9    2e-12   
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                 69.3    2e-12   
gb|EPS68613.1|  hypothetical protein M569_06155                       69.3    3e-12   
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                      69.3    3e-12   
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                 69.3    3e-12   
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                 69.3    3e-12   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5             69.3    3e-12   
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg           69.3    3e-12   
gb|AFH36338.1|  aquaporin PIP2;3                                      68.9    3e-12   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                69.7    3e-12   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                68.9    4e-12   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                 68.9    4e-12   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                 68.9    4e-12   
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707           68.9    4e-12   
emb|CDY46759.1|  BnaA03g17030D                                        68.9    4e-12   
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4             68.6    4e-12   
ref|NP_001274308.1|  aquaporin PIP2-1-like                            68.6    4e-12   
gb|KDO44718.1|  hypothetical protein CISIN_1g0196812mg                68.2    5e-12   
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                   69.3    5e-12   
ref|NP_001234625.1|  aquaporin                                        68.6    5e-12   
gb|AFQ23181.1|  aquaporin PIP2;2                                      68.6    6e-12   
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                 68.6    6e-12   
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                 68.2    6e-12   
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)      68.6    6e-12   
emb|CDX91340.1|  BnaC04g08100D                                        68.2    6e-12   
ref|NP_181255.1|  aquaporin PIP2-3                                    68.2    6e-12   
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5             68.2    6e-12   
ref|XP_010263732.1|  PREDICTED: aquaporin PIP2-7-like                 67.4    6e-12   
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4             68.2    7e-12   
emb|CDY56697.1|  BnaCnng31040D                                        68.2    7e-12   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                 68.2    7e-12   
emb|CDX74984.1|  BnaA05g07300D                                        68.6    8e-12   
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1              68.2    8e-12   
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg           68.2    8e-12   
ref|XP_010107541.1|  Aquaporin PIP2-2                                 68.2    8e-12   
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                     68.2    8e-12   
ref|XP_008449250.1|  PREDICTED: aquaporin PIP2-1-like                 67.8    8e-12   
gb|EMS56715.1|  putative aquaporin PIP2-2                             68.9    8e-12   
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                 67.8    9e-12   
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg           67.8    9e-12   
gb|AHB33482.1|  plasma intrinsic protein 2-6                          67.8    9e-12   
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                 67.8    1e-11   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1      67.8    1e-11   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg           67.8    1e-11   
gb|ABI96814.1|  plasma membrane intrinsic protein                     67.8    1e-11   
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                         67.8    1e-11   
ref|NP_001274397.1|  aquaporin PIP2-1-like                            67.8    1e-11   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                   68.6    1e-11   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...  67.8    1e-11   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like        67.8    1e-11   
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2             67.4    1e-11   
gb|AAG44947.1|AF290620_1  putative PIP2                               67.4    1e-11   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                      67.4    1e-11   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                 67.4    1e-11   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                67.4    1e-11   
ref|XP_004143246.1|  PREDICTED: aquaporin PIP2-2-like                 67.4    1e-11   
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2      67.4    1e-11   
emb|CCI55668.1|  EaPIP2,1                                             67.4    1e-11   
dbj|BAO18630.1|  plasmamembrane intrinsic protein 2;8                 67.4    1e-11   
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4             67.4    2e-11   
gb|ACJ85211.1|  unknown                                               67.0    2e-11   
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2             67.4    2e-11   
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4             67.4    2e-11   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                 67.0    2e-11   
ref|NP_001266257.1|  aquaporin PIP2-7-like                            67.0    2e-11   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6             67.0    2e-11   
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg           67.0    2e-11   
gb|KCW51593.1|  hypothetical protein EUGRSUZ_J01087                   67.8    2e-11   
ref|XP_003625627.1|  Aquaporin PIP2-1                                 67.0    2e-11   
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                      67.0    2e-11   
gb|AHG32323.1|  PIP2-2                                                67.0    2e-11   
gb|AFK33316.1|  unknown                                               66.6    2e-11   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8             66.6    2e-11   
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                 66.6    2e-11   
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                  66.6    2e-11   
gb|AGD98712.1|  aquaporin protein 9                                   66.6    3e-11   
gb|AGD98705.1|  aquaporin                                             66.6    3e-11   
gb|AAL49750.1|AF452012_1  aquaporin-like protein                      66.6    3e-11   
dbj|BAD90701.1|  plasma membrane intrinsic protein 2;5                66.6    3e-11   
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg           66.6    3e-11   
gb|AFQ23567.1|  aquaporin PIP2;2                                      66.6    3e-11   
tpg|DAA60471.1|  TPA: plasma membrane intrinsic protein2              65.9    3e-11   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715           66.2    4e-11   
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                 66.2    4e-11   
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5             66.2    4e-11   
gb|ABK22546.1|  unknown                                               65.9    4e-11   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6             65.9    4e-11   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg           65.9    5e-11   
gb|EMS60960.1|  Aquaporin PIP2-4                                      65.5    5e-11   
ref|XP_010689549.1|  PREDICTED: aquaporin PIP2-1-like                 65.9    5e-11   
ref|XP_004143248.1|  PREDICTED: aquaporin PIP2-1-like                 65.5    5e-11   
ref|XP_006384579.1|  hypothetical protein POPTR_0004s18240g           65.1    6e-11   
gb|KDP23969.1|  hypothetical protein JCGZ_25357                       65.9    6e-11   
gb|ACR38689.1|  unknown                                               65.1    6e-11   
gb|ACA35273.1|  aquaporin                                             63.9    6e-11   
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                 65.5    6e-11   
ref|XP_003563179.1|  PREDICTED: aquaporin PIP2-6                      65.9    6e-11   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5             65.5    7e-11   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6             65.5    7e-11   
gb|ACB71281.1|  plasma membrane intrinsic protein                     65.5    8e-11   
ref|NP_001053335.1|  Os04g0521100                                     65.5    8e-11   
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8             65.1    9e-11   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7-like                 65.1    9e-11   
gb|ACE60220.1|  plasma membrane aquaporin                             65.1    9e-11   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein               65.1    9e-11   
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                 65.1    9e-11   
dbj|BAG06230.1|  plasma membrane intrinsic protein                    65.1    9e-11   
gb|ABI96815.1|  plasma membrane intrinsic protein                     65.1    9e-11   
dbj|BAG68662.1|  plasma membrane intrinsic protein                    65.1    9e-11   
gb|ACR56615.1|  plasma intrinsic protein 2;5                          65.1    1e-10   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                      65.1    1e-10   
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                       65.1    1e-10   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A             65.1    1e-10   
ref|XP_006359706.1|  PREDICTED: aquaporin PIP2-7-like                 65.1    1e-10   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g           65.1    1e-10   
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                 65.1    1e-10   
ref|NP_001274386.1|  aquaporin PIP2-1-like                            64.7    1e-10   
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301           64.7    1e-10   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                   65.9    1e-10   
ref|XP_006383053.1|  plasma membrane intrinsic protein 1-1            64.7    1e-10   
gb|EAZ39657.1|  hypothetical protein OsJ_24085                        65.1    2e-10   
ref|XP_006412151.1|  hypothetical protein EUTSA_v10025940mg           63.9    2e-10   
gb|EMT03221.1|  hypothetical protein F775_43871                       64.3    2e-10   
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790        64.3    2e-10   
ref|NP_001059542.1|  Os07g0448100                                     64.3    2e-10   
ref|XP_009631880.1|  PREDICTED: probable aquaporin PIP1-2             64.3    2e-10   
gb|EPS67285.1|  hypothetical protein M569_07488                       63.9    2e-10   
gb|ABH09327.1|  putative aquaporin                                    63.9    2e-10   
ref|NP_001267957.1|  aquaporin PIP2;2                                 63.9    2e-10   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                   63.9    2e-10   
gb|AFN53630.1|  putative aquaporin PIP2-8                             65.9    2e-10   
gb|EAZ03711.1|  hypothetical protein OsI_25843                        64.3    2e-10   
ref|XP_002879655.1|  aquaporin                                        63.5    2e-10   
ref|XP_002306187.1|  membrane intrinsic family protein                63.9    2e-10   
ref|XP_009782764.1|  PREDICTED: aquaporin PIP2-7                      63.9    2e-10   
gb|AFB82643.1|  aquaporin                                             63.9    3e-10   
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                       63.9    3e-10   
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6              63.9    3e-10   
gb|ACR56614.1|  plasma intrinsic protein 2;4                          63.9    3e-10   
emb|CDP21564.1|  unnamed protein product                              63.9    3e-10   
ref|XP_006657662.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...  63.9    3e-10   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2              64.3    3e-10   
gb|ABL76066.1|  aquaporin 2                                           63.5    3e-10   
ref|XP_009780331.1|  PREDICTED: aquaporin PIP1-1-like                 62.4    3e-10   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                63.5    3e-10   
gb|KDO68091.1|  hypothetical protein CISIN_1g023370mg                 63.5    3e-10   
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6             63.5    3e-10   
ref|NP_001105024.1|  aquaporin PIP2-1                                 63.9    3e-10   
dbj|BAA20074.1|  water channel protein                                63.9    3e-10   
ref|NP_190910.1|  aquaporin PIP2-1                                    63.9    3e-10   
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                63.5    3e-10   
gb|AFN53685.1|  putative aquaporin PIP2-8                             65.5    3e-10   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein              63.5    3e-10   
gb|AEF32110.1|  aquaporin PIP2                                        63.5    3e-10   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700        63.5    3e-10   
ref|XP_010107654.1|  Aquaporin PIP2-7                                 63.5    3e-10   
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like        63.5    3e-10   
gb|AEW08748.1|  hypothetical protein CL1521Contig1_01                 60.5    4e-10   
gb|AAO86707.1|  aquaporin                                             63.5    4e-10   
gb|AAB65787.1|  plasma membrane intrinsic protein                     63.5    4e-10   
ref|NP_195236.1|  plasma membrane intrinsic protein 3                 63.5    4e-10   
ref|XP_009762763.1|  PREDICTED: probable aquaporin PIP1-2             63.5    4e-10   
gb|ACV70048.1|  aquaporin PIP2;1                                      62.8    4e-10   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830        63.5    4e-10   
gb|EMT02787.1|  Putative aquaporin PIP2-6                             62.4    4e-10   
gb|ACV70050.1|  aquaporin PIP2;1                                      62.8    4e-10   
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                 63.5    4e-10   
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...  63.5    4e-10   
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                 63.5    4e-10   
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760        63.5    4e-10   
ref|XP_011043134.1|  PREDICTED: aquaporin PIP2-7-like                 63.5    4e-10   
emb|CDX69112.1|  BnaC01g03410D                                        63.2    5e-10   
ref|XP_011045923.1|  PREDICTED: probable aquaporin PIP2-8             63.2    5e-10   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg           63.2    5e-10   
ref|NP_001105638.1|  aquaporin PIP2-2                                 63.5    5e-10   
gb|ACF79873.1|  unknown                                               63.5    5e-10   
gb|ACG32567.1|  aquaporin PIP2.1                                      63.2    5e-10   
ref|XP_009789917.1|  PREDICTED: aquaporin PIP1-1-like                 62.0    5e-10   
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5             63.2    5e-10   
gb|ABM54183.1|  aquaporin                                             63.2    5e-10   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                   63.2    5e-10   
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg           63.2    5e-10   
tpg|DAA39707.1|  TPA: plasma membrane intrinsic protein2              62.8    5e-10   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                   63.2    5e-10   
ref|NP_001059543.1|  Os07g0448200                                     62.4    5e-10   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                      63.2    6e-10   
ref|XP_004500724.1|  PREDICTED: uncharacterized protein LOC101494283  64.7    6e-10   
gb|AAS65964.1|  aquaporin PIP 2                                       62.8    6e-10   
gb|ACB87734.1|  aquaporin                                             62.8    6e-10   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6             62.8    6e-10   
ref|XP_006664814.1|  PREDICTED: probable aquaporin PIP2-6-like        62.8    6e-10   
ref|XP_006291621.1|  hypothetical protein CARUB_v10017773mg           62.8    6e-10   
ref|XP_004137971.1|  PREDICTED: probable aquaporin PIP2-4-like        63.2    6e-10   
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                 62.8    7e-10   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800        62.8    7e-10   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780        62.8    7e-10   
ref|XP_009386207.1|  PREDICTED: probable aquaporin PIP1-2 isoform X2  63.5    7e-10   
dbj|BAG06231.1|  plasma membrane intrinsic protein                    62.8    7e-10   
gb|EAZ03714.1|  hypothetical protein OsI_25847                        62.8    7e-10   
ref|NP_001105027.1|  aquaporin PIP2-6                                 62.8    7e-10   
emb|CDX67611.1|  BnaA07g16510D                                        62.8    7e-10   
dbj|BAF32042.1|  putative aquaporin                                   62.8    7e-10   
ref|XP_004164389.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...  62.8    8e-10   
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8             62.8    8e-10   
ref|XP_001762521.1|  predicted protein                                62.4    8e-10   
ref|XP_009386206.1|  PREDICTED: probable aquaporin PIP1-2 isoform X1  62.8    8e-10   
ref|XP_010432340.1|  PREDICTED: aquaporin PIP2-7                      62.4    8e-10   
gb|AAF65845.1|AF255795_1  aquaporin 1                                 62.8    9e-10   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...  62.4    9e-10   
gb|ADG03686.1|  aquaporin                                             62.8    9e-10   
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840        62.4    9e-10   
emb|CDY07519.1|  BnaC06g15450D                                        62.4    9e-10   
ref|XP_007041805.1|  Plasma membrane intrinsic protein 3 isoform 2    61.2    9e-10   
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                  62.4    1e-09   
ref|XP_006284279.1|  hypothetical protein CARUB_v10005443mg           62.4    1e-09   
ref|XP_006383054.1|  plasma membrane intrinsic protein 1-1            62.0    1e-09   
gb|EPS61960.1|  hypothetical protein M569_12834                       62.4    1e-09   
ref|NP_001052292.1|  Os04g0233400                                     62.0    1e-09   
dbj|BAF32141.1|  putative aquaporin                                   62.0    1e-09   
ref|XP_010028741.1|  PREDICTED: uncharacterized protein LOC104418957  63.9    1e-09   
gb|KCW72173.1|  hypothetical protein EUGRSUZ_E00628                   61.6    1e-09   
ref|XP_006422583.1|  hypothetical protein CICLE_v10029003mg           61.2    1e-09   
gb|ABB87103.1|  water channel protein-like                            61.6    1e-09   
emb|CDX73446.1|  BnaC08g25570D                                        62.0    1e-09   



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score = 81.6 bits (200),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 40/52 (77%), Positives = 41/52 (79%), Gaps = 6/52 (12%)
 Frame = -3

Query  140  MAKDIEGTAEH------SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE TAE       SAKDYHDPPPAPLID +ELTKWS YRAAIAEFIAT
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYHDPPPAPLIDMEELTKWSLYRAAIAEFIAT  52



>gb|KDO73275.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=264

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 40/52 (77%), Gaps = 6/52 (12%)
 Frame = -3

Query  140  MAKDIE------GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E      G  E SAKDYHDPPPAPLIDF+EL KWSFYRA IAEFIAT
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAT  52



>ref|XP_006424577.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|ESR37817.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
Length=264

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 40/52 (77%), Gaps = 6/52 (12%)
 Frame = -3

Query  140  MAKDIE------GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E      G  E SAKDYHDPPPAPLIDF+EL KWSFYRA IAEFIAT
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAT  52



>tpg|DAA33865.1| TPA_inf: aquaporin PIP2;10 [Gossypium hirsutum]
Length=271

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 40/52 (77%), Gaps = 6/52 (12%)
 Frame = -3

Query  140  MAKDIEGTAEH------SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE TAE       SAKDY DPPPAPLID +ELTKWS YRAAIAEFIAT
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAAIAEFIAT  52



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/49 (80%), Positives = 41/49 (84%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E+SAKDYHDPPPAPLID DELTKWS YRAAIAEFIAT
Sbjct  1    MAKDVEQVTEQGEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIAT  49



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E   E SAKDY DPPPAPLIDF+EL +WSFYRAAIAEFIAT
Sbjct  1    MGKDVEAATEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIAT  46



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 40/52 (77%), Gaps = 6/52 (12%)
 Frame = -3

Query  140  MAKDIE------GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E      G  E SAKDYHDPPPAPLIDF+EL KWSFYRA IAEFIAT
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAT  52



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 39/49 (80%), Positives = 41/49 (84%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E+SAKDYHDPPPAPLID DELTKWS YRAAIAEFIAT
Sbjct  1    MAKDVEQVTEQGEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIAT  49



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E   E SAKDY DPPPAPLIDF+EL +WSFYRAAIAEFIAT
Sbjct  1    MGKDVEAATEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIAT  46



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE   +  AKDYHDPPPAPL+D +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDIEVGGQFQAKDYHDPPPAPLVDAEELTKWSFYRAIIAEFIAT  46



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/49 (80%), Positives = 41/49 (84%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E+SAKDYHDPPPAPLID DELTKWS YRAAIAEFIAT
Sbjct  1    MAKDVEQVTEQGEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIAT  49



>emb|CAB45651.1| putative plasma membrane intrinsic protein [Pisum sativum]
Length=285

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E     E+SAKDY DPPPAPLID DELTKWSFYRA IAEF+AT
Sbjct  1    MAKDVEVQEQGEYSAKDYQDPPPAPLIDLDELTKWSFYRALIAEFVAT  48



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK++E     AE +AKDYHDPPPAPLID+DELTKWSFYRA IAEFIAT
Sbjct  1    MAKEVECAEPAAEFAAKDYHDPPPAPLIDYDELTKWSFYRALIAEFIAT  49



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E SAKDYHDPPPAPLID +E+T+WSFYRA IAEF+AT
Sbjct  1    MGKDIEVGGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVAT  46



>gb|ACU19125.1| unknown [Glycine max]
Length=287

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 39/49 (80%), Positives = 41/49 (84%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E+SAKDYHDPPPAPLID DELTKWS YRAAIAEFIAT
Sbjct  1    MAKDVEQVTEQGEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIAT  49



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
Length=285

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E   E  AKDYHDPPPAPL+D +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVEVGGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIAT  46



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = -3

Query  140  MAKDIEGTAEH-SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE + E  S KDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MGKDIESSVEQVSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIAT  47



>emb|CAC82712.1| major intrinsic protein 1 [Populus tremula x Populus tremuloides]
 emb|CAH60722.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD EG  E SAKDYHDPPPAPLID +E+T+WSFYRA IAEF+AT
Sbjct  1    MGKDFEGGGELSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVAT  46



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score = 79.7 bits (195),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 36/46 (78%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E SAKDYHDPPPAPLID +ELT+WS YRA IAEFIAT
Sbjct  1    MGKDIEVGGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIAT  46



>gb|ACU00104.1| plasma membrane intrinsic protein PIP2.2 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E SAKDYHDPPPAPLID +E+T+WSFYRA IAEF+AT
Sbjct  1    MGKDIEVGGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVAT  46



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/46 (78%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E SAKDYHDPPPAPLID +ELT+WS YRA IAEFIAT
Sbjct  1    MGKDIEVGGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIAT  46



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/46 (78%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE   E  AKDYHDPPPAPL+D  EL KWSFYRA IAEFIAT
Sbjct  1    MAKDIEVGGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIAT  46



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score = 79.0 bits (193),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E SAKDYHDPPPAPLID +E+T+WSFYRA IAEF+AT
Sbjct  1    MGKDIEVGGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVAT  46



>gb|EYU34445.1| hypothetical protein MIMGU_mgv1a011350mg [Erythranthe guttata]
Length=284

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGTA---EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIEG A   E+ AKDYHDPPPAPLID +ELTKWS YRA IAEF AT
Sbjct  1    MAKDIEGGAAAHEYGAKDYHDPPPAPLIDSEELTKWSLYRAVIAEFTAT  49



>ref|XP_003575410.1| PREDICTED: aquaporin PIP2-4 [Brachypodium distachyon]
Length=288

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE +A    E SAKDY DPPPAP++DF+ELTKWS YRAAIAEF+AT
Sbjct  1    MAKDIEASAPEGGEFSAKDYSDPPPAPIVDFEELTKWSLYRAAIAEFVAT  50



>gb|EYU39575.1| hypothetical protein MIMGU_mgv1a011441mg [Erythranthe guttata]
Length=281

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+       AKDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVAEQGSFGAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIAT  46



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E +AKDYHDPPPAPLID +ELT+WS YRA IAEFIAT
Sbjct  1    MGKDIEVGGEFNAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIAT  46



>ref|XP_004505993.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=285

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E     E SAKDY DPPPAPLIDFDELTKWSFYRA IAEF+AT
Sbjct  1    MAKDVEVQEHGEFSAKDYQDPPPAPLIDFDELTKWSFYRALIAEFVAT  48



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  G  E  AKDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDIEVGGQGEFHAKDYHDPPPAPLIDAEELTKWSFYRAIIAEFIAT  48



>ref|XP_006428787.1| hypothetical protein CICLE_v10012633mg [Citrus clementina]
 gb|ESR42027.1| hypothetical protein CICLE_v10012633mg [Citrus clementina]
Length=235

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  G  E  AKDYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDIEIGGQGEFHAKDYHDPPPAPLIDAEELTQWSFYRATIAEFIAT  48



>gb|AJF34896.1| plasma membrane intrinsic protein 2-2, partial [Stipa purpurea]
Length=104

 Score = 75.9 bits (185),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE +A    E SAKDY DPPPAP+IDF+ELTKWS YRA IAEF+AT
Sbjct  1    MAKDIEASAPEGAEFSAKDYSDPPPAPIIDFEELTKWSLYRAVIAEFVAT  50



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 39/49 (80%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E    T E S KDYHDPPPAPLID DEL +WSFYRA IAEFIAT
Sbjct  1    MAKDVEVAEPTGEFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIAT  49



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 39/50 (78%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIE----GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E       E SAKDYHDPPPAPLID DEL KWSFYRA IAEFIAT
Sbjct  1    MAKDVEVAEATGGEFSAKDYHDPPPAPLIDVDELGKWSFYRALIAEFIAT  50



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2-like [Fragaria vesca subsp. vesca]
Length=281

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG    E +AKDYHDPPP PL D DELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVEGAEHGEFAAKDYHDPPPTPLFDADELTKWSFYRAVIAEFIAT  48



>gb|KCW51391.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=209

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E    AE +AKDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVEVAEPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E+SAKDYHDPPPAPLI  DELTKWS YRAAIAEFIAT
Sbjct  1    MAKDVEQVTEQGEYSAKDYHDPPPAPLIHPDELTKWSLYRAAIAEFIAT  49



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG AEH   +AKDYHDPPP PL D +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVEG-AEHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIAT  48



>ref|NP_001105616.1| aquaporin PIP2-5 [Zea mays]
 sp|Q9XF58.1|PIP25_MAIZE RecName: Full=Aquaporin PIP2-5; AltName: Full=Plasma membrane 
intrinsic protein 2-5; AltName: Full=ZmPIP2-5; AltName: Full=ZmPIP2;5; 
AltName: Full=ZmPIP2a [Zea mays]
 gb|AAD28761.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAO86708.1| aquaporin [Zea mays]
 tpg|DAA36903.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=285

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  A H  KDY DPPPAPL+D +ELTKWS YRA IAEF+AT
Sbjct  1    MAKDIEAAAAHEGKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVAT  46



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 39/50 (78%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGT----AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE       E SAKDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MTKDIETAEQRGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIAT  50



>ref|XP_006481459.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  G  E  AKDYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDIEVGGQGEFHAKDYHDPPPAPLIDAEELTQWSFYRATIAEFIAT  48



>ref|XP_006481455.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  G  E  AKDYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDIEIGGQGEFHAKDYHDPPPAPLIDAEELTQWSFYRATIAEFIAT  48



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+EG    E+SAKDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MGKDVEGAEQGEYSAKDYQDPPPAPLIDPEELTKWSFYRALIAEFIAT  48



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E   E  AKDYHDPPPAPL+D  ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVGGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIAT  46



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E  AKDYHDPPPAPLID +ELT+WS YRA IAEFIAT
Sbjct  1    MGKDIEVGGEFIAKDYHDPPPAPLIDAEELTQWSLYRAVIAEFIAT  46



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E     E+SAKDYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVAERGEYSAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIAT  48



>ref|XP_006481457.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Citrus sinensis]
 ref|XP_006481458.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Citrus sinensis]
Length=287

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  G  E  AKDYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDIEVGGQGEFHAKDYHDPPPAPLIDAEELTQWSFYRATIAEFIAT  48



>gb|AAL32127.1| aquaporin [Medicago truncatula]
Length=287

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 37/49 (76%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+EG     E SAKDY DPPPAPL D DELTKWS YRA IAEF+AT
Sbjct  1    MGKDVEGQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVAT  49



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE +A    E SAKDY DPPPAPLID +ELTKWS YRA IAEFIAT
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIAT  50



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE +A    E SAKDY DPPPAPLID +ELTKWS YRA IAEFIAT
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIAT  50



>ref|XP_003606384.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88581.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=204

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E     E+SAKDY DPPPAPLID +ELTKWSFYRA IAEF+AT
Sbjct  1    MAKDVEVQEQGEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVAT  48



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+      SAKDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MVKDVAEQGSFSAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIAT  46



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIE----GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK++E    G  E SAKDYHDPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MAKEVETAEQGGGEFSAKDYHDPPPAPLIDAEELFKWSFYRALIAEFIAT  50



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK IE   E  AKDYHDPPPAPL+D  EL KWSFYRA IAEFIAT
Sbjct  1    MAKAIEVGGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIAT  46



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score = 76.6 bits (187),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  G    SAKDYHDPPPAPLID +E T+WSFYRA IAEFIAT
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIAT  48



>ref|XP_003606383.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88580.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
 gb|AFK45158.1| unknown [Medicago truncatula]
Length=285

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E     E+SAKDY DPPPAPLID +ELTKWSFYRA IAEF+AT
Sbjct  1    MAKDVEVQEQGEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVAT  48



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E    AE +AKDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVEVAEPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E   E  AKDYHDPPPAPLID +ELT+WS YRA IAEFIAT
Sbjct  1    MGKDVEVRGEFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIAT  46



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 39/50 (78%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIE----GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E       E SAKDYHDPPPAPLIDF+EL KWSFYRA IAEFIAT
Sbjct  1    MTKDVEVAEQQAPEFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIAT  50



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIA  6
            MAKD+E   E  AKDYHDPPPAPL+D  ELT+WSFYRA IAEFIA
Sbjct  1    MAKDVEVGGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIA  45



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E+SAKDYHDPPPAPL D +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIAT  49



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E+SAKDYHDPPPAPL D +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIAT  49



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E+SAKDYHDPPPAPL D +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIAT  49



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E+SAKDYHDPPPAPL D +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIAT  49



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    S+KDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIAT  48



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E+SAKDYHDPPPAPL D +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIAT  49



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E T     S KDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVEVTERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIAT  48



>ref|NP_001275065.1| major intrinsic protein 2 [Solanum tuberosum]
 gb|ABB29939.1| major intrinsic protein 2-like [Solanum tuberosum]
 emb|CBI99236.1| major intrinsic protein 2 [Solanum tuberosum]
Length=287

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGT----AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M K++E      AE+SAKDY DPPPAPLIDF+ELTKWS YRA IAEFIAT
Sbjct  1    MTKEVEAVHEQAAEYSAKDYTDPPPAPLIDFEELTKWSLYRAVIAEFIAT  50



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E  AKDYHDPPPAPLID +ELT+WS YRA IAEFIAT
Sbjct  1    MGKDIEVGREFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIAT  46



>ref|XP_006648854.1| PREDICTED: probable aquaporin PIP2-2-like [Oryza brachyantha]
Length=262

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE +A    E SAKDY DPPPAPLID +ELTKWS YRA IAEFIAT
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIAT  50



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E SAKDYHDPPPAPLID +EL KWS YRA IAEFIAT
Sbjct  1    MAKDVEVAENPGEFSAKDYHDPPPAPLIDVEELGKWSLYRALIAEFIAT  49



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEG----TAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E       E+SAKDYHDPPPAPLIDFDEL+ WSFYRA IAEF+AT
Sbjct  1    MTKDVESHVEPAEEYSAKDYHDPPPAPLIDFDELSSWSFYRALIAEFVAT  50



>tpg|DAA64677.1| TPA_exp: aquaporin PIP2 4a [Nicotiana tabacum]
Length=287

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGT----AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+K++E      AE+SAKDY DPPP PLIDF+ELTKWS YRA IAEFIAT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIAT  50



>ref|XP_009615789.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=287

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGT----AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+K++E      AE+SAKDY DPPP PLIDF+ELTKWS YRA IAEFIAT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIAT  50



>ref|XP_010920406.1| PREDICTED: aquaporin PIP2-4 isoform X2 [Elaeis guineensis]
Length=238

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AE +AKDY DPPPAPL+D +ELTKWS YRA IAEFIAT
Sbjct  1    MRKDMEAGAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIAT  46



>ref|NP_001289846.1| probable aquaporin PIP2-1 [Solanum lycopersicum]
 dbj|BAO18629.1| plasmamembrane intrinsic protein 2;6 [Solanum lycopersicum]
Length=287

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGT----AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M K++E       E+SAKDY DPPPAPLIDF+ELTKWS YRAAIAEFIAT
Sbjct  1    MTKEVEAAHEQAVEYSAKDYTDPPPAPLIDFEELTKWSLYRAAIAEFIAT  50



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK+ E   E  AKDYHDPPPAPL D +EL KWSFYRA IAEFIAT
Sbjct  1    MAKEAEAAGEFRAKDYHDPPPAPLFDAEELGKWSFYRAIIAEFIAT  46



>gb|AFK35635.1| unknown [Medicago truncatula]
Length=162

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    S KDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>ref|XP_007150204.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
 gb|ESW22198.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
Length=287

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGTAE---HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E   E   +SAKDYHDPPPAPL D DELTKWS YRAAIAEFIAT
Sbjct  1    MAKDVEQVTEQPEYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIAT  49



>gb|ABU94630.1| putative aquaporin PIP2;2 [Phaseolus vulgaris]
Length=287

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGTAE---HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E   E   +SAKDYHDPPPAPL D DELTKWS YRAAIAEFIAT
Sbjct  1    MAKDVEQVTEQPEYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIAT  49



>gb|AHA84128.1| plasma membrane integral protein ZmPIP2-7 [Phaseolus vulgaris]
Length=287

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGTAE---HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E   E   +SAKDYHDPPPAPL D DELTKWS YRAAIAEFIAT
Sbjct  1    MAKDVEQVTEQPEYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIAT  49



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      +SAKDYHDPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MAKDVEVAERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIAT  48



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+EG  +  AKDYHDPPPAPLID +E T+WSFYRA IAEFIAT
Sbjct  1    MGKDVEG-GDFQAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIAT  45



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  G    SAKDYHDPPPAPLID +E T+WSFYRA IAEFIAT
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIAT  48



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AE +AKDY DPPPAPL+D +ELTKWS YRA IAEFIAT
Sbjct  1    MRKDMEAGAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIAT  46



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE +     E SAKDY DPPPAPLID +ELTKWS YRAAIAEF+AT
Sbjct  1    MAKDIEASGPEAGEFSAKDYSDPPPAPLIDAEELTKWSLYRAAIAEFVAT  50



>ref|XP_009355655.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDI--EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+K++  EG A H  KDY DPPPAPLIDFDEL +WSFYRA IAEF+AT
Sbjct  1    MSKEVSEEGRAHHHGKDYADPPPAPLIDFDELRRWSFYRALIAEFVAT  48



>ref|XP_009786071.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64678.1| TPA_exp: aquaporin PIP2 4b [Nicotiana tabacum]
Length=287

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGT----AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M K++E      AE+SAKDY DPPP PLIDF+ELTKWS YRA IAEFIAT
Sbjct  1    MTKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIAT  50



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    S KDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E T     S KDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVEVTERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIAT  48



>ref|XP_006360898.1| PREDICTED: aquaporin PIP2-7-like [Solanum tuberosum]
Length=283

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDI--EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+KD+  EG A H  KDY DPPPAPL+D  ELTKWSFYRA IAEFIAT
Sbjct  1    MSKDVIEEGQAHHHGKDYVDPPPAPLLDMAELTKWSFYRAVIAEFIAT  48



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGTAE---HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK++EG +E   +SAKDYHDPPPA   D DELTKWSFYRA IAEF+AT
Sbjct  1    MAKEVEGVSEQPEYSAKDYHDPPPAAFFDLDELTKWSFYRALIAEFVAT  49



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      +SAKDYHDPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MAKDVEVAERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIAT  48



>gb|EAZ23886.1| hypothetical protein OsJ_07605 [Oryza sativa Japonica Group]
Length=280

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE +A    E SAKDY DPPPAPLID +ELTKWS YRA IAEFIAT
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIAT  50



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 40/49 (82%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AEH   +AKDYHDPPP PL D +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAEHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIAT  48



>ref|XP_008377729.1| PREDICTED: probable aquaporin PIP2-8 [Malus domestica]
Length=281

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDI--EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+K++  EG A H  KDY DPPPAPLIDFDEL +WSFYRA IAEF+AT
Sbjct  1    MSKEVSEEGRAHHHGKDYTDPPPAPLIDFDELRRWSFYRALIAEFVAT  48



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE     E++AKDY DPPPAPL+D +ELTKWS YRAAIAEFIAT
Sbjct  1    MAKDIEVAEQGEYTAKDYTDPPPAPLVDVEELTKWSLYRAAIAEFIAT  48



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 39/55 (71%), Gaps = 9/55 (16%)
 Frame = -3

Query  140  MAKDIE---------GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E         G  E SAKDYHD PPAPLIDFDEL KWSFYRA IAEFIAT
Sbjct  1    MGKDVEVAEQQGGGGGGGEFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIAT  55



>ref|NP_001235204.1| Pip1 protein [Glycine max]
 gb|AAA69490.1| putative water channel protein; plasmalemma intrinsic protein; 
similar to Arabidopsis Pip2a gene product, PIR Accession Number 
S44084 [Glycine max]
Length=285

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 2/47 (4%)
 Frame = -3

Query  140  MAK-DIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK D+EG    SAKDYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKHDVEG-GSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIAT  46



>ref|XP_006367007.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Solanum tuberosum]
Length=287

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E++ KDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MGKDIEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAT  46



>gb|ACU23034.1| unknown [Glycine max]
Length=158

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    S KDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>gb|AAF61464.1|AF139815_1 plasma membrane intrinsic protein 2 [Triticum aestivum]
Length=257

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE      E S KDY DPPPAP++DF+ELTKWS YRA IAEF+AT
Sbjct  1    MAKDIEAAPQGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVAT  49



>gb|KEH39328.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=268

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E      E SAKDY DPPPAPL D DELTKWS YRA IAEF+AT
Sbjct  1    MGKDVEVQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVAT  49



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  155  YFWLAMAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            +F   MAKD E   E++ KDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  4    FFGEQMAKDTEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAT  54



>gb|AEC45512.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=273

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E SAKDYHDPPPAPLID +EL KWS YRA IAEFIAT
Sbjct  1    MAKDVEVAENPGEFSAKDYHDPPPAPLIDVEELGKWSLYRALIAEFIAT  49



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E     E  AKDYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVVEGGEFQAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIAT  48



>gb|ABO69705.2| aquaporin PIP2 [Prunus humilis]
Length=281

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG    E +AKDYHDPPP P  D +ELTKWSFYRA IAEF+AT
Sbjct  1    MAKDVEGAEHGEFAAKDYHDPPPTPFFDAEELTKWSFYRALIAEFVAT  48



>ref|XP_003580150.1| PREDICTED: aquaporin PIP2-5 [Brachypodium distachyon]
Length=287

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = -3

Query  140  MAKDIEGT-AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE    E++AKDY DPPPAPL D +ELTKWS YRAAIAEF+AT
Sbjct  1    MAKDIEAAPGEYAAKDYSDPPPAPLFDAEELTKWSLYRAAIAEFVAT  47



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M K++E   E    SAKDY DPPPAPL+DF+ELT+WSFYRA IAEFIAT
Sbjct  1    MTKEVESVTERGEFSAKDYTDPPPAPLVDFEELTQWSFYRAIIAEFIAT  49



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE    +SAKDY DPPP PLID +EL KWSFYRA IAEFIAT
Sbjct  1    MGKDIEVGGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIAT  46



>ref|NP_001289823.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18626.1| plasmamembrane intrinsic protein 2;1 [Solanum lycopersicum]
Length=279

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E   E++ KDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MAKDMEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAT  46



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AEH   SAKDYHDPPP PLID  ELTKWSFYRA IAEFIAT
Sbjct  1    MGKDVE-VAEHGHFSAKDYHDPPPTPLIDAVELTKWSFYRALIAEFIAT  48



>ref|XP_011077012.1| PREDICTED: probable aquaporin PIP2-5 [Sesamum indicum]
Length=281

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M K++     + AKDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MTKEVAEHGSYGAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIAT  46



>ref|XP_009619670.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=283

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E++ KDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MGKDIEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAT  46



>ref|XP_008366675.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=281

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE    +SAKDY DPPP PLID +EL KWSFYRA IAEFIAT
Sbjct  1    MGKDIEVGGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIAT  46



>ref|XP_006367008.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Solanum tuberosum]
Length=279

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E++ KDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MGKDIEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAT  46



>ref|XP_009345759.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
 ref|XP_009345763.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=285

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE    +SAKDY DPPP PLID +EL KWSFYRA IAEFIAT
Sbjct  1    MGKDIEVGGGYSAKDYQDPPPEPLIDAEELGKWSFYRAIIAEFIAT  46



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 2/47 (4%)
 Frame = -3

Query  140  MAK-DIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK D+EG    SAKDYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKHDVEG-GSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIAT  46



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK++E T     E SAKDYHDPPPAPL+D  ELTKWSFYRA IAEFIAT
Sbjct  1    MAKEVEETVVTEQEFSAKDYHDPPPAPLVDAVELTKWSFYRAIIAEFIAT  50



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  155  YFWLAMAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            +F   MAKD E   E++ KDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  4    FFGEQMAKDTEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAT  54



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 2/47 (4%)
 Frame = -3

Query  140  MAK-DIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK D+EG    SAKDYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKHDVEG-GSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIAT  46



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 40/47 (85%), Gaps = 2/47 (4%)
 Frame = -3

Query  140  MAK-DIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK D+EG    SAKDYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKHDVEG-GSFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIAT  46



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 40/49 (82%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIEG AEH   ++KDY DPPP PL D +ELTKWSFYRA IAEF+AT
Sbjct  1    MAKDIEG-AEHGEFASKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVAT  48



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E      E  AKDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MGKDVEVGGHGGEFHAKDYHDPPPAPLIDAEELTKWSFYRAIIAEFIAT  49



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E++ KDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MGKDIEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAT  46



>emb|CDP07111.1| unnamed protein product [Coffea canephora]
Length=288

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/51 (69%), Positives = 38/51 (75%), Gaps = 5/51 (10%)
 Frame = -3

Query  140  MAKDIEGT-----AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG       E SAKDYHDPPPA   D DELTKWSF+RA IAEF+AT
Sbjct  1    MAKDVEGVVAAEQGEFSAKDYHDPPPAAFFDLDELTKWSFHRALIAEFVAT  51



>dbj|BAO18631.1| plasmamembrane intrinsic protein 2;9 [Solanum lycopersicum]
Length=283

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDI--EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+KD+  EG A H  KDY DPPPAPL+D  ELTKWSFYRA IAEFIAT
Sbjct  1    MSKDVIEEGQAHHHGKDYVDPPPAPLLDMAELTKWSFYRALIAEFIAT  48



>ref|XP_008345040.1| PREDICTED: aquaporin PIP2-1-like [Malus domestica]
Length=166

 Score = 73.2 bits (178),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  + + AKDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MAKDIEVGSGNPAKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAT  46



>gb|AAG02208.1|AF290201_1 plasma membrane intrinsic protein PIP2 [Solanum chacoense]
Length=283

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDI--EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+KD+  EG A H  KDY DPPPAPL+D  ELTKWSFYRA IAEFIAT
Sbjct  1    MSKDVIEEGQAHHHGKDYVDPPPAPLLDMAELTKWSFYRAVIAEFIAT  48



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE       SAKDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDIEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE      E S+KDY DPPPAP++DF+ELTKWS YRA IAEF+AT
Sbjct  1    MAKDIEAAPQGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVAT  49



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E++ KDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MGKDIEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAT  46



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 39/49 (80%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE      E S+KDY DPPPAP++DF+ELTKWS YRA IAEF+AT
Sbjct  1    MAKDIEAAPQGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVAT  49



>ref|XP_011094668.1| PREDICTED: aquaporin PIP2-4-like [Sesamum indicum]
Length=281

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = -3

Query  140  MAKDIE-GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE G  E+ AKDY DPPPAPLID +EL KWS YRA IAEFIAT
Sbjct  1    MAKDIEVGGTEYGAKDYQDPPPAPLIDPEELGKWSLYRAVIAEFIAT  47



>ref|XP_008345410.1| PREDICTED: aquaporin PIP2-1-like [Malus domestica]
Length=227

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  + + AKDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MAKDIEVGSGNPAKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAT  46



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AEH   SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MTKDVE-VAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIAT  48



>ref|XP_009413714.1| PREDICTED: aquaporin PIP2-4-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=287

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD E  G  E+  KDY DPPPAPLID +ELTKWS YRAAIAEF+AT
Sbjct  1    MAKDTEVAGRGEYGGKDYTDPPPAPLIDAEELTKWSLYRAAIAEFVAT  48



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGTA---EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  A   E++ KDY DPPPAPL D++ELTKWS YRAAIAEFIAT
Sbjct  1    MAKDVEAAAGHGEYAVKDYTDPPPAPLFDWEELTKWSLYRAAIAEFIAT  49



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIEG AEH   + KDY DPPP PL D +ELTKWSFYRA IAEF+AT
Sbjct  1    MAKDIEG-AEHGEFATKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVAT  48



>gb|AFO63679.1| plasma intrinsic protein 2 [Eriobotrya japonica]
Length=281

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDI--EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+K++  EG A H  KDY DPPPAPLIDFDEL +WSFYRA IAEF+AT
Sbjct  1    MSKEVSEEGQAHHHGKDYADPPPAPLIDFDELRRWSFYRAPIAEFVAT  48



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AEH   SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MTKDVE-VAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIAT  48



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AEH   SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MTKDVE-VAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIAT  48



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG    E + KDYHDPPP PL D +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVEGAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIAT  48



>ref|NP_001289999.1| aquaporin PIP2-1 [Beta vulgaris subsp. vulgaris]
 gb|ACT22630.1| plasma membrane intrinsic protein PIP2;2 [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 5/51 (10%)
 Frame = -3

Query  140  MAKDIEGTAEH-----SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  +E      S KDYHDPPPAPLID +EL KWSFYRA IAEF+AT
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVAT  51



>gb|AEY75244.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=281

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG    E + KDYHDPPP PL D +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVEGAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIAT  48



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 5/51 (10%)
 Frame = -3

Query  140  MAKDIEGTA-----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  A     E++AKDY DPPPAPLID +ELTKWS YRA IAEF+AT
Sbjct  1    MAKDIEAAAAPEGGEYTAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVAT  51



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE      E S KDY DPPPAP++DF+ELTKWS YRA IAEF+AT
Sbjct  1    MAKDIEAAPQGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVAT  49



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AEH   SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MTKDVE-VAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIAT  48



>gb|AAB67868.1| plasma membrane major intrinsic protein 1 [Beta vulgaris]
Length=288

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 5/51 (10%)
 Frame = -3

Query  140  MAKDIEGTAEH-----SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  +E      S KDYHDPPPAPLID +EL KWSFYRA IAEF+AT
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVAT  51



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = -3

Query  140  MAKDIEGTA-EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E +  E S KDYHDPPPAPLID DELT+WS YRA IAEFIAT
Sbjct  1    MTKDVETSGQEFSNKDYHDPPPAPLIDPDELTQWSLYRAIIAEFIAT  47



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/53 (72%), Positives = 40/53 (75%), Gaps = 7/53 (13%)
 Frame = -3

Query  140  MAKDIE-------GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E       G  E SAKDYHDPPPAPLIDF+EL KWSFYRA IAEFIAT
Sbjct  1    MGKDVEVAEQQGGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIAT  53



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AEH   SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MTKDVE-VAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIAT  48



>ref|XP_006367009.1| PREDICTED: probable aquaporin PIP2-2-like [Solanum tuberosum]
Length=204

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE   E++ KDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MGKDIEVGTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAT  46



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -3

Query  140  MAK-DIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK D+EG    SAKDYHDPPPAPLID  ELT+WSFYRA IAEFIAT
Sbjct  1    MAKHDVEG-GSFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIAT  46



>gb|EMT09900.1| Putative aquaporin PIP2-2 [Aegilops tauschii]
Length=315

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE      E S KDY DPPPAP++DF+ELTKWS YRA IAEF+AT
Sbjct  1    MAKDIEAAPQGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVAT  49



>gb|ABC01884.1| plasma membrane intrinsic protein PIP2-like protein [Solanum 
tuberosum]
Length=283

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDI--EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+KD+  EG   H  KDY DPPPAPL+D  ELTKWSFYRA IAEFIAT
Sbjct  1    MSKDVIEEGQVHHRGKDYVDPPPAPLLDMAELTKWSFYRAVIAEFIAT  48



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    S KDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E +AKDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVEVQESAPEFTAKDYTDPPPAPLIDPEELTKWSFYRALIAEFIAT  49



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAE---HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+ G AE   +SAKDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDM-GVAEQGSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>ref|XP_009367074.1| PREDICTED: aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=288

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIEG AEH   + KDY DPPP PL D +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDIEG-AEHGEFATKDYQDPPPTPLFDAEELTKWSFYRAVIAEFIAT  48



>ref|XP_003597235.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES67486.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E      E SAKDY DPPPAPL D DELTKWS YRA IAEF+AT
Sbjct  1    MGKDVEVQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVAT  49



>gb|ACJ85173.1| unknown [Medicago truncatula]
Length=287

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    S KDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAE---HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+ G AE   +SAKDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDM-GVAEQGSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E       SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIAT  48



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+      SAKDYHDPPPAPLID  EL KWSFYRA IAEFIAT
Sbjct  1    MTKDVPEQGSFSAKDYHDPPPAPLIDPGELAKWSFYRALIAEFIAT  46



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 2/47 (4%)
 Frame = -3

Query  140  MAK-DIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK D+EG    +AKDYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKHDVEG-GSFAAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIAT  46



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E       SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIAT  48



>ref|XP_009413716.1| PREDICTED: probable aquaporin PIP2-3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD E  G  E+  KDY DPPPAPLID +ELTKWS YRAAIAEF+AT
Sbjct  1    MAKDTEVAGRGEYGGKDYTDPPPAPLIDAEELTKWSLYRAAIAEFVAT  48



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG    E +AKDYHDPPP P  D +ELTKWSFYRA IAEF+AT
Sbjct  1    MAKDVEGAEHGEFAAKDYHDPPPTPFFDAEELTKWSFYRALIAEFVAT  48



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 41/49 (84%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAE---HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+ G AE   +SAKDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDM-GVAEQGSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>gb|AAY22203.1| putative aquaporin [Phaseolus vulgaris]
Length=285

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E     E++AKDY DPPPAPL D +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVQEQGEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIAT  48



>gb|ADJ67992.1| aquaporin [Fragaria x ananassa]
Length=285

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSAKDYHDPPPAPLFDSVELTKWSFYRAVIAEFIAT  48



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 42/49 (86%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEHS---AKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E ++EHS   AKDYHDPPPA LID DEL+KWSFYRA IAEFIAT
Sbjct  1    MAKDVE-SSEHSQFSAKDYHDPPPASLIDPDELSKWSFYRALIAEFIAT  48



>ref|XP_007207344.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
 gb|EMJ08543.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
Length=284

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 39/49 (80%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE-GTAEH--SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE G  +H  S KDY DPPPAPLID +EL +WSFYRA IAEFIAT
Sbjct  1    MAKDIEVGGGQHRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIAT  49



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            E  AE SAKDY DPPPAPL+DF+ELT+WS YRA IAEFIAT
Sbjct  10   EQAAEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIAT  50



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 35/49 (71%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGTAE---HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AE    +AKDY DPPPAPLID +ELTKWS YRA IAEFIAT
Sbjct  1    MGKDVEAAAEAGEFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIAT  49



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    SAKDYHDPPPAPLID  ELTKWSFYRA IAEF+AT
Sbjct  1    MAKDME-VAERGSFSAKDYHDPPPAPLIDSAELTKWSFYRALIAEFVAT  48



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIE---GTAEH-SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE    T EH  AKDY DPPPAPL+D +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDIEVGGNTHEHYGAKDYQDPPPAPLVDPEELTQWSFYRAIIAEFIAT  50



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E     E++AKDY DPPPAPL D +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVQEQGEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIAT  48



>gb|ACM50914.1| aquaporin [Medicago falcata]
Length=287

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E     AE +AKDY DPPPAPL D DELTKWS YRA IAEF+AT
Sbjct  1    MGKDVEVQEQGAEFTAKDYQDPPPAPLFDTDELTKWSLYRAVIAEFVAT  49



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AEH   SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MTKDVE-VAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIAT  48



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E     E++AKDY DPPPAPL D +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVQEQGEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIAT  48



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    SAKDYHDPPPAPLID  ELTKWSFYRA IAEF+AT
Sbjct  1    MAKDME-VAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVAT  48



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  G  E+  KDY DPPP PL+D +ELTKWS YRAAIAEF+AT
Sbjct  1    MAKDVEAGGRGEYGGKDYSDPPPEPLVDAEELTKWSLYRAAIAEFVAT  48



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -3

Query  140  MAK-DIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK D+EG    SAKDYHDPPPAPLID +ELT+WS YRA IAEFIAT
Sbjct  1    MAKHDVEG-GSFSAKDYHDPPPAPLIDAEELTQWSLYRALIAEFIAT  46



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E     A  SAKDYHDPPPAPL D  ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDVECADPPAGFSAKDYHDPPPAPLFDCGELTQWSFYRALIAEFIAT  49



>gb|AAV80229.1| aquaporin 2 [Aegiceras corniculatum]
Length=284

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = -3

Query  140  MAKDIE-GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE G   ++ KDY DPPPAPLID +ELTKWS YRA IAEFIAT
Sbjct  1    MAKDIEVGPGANAPKDYQDPPPAPLIDAEELTKWSLYRAVIAEFIAT  47



>ref|XP_003591905.1| Aquaporin PIP [Medicago truncatula]
Length=283

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    S KDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 37/46 (80%), Gaps = 3/46 (7%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  A    +DYHDPPPAPLID +ELT+WSFYRA IAEFIAT
Sbjct  1    MVKDVEMAA---GRDYHDPPPAPLIDSEELTQWSFYRALIAEFIAT  43



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE +     E SAKDY DPPPAPLID +ELT+WS YRA IAEFIAT
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAEELTQWSLYRAVIAEFIAT  50



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    SAKDYHDPPPAPLID  ELTKWSFYRA IAEF+AT
Sbjct  1    MAKDME-VAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVAT  48



>ref|XP_008236033.1| PREDICTED: aquaporin PIP2-7 [Prunus mume]
Length=281

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDI--EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+K++  EG A H  KDY DPPPAPLID DEL +WSFYRA IAEFIAT
Sbjct  1    MSKEVSEEGQAHHHGKDYVDPPPAPLIDSDELKRWSFYRALIAEFIAT  48



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 38/47 (81%), Gaps = 2/47 (4%)
 Frame = -3

Query  140  MAK-DIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK D EG    SAKDYHDPPPAPLID  ELT+WSFYRA IAEFIAT
Sbjct  1    MAKHDAEG-GSFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIAT  46



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  AE    S KDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDIE-VAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>gb|KDO44717.1| hypothetical protein CISIN_1g0196812mg [Citrus sinensis]
Length=256

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 37/49 (76%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD  G AEH   SAKDY DPPP PL D  ELTKWSFYRA IAEFIAT
Sbjct  51   MAKDT-GVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAT  98



>gb|AEQ20672.1| PIP2;1 [Karelinia caspia]
Length=284

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/47 (74%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = -3

Query  140  MAKDIE-GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE G  ++ AKDY DPPPA L D +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDIEVGGNDYGAKDYQDPPPAELFDAEELTKWSFYRAIIAEFIAT  47



>ref|XP_007218772.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
 gb|EMJ19971.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
Length=287

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIAT  48



>ref|XP_008233329.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=287

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIAT  48



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    S KDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>ref|XP_008359252.1| PREDICTED: aquaporin PIP2-2-like [Malus domestica]
Length=113

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 36/48 (75%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIEG    E + KDY DPP  PL D +ELTKWSFYRA IAEF+AT
Sbjct  1    MAKDIEGAEHGEFATKDYQDPPXTPLFDAEELTKWSFYRAVIAEFVAT  48



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -3

Query  110  HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            H  KDYHDPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  9    HGGKDYHDPPPAPLIDGEELTKWSFYRAVIAEFIAT  44



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE +     E SAKDY DPPPAPL+D +ELT+WS YRA IAEFIAT
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLVDAEELTQWSLYRAVIAEFIAT  50



>emb|CAB46351.1| major intrinsic protein 2 [Solanum tuberosum]
Length=286

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGT----AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M K++E      AE+S KDY DPPPAPLIDF+ELTKWS YRA IA+FIAT
Sbjct  1    MTKEVEAVHEQAAEYSRKDYTDPPPAPLIDFEELTKWSLYRAVIADFIAT  50



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG   + A+DY DPPP P  D +ELTKWS YRA IAEF+AT
Sbjct  1    MAKDVEGAEGYQARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVAT  46



>ref|XP_002311092.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK95655.1| unknown [Populus trichocarpa]
 gb|EEE88459.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=285

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD E       SAKDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDTEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>ref|XP_002532756.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF29633.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=283

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E       SAKDYHDPPPAPLID  ELTKWSFYRA IAEFIAT
Sbjct  1    MVKDMEVGERGPFSAKDYHDPPPAPLIDAVELTKWSFYRALIAEFIAT  48



>ref|XP_010555818.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 32/46 (70%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+      S KDYHDPPPAP+ D  EL KWSFYRA IAEFIAT
Sbjct  1    MAKDVAEQGSFSGKDYHDPPPAPVFDTAELGKWSFYRAVIAEFIAT  46



>ref|NP_001233846.1| putative PIP-type aquaporin [Solanum lycopersicum]
 gb|ADP23920.1| putative PIP-type aquaporin [Solanum lycopersicum]
Length=283

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDI--EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+KD+  EG A H   DY DPPPAPL+D  ELTKWSFYRA IAEFIAT
Sbjct  1    MSKDVIEEGQAHHHGSDYVDPPPAPLLDMAELTKWSFYRALIAEFIAT  48



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    S KDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 1/47 (2%)
 Frame = -3

Query  140  MAKDIE-GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E G A  +AKDY DPPPAPLID +ELTKWS YRA IAEF+AT
Sbjct  1    MGKDMEAGAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVAT  47



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD E   G     AKDY DPPP+PL D +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDFETGGGEVRDVAKDYQDPPPSPLFDMEELTKWSFYRALIAEFIAT  49



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGTAE--HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+KD+E   +  +SAKDYHDPPPA LID +EL KWSFYRA IAEFIAT
Sbjct  1    MSKDVEVAEQPAYSAKDYHDPPPARLIDMEELIKWSFYRAVIAEFIAT  48



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 4/50 (8%)
 Frame = -3

Query  140  MAKDIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE +     E SAKDY DPPPAPLID  ELT+WS YRA IAEFIAT
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAAELTQWSLYRAVIAEFIAT  50



>emb|CDX74983.1| BnaA05g07290D [Brassica napus]
Length=197

 Score = 70.9 bits (172),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG    +A+DY DPPP P  D +ELTKWS YRA IAEF+AT
Sbjct  1    MAKDVEGAEGFAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVAT  46



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 3/48 (6%)
 Frame = -3

Query  140  MAKDIEGTAEH--SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  AEH  + KDY DPPPAPLID +EL +WSFYRA IAEFIAT
Sbjct  1    MAKDIE-VAEHGETVKDYQDPPPAPLIDAEELGQWSFYRALIAEFIAT  47



>ref|XP_010554547.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+      S KDYHDPPPAPL D  EL KWSFYRA IAEFIAT
Sbjct  1    MAKDVAEHGSFSGKDYHDPPPAPLFDATELGKWSFYRALIAEFIAT  46



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE-GTAEHSA-KDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE GT +++  KDY DPPPAPLID +EL KWSFYRA IAEFIAT
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIAT  48



>emb|CAH60723.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAE---HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    SAKDYHDPPPAPL D  ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDME-VAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIAT  48



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG    +A+DY DPPP P  D +ELTKWS YRA IAEF+AT
Sbjct  1    MAKDVEGAEGFAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVAT  46



>ref|XP_009376943.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDI--EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+K++  EG A H  KDY DPPPAPL D DEL +WSFYRA IAEFIAT
Sbjct  1    MSKEVIEEGQARHHGKDYVDPPPAPLFDMDELKRWSFYRALIAEFIAT  48



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 37/46 (80%), Gaps = 2/46 (4%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AE +AKDY DPPPAPLID +EL KWS YRA IAEFIAT
Sbjct  1    MGKDVE--AEFTAKDYTDPPPAPLIDAEELAKWSLYRAVIAEFIAT  44



>ref|XP_007200557.1| hypothetical protein PRUPE_ppa009691mg [Prunus persica]
 gb|EMJ01756.1| hypothetical protein PRUPE_ppa009691mg [Prunus persica]
Length=281

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDI--EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M+K++  EG A H  KDY DPPPAPLID DEL +WSFYRA IAEFIAT
Sbjct  1    MSKEVSEEGQAHHHGKDYVDPPPAPLIDSDELKRWSFYRALIAEFIAT  48



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIE---GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E      E  AKDY+DPPPAPLID +E T+WSFYRA IAEFIAT
Sbjct  1    MAKDVEVGGQGGEFQAKDYNDPPPAPLIDAEEFTQWSFYRAIIAEFIAT  49



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGTAE---HSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E  AE    +AKDY DPPPAPLID +ELT WS YRA IAEFIAT
Sbjct  1    MGKDVEAAAEAGEFTAKDYMDPPPAPLIDVEELTTWSLYRAVIAEFIAT  49



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 39/49 (80%), Gaps = 4/49 (8%)
 Frame = -3

Query  140  MAKDIEGTAEH---SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E  AE    S KDY DPPPAPLID +ELTKWSFYRA IAEFIAT
Sbjct  1    MAKDVE-VAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIAT  48



>ref|XP_010505294.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK +EG   + A+DY DPPP P  D DELTKWS YRA IAEF+AT
Sbjct  1    MAKGVEGAEGYQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVAT  46



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG    +A+DY DPPP P  D +ELTKWS YRA IAEF+AT
Sbjct  1    MAKDVEGAEGFAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVAT  46



>ref|XP_006846771.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
 gb|ERN08352.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
Length=283

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 38/48 (79%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGT--AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E +   E +AKDY DPPPA LID +ELTKWSFYRA IAEFIAT
Sbjct  1    MGKDVEVSEQPEFTAKDYTDPPPAALIDLEELTKWSFYRALIAEFIAT  48



>ref|XP_009342858.1| PREDICTED: probable aquaporin PIP2-5 isoform X1 [Pyrus x bretschneideri]
Length=285

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE    +SAKDY D PP PLID +EL KWSFYRA IAEFIAT
Sbjct  1    MGKDIEVGGGYSAKDYQDLPPEPLIDAEELGKWSFYRAIIAEFIAT  46



>ref|NP_001274381.1| aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004145740.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004169567.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33480.1| plasma intrinsic protein 2-4 [Cucumis sativus]
 gb|KGN46837.1| hypothetical protein Csa_6G140850 [Cucumis sativus]
Length=283

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E     E  +KDY DPPPAPLID +ELTKWS YRAAIAEFIAT
Sbjct  1    MGKDVEVAEQGEFQSKDYQDPPPAPLIDPEELTKWSLYRAAIAEFIAT  48



>ref|XP_010516976.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK +EG   + A+DY DPPP P  D DELTKWS YRA IAEF+AT
Sbjct  1    MAKGVEGAEGYQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVAT  46



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 34/46 (74%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE     +AKDYHDPPP PLID +E  KWSFYRA IAEFIAT
Sbjct  1    MAKDIE-VGGFAAKDYHDPPPTPLIDPEEFGKWSFYRAIIAEFIAT  45



>dbj|BAE06148.1| PIP aquaporin isoform [Hordeum vulgare]
Length=290

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE      E++AKDY DPPPAPL D +ELTKWS YRA IAEF+AT
Sbjct  1    MAKDIEAAPPGGEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVAT  49



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 39/51 (76%), Gaps = 5/51 (10%)
 Frame = -3

Query  140  MAK-DIEGTA----EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAK DIE +     E SAKDY DPPPAPLID DELTKWS YRA IAEFIAT
Sbjct  1    MAKQDIEASGPEAGEFSAKDYTDPPPAPLIDADELTKWSLYRAVIAEFIAT  51



>gb|ABI96813.1| plasma membrane intrinsic protein [Triticum aestivum]
Length=290

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDIEGT---AEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE      E++AKDY DPPPAPL D +ELTKWS YRA IAEF+AT
Sbjct  1    MAKDIEAAPPGGEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVAT  49



>ref|XP_009342865.1| PREDICTED: probable aquaporin PIP2-5 isoform X2 [Pyrus x bretschneideri]
Length=285

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KDIE    +SAKDY D PP PLID +EL KWSFYRA IAEFIAT
Sbjct  1    MGKDIEIGGGYSAKDYQDLPPEPLIDAEELGKWSFYRAIIAEFIAT  46



>ref|XP_002446796.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
 gb|EES11124.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
Length=292

 Score = 70.9 bits (172),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 7/53 (13%)
 Frame = -3

Query  140  MAKDIEGTA-------EHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  A       E++AKDY DPPPAPL+D +ELTKWS YRA IAEF+AT
Sbjct  1    MAKDIEAAAAAHGGGGEYTAKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVAT  53



>ref|XP_008463943.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=283

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E     E  +KDY DPPPAPLID +ELTKWS YRAAIAEFIAT
Sbjct  1    MGKDVEVAEQGEFQSKDYQDPPPAPLIDPEELTKWSLYRAAIAEFIAT  48



>ref|XP_006481456.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=198

 Score = 70.1 bits (170),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGTAEHS--AKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE   E     KDYHDPPPAPLI  +ELT+WSFYRA IAEFIAT
Sbjct  1    MAKDIEVGREGEFHDKDYHDPPPAPLIGAEELTRWSFYRAIIAEFIAT  48



>ref|XP_009133124.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
 gb|AAD39374.1|AF118383_1 plasma membrane intrinsic protein 2 [Brassica napus]
 emb|CDY46758.1| BnaA03g17020D [Brassica napus]
Length=283

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG    +A+DY DPPP P  D +ELTKWS YRA IAEF+AT
Sbjct  1    MAKDVEGAEGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVAT  46



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 3/48 (6%)
 Frame = -3

Query  140  MAKDIEGTAEH--SAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE  AEH  + +DY DPPPAPLID +EL +WSFYRA IAEFIAT
Sbjct  1    MAKDIE-VAEHGETVRDYQDPPPAPLIDAEELGQWSFYRALIAEFIAT  47



>ref|XP_009133125.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
Length=285

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG    +A+DY DPPP P  D +ELT+WS YRA IAEF+AT
Sbjct  1    MAKDVEGAEGFAARDYQDPPPTPFFDAEELTRWSLYRAVIAEFVAT  46



>ref|XP_006294744.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
 gb|EOA27642.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
Length=285

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG      +DY DPPP P  D DELTKWS YRA IAEF+AT
Sbjct  1    MAKDVEGPEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVAT  46



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE-GTAEHSA-KDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKDIE GT +++  KDY DPPPAPLID +EL KWSFYRA +AEFIAT
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIVAEFIAT  48



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E     +A+DY DPPPAPL D +EL KWS YRA IAEF+AT
Sbjct  1    MAKDLEVQEGRAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVAT  46



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 3/49 (6%)
 Frame = -3

Query  140  MAKDI---EGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+   EG A  +A+DY DPPPAPL+D +EL KWS YRA IAEF+AT
Sbjct  1    MAKDLDVQEGGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVAT  49



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG    +A+DY DPPP P  D +ELTKWS YRA IAEF+AT
Sbjct  1    MAKDVEGAEGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVAT  46



>emb|CAA53478.1| plasma membrane intrinsic protein 2b [Arabidopsis thaliana]
Length=285

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+EG      +DY DPPP P  D DELTKWS YRA IAEF+AT
Sbjct  1    MAKDVEGPEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVAT  46



>gb|ABN11917.1| aquaporin [Cucurbita ficifolia]
Length=284

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  140  MAKDIEGTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD E     +AKDYHDPPPAPLID +E T+WSFYRA IAEFI T
Sbjct  1    MAKDSEAGG-FAAKDYHDPPPAPLIDVEEFTQWSFYRAIIAEFITT  45



>ref|XP_010100853.1| Aquaporin PIP2-1 [Morus notabilis]
 gb|EXB85110.1| Aquaporin PIP2-1 [Morus notabilis]
Length=287

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIEGTAEHS--AKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            M KD+E T   S  AKDYHDPPPAPL+D  EL KWSFYRA IAEF+AT
Sbjct  1    MTKDLEVTERGSFTAKDYHDPPPAPLLDSAELGKWSFYRALIAEFVAT  48



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 37/48 (77%), Gaps = 2/48 (4%)
 Frame = -3

Query  140  MAKDIE--GTAEHSAKDYHDPPPAPLIDFDELTKWSFYRAAIAEFIAT  3
            MAKD+E       SAKDY DPPPAPLID  ELTKWSFYRA IAEF+AT
Sbjct  1    MAKDMEVGERGSFSAKDYQDPPPAPLIDAAELTKWSFYRALIAEFVAT  48



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 527063832390