BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10260_g1_i1 len=1699 path=[1:0-1698]

Length=1699
                                                                      Score     E

emb|CDP00016.1|  unnamed protein product                                738   0.0      
ref|XP_004239760.1|  PREDICTED: ABC transporter G family member 6       729   0.0      
ref|XP_006361395.1|  PREDICTED: ABC transporter G family member 6...    725   0.0      
ref|XP_006345915.1|  PREDICTED: ABC transporter G family member 1...    726   0.0      
ref|XP_009796484.1|  PREDICTED: ABC transporter G family member 1...    724   0.0      
ref|XP_009626224.1|  PREDICTED: ABC transporter G family member 6       721   0.0      
ref|XP_004236771.1|  PREDICTED: ABC transporter G family member 6...    716   0.0      
ref|XP_002525084.1|  ATP-binding cassette transporter, putative         716   0.0      Ricinus communis
gb|AAR06252.1|  stigma/style ABC transporter                            711   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009767486.1|  PREDICTED: ABC transporter G family member 6...    709   0.0      
ref|XP_009597347.1|  PREDICTED: ABC transporter G family member 6...    707   0.0      
ref|XP_011027346.1|  PREDICTED: ABC transporter G family member 6...    705   0.0      
ref|XP_002315262.1|  ABC transporter family protein                     701   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010101507.1|  ABC transporter G family member 16                 701   0.0      
gb|KDP46092.1|  hypothetical protein JCGZ_06603                         699   0.0      
ref|XP_003633443.1|  PREDICTED: ABC transporter G family member 6...    699   0.0      
ref|XP_006361394.1|  PREDICTED: ABC transporter G family member 1...    697   0.0      
ref|XP_008233528.1|  PREDICTED: ABC transporter G family member 6...    693   0.0      
ref|XP_008463532.1|  PREDICTED: ABC transporter G family member 6       691   0.0      
ref|XP_010259980.1|  PREDICTED: ABC transporter G family member 6...    692   0.0      
ref|XP_004149819.1|  PREDICTED: ABC transporter G family member 1...    691   0.0      
ref|XP_011101624.1|  PREDICTED: ABC transporter G family member 1...    691   0.0      
ref|XP_007027149.1|  ABC-2 type transporter family protein              690   0.0      
ref|XP_009344892.1|  PREDICTED: ABC transporter G family member 6...    690   0.0      
ref|XP_007219556.1|  hypothetical protein PRUPE_ppa001878mg             688   0.0      
ref|XP_008354104.1|  PREDICTED: ABC transporter G family member 6...    688   0.0      
ref|XP_008370127.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    688   0.0      
ref|XP_003556547.1|  PREDICTED: ABC transporter G family member 1...    686   0.0      
ref|XP_004236770.1|  PREDICTED: ABC transporter G family member 6...    683   0.0      
ref|XP_007009605.1|  ABC-2 type transporter family protein              684   0.0      
ref|XP_010068855.1|  PREDICTED: ABC transporter G family member 6...    680   0.0      
ref|XP_010558773.1|  PREDICTED: ABC transporter G family member 6       680   0.0      
ref|XP_003592758.1|  ABC transporter G family member                    680   0.0      
ref|XP_010067225.1|  PREDICTED: ABC transporter G family member 6...    680   0.0      
ref|XP_011091494.1|  PREDICTED: ABC transporter G family member 1       677   0.0      
ref|XP_004308829.1|  PREDICTED: ABC transporter G family member 6...    677   0.0      
ref|XP_011019683.1|  PREDICTED: ABC transporter G family member 6...    675   0.0      
ref|XP_010669774.1|  PREDICTED: ABC transporter G family member 6...    674   0.0      
ref|XP_004497331.1|  PREDICTED: ABC transporter G family member 1...    674   0.0      
ref|XP_009335931.1|  PREDICTED: ABC transporter G family member 6...    671   0.0      
ref|XP_009357635.1|  PREDICTED: ABC transporter G family member 6...    671   0.0      
gb|KDO67830.1|  hypothetical protein CISIN_1g037973mg                   661   0.0      
gb|KFK25590.1|  hypothetical protein AALP_AA8G134300                    664   0.0      
ref|XP_006403679.1|  hypothetical protein EUTSA_v10010147mg             664   0.0      
ref|XP_008364101.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    664   0.0      
ref|NP_190919.1|  ABC transporter G family member 20                    662   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002277271.1|  PREDICTED: ABC transporter G family member 20      662   0.0      Vitis vinifera
ref|XP_010910345.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    660   0.0      
ref|XP_010529750.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    662   0.0      
ref|XP_002877923.1|  abc transporter family protein                     662   0.0      
ref|XP_010920754.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    662   0.0      
ref|XP_006287124.1|  hypothetical protein CARUB_v10000296mg             662   0.0      
ref|XP_007142686.1|  hypothetical protein PHAVU_007G008200g             662   0.0      
ref|XP_006399852.1|  hypothetical protein EUTSA_v10012786mg             661   0.0      
ref|XP_008793934.1|  PREDICTED: ABC transporter G family member 2...    659   0.0      
ref|XP_006436144.1|  hypothetical protein CICLE_v10030782mg             661   0.0      
ref|XP_002320112.2|  ABC transporter family protein                     659   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010492119.1|  PREDICTED: ABC transporter G family member 6       657   0.0      
ref|XP_010528237.1|  PREDICTED: ABC transporter G family member 2...    658   0.0      
ref|XP_007208058.1|  hypothetical protein PRUPE_ppa002035mg             657   0.0      
ref|XP_002301347.2|  ABC transporter family protein                     657   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009341777.1|  PREDICTED: ABC transporter G family member 2...    657   0.0      
ref|XP_002871574.1|  abc transporter family protein                     656   0.0      
gb|AIU41650.1|  ABC transporter family protein                          655   0.0      
ref|XP_006411161.1|  hypothetical protein EUTSA_v10016300mg             656   0.0      
ref|XP_011015324.1|  PREDICTED: ABC transporter G family member 2...    655   0.0      
ref|XP_010419943.1|  PREDICTED: ABC transporter G family member 6...    654   0.0      
ref|XP_010937796.1|  PREDICTED: ABC transporter G family member 6...    654   0.0      
ref|XP_008350411.1|  PREDICTED: ABC transporter G family member 2...    653   0.0      
ref|XP_010453438.1|  PREDICTED: ABC transporter G family member 6...    652   0.0      
ref|NP_196862.1|  ABC transporter G family member 6                     652   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010517003.1|  PREDICTED: ABC transporter G family member 2       653   0.0      
ref|XP_010505317.1|  PREDICTED: ABC transporter G family member 2...    652   0.0      
ref|XP_006295587.1|  hypothetical protein CARUB_v10024695mg             652   0.0      
ref|XP_008811960.1|  PREDICTED: ABC transporter G family member 2...    650   0.0      
ref|NP_181467.1|  ABC transporter G family member 1                     651   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011023380.1|  PREDICTED: ABC transporter G family member 2...    651   0.0      
ref|XP_010509348.1|  PREDICTED: ABC transporter G family member 2...    651   0.0      
emb|CDY09810.1|  BnaC09g43510D                                          651   0.0      
ref|XP_006295608.1|  hypothetical protein CARUB_v10024720mg             650   0.0      
gb|KFK36622.1|  hypothetical protein AALP_AA4G147700                    650   0.0      
ref|XP_011035805.1|  PREDICTED: ABC transporter G family member 2...    650   0.0      
emb|CDX74853.1|  BnaA05g05990D                                          645   0.0      
ref|XP_008442601.1|  PREDICTED: ABC transporter G family member 20      649   0.0      
ref|XP_009141649.1|  PREDICTED: ABC transporter G family member 2       649   0.0      
ref|XP_010253396.1|  PREDICTED: ABC transporter G family member 6...    649   0.0      
gb|EYU33174.1|  hypothetical protein MIMGU_mgv1a026904mg                649   0.0      
ref|XP_002881649.1|  abc transporter family protein                     648   0.0      
ref|XP_009121752.1|  PREDICTED: ABC transporter G family member 6       647   0.0      
emb|CDY18451.1|  BnaA04g21360D                                          647   0.0      
ref|XP_010517272.1|  PREDICTED: ABC transporter G family member 1...    647   0.0      
ref|XP_010516065.1|  PREDICTED: ABC transporter G family member 16      647   0.0      
ref|XP_008810525.1|  PREDICTED: ABC transporter G family member 6...    647   0.0      
ref|XP_010086759.1|  ABC transporter G family member 2                  647   0.0      
ref|XP_009143325.1|  PREDICTED: ABC transporter G family member 1       646   0.0      
ref|XP_002878016.1|  abc transporter family protein                     645   0.0      
ref|XP_010427003.1|  PREDICTED: ABC transporter G family member 20      645   0.0      
emb|CDX93388.1|  BnaC04g45080D                                          645   0.0      
ref|XP_009144100.1|  PREDICTED: ABC transporter G family member 1...    645   0.0      
ref|XP_010427257.1|  PREDICTED: ABC transporter G family member 1...    644   0.0      
ref|XP_010505600.1|  PREDICTED: ABC transporter G family member 1...    644   0.0      
ref|XP_010504353.1|  PREDICTED: ABC transporter G family member 1...    643   0.0      
ref|XP_006290640.1|  hypothetical protein CARUB_v10016733mg             642   0.0      
emb|CDX69629.1|  BnaA10g19780D                                          642   0.0      
ref|XP_006410918.1|  hypothetical protein EUTSA_v10016295mg             642   0.0      
ref|XP_002881504.1|  abc transporter family protein                     642   0.0      
ref|XP_010509030.1|  PREDICTED: ABC transporter G family member 1       642   0.0      
gb|KCW88884.1|  hypothetical protein EUGRSUZ_A01212                     639   0.0      
ref|XP_004168142.1|  PREDICTED: ABC transporter G family member 2...    640   0.0      
ref|XP_004493913.1|  PREDICTED: ABC transporter G family member 2...    641   0.0      
emb|CAB82704.1|  ABC transporter-like protein                           640   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006428975.1|  hypothetical protein CICLE_v10011147mg             640   0.0      
ref|XP_004137951.1|  PREDICTED: ABC transporter G family member 2...    640   0.0      
ref|XP_006480710.1|  PREDICTED: ABC transporter G family member 2...    640   0.0      
ref|NP_191069.2|  ABC transporter G family member 16                    640   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008369824.1|  PREDICTED: ABC transporter G family member 2...    639   0.0      
ref|XP_010047167.1|  PREDICTED: ABC transporter G family member 2...    640   0.0      
ref|XP_009340895.1|  PREDICTED: ABC transporter G family member 2...    639   0.0      
gb|EYU33173.1|  hypothetical protein MIMGU_mgv1a018654mg                638   0.0      
ref|XP_006292248.1|  hypothetical protein CARUB_v10018456mg             638   0.0      
ref|XP_004246729.1|  PREDICTED: ABC transporter G family member 20      639   0.0      
gb|KFK34602.1|  hypothetical protein AALP_AA5G167000                    637   0.0      
ref|XP_010504115.1|  PREDICTED: ABC transporter G family member 2...    638   0.0      
gb|KHN02392.1|  ABC transporter G family member 2                       631   0.0      
gb|KFK36827.1|  hypothetical protein AALP_AA4G176600                    636   0.0      
ref|XP_011094785.1|  PREDICTED: ABC transporter G family member 2...    636   0.0      
ref|XP_006403493.1|  hypothetical protein EUTSA_v10010146mg             636   0.0      
gb|KDP29036.1|  hypothetical protein JCGZ_16425                         635   0.0      
ref|XP_010534453.1|  PREDICTED: ABC transporter G family member 1...    635   0.0      
ref|XP_009765003.1|  PREDICTED: ABC transporter G family member 2...    635   0.0      
ref|XP_007162694.1|  hypothetical protein PHAVU_001G172400g             634   0.0      
ref|XP_008777932.1|  PREDICTED: ABC transporter G family member 6       634   0.0      
ref|XP_010515843.1|  PREDICTED: ABC transporter G family member 2...    634   0.0      
ref|XP_006345684.1|  PREDICTED: ABC transporter G family member 2...    633   0.0      
ref|NP_181272.1|  ABC transporter G family member 2                     633   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004302811.1|  PREDICTED: ABC transporter G family member 2...    631   0.0      
ref|XP_003553533.1|  PREDICTED: ABC transporter G family member 2...    631   0.0      
ref|XP_006843658.1|  hypothetical protein AMTR_s00007p00181450          630   0.0      
ref|XP_008241789.1|  PREDICTED: ABC transporter G family member 20      629   0.0      
ref|XP_009597344.1|  PREDICTED: ABC transporter G family member 2...    630   0.0      
ref|XP_003625526.1|  ABC transporter G family member                    630   0.0      
ref|XP_003520635.1|  PREDICTED: ABC transporter G family member 2...    627   0.0      
ref|XP_002525222.1|  ATP-binding cassette transporter, putative         626   0.0      Ricinus communis
ref|XP_009412596.1|  PREDICTED: ABC transporter G family member 6...    627   0.0      
ref|XP_009139200.1|  PREDICTED: ABC transporter G family member 16      624   0.0      
gb|KCW65320.1|  hypothetical protein EUGRSUZ_G02773                     624   0.0      
emb|CDX73549.1|  BnaC08g24540D                                          622   0.0      
ref|XP_009402343.1|  PREDICTED: ABC transporter G family member 6...    621   0.0      
ref|XP_011019268.1|  PREDICTED: ABC transporter G family member 20      619   0.0      
gb|KFK36825.1|  hypothetical protein AALP_AA4G176400                    619   0.0      
gb|EYU19905.1|  hypothetical protein MIMGU_mgv1a026629mg                613   0.0      
ref|XP_004984786.1|  PREDICTED: ABC transporter G family member 1...    617   0.0      
gb|ACN28499.1|  unknown                                                 613   0.0      Zea mays [maize]
ref|XP_002308489.2|  ABC transporter family protein                     612   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_001151504.1|  ATPase, coupled to transmembrane movement of...    613   0.0      Zea mays [maize]
tpg|DAA44748.1|  TPA: ATPase, coupled to transmembrane movement o...    614   0.0      
ref|XP_010684173.1|  PREDICTED: ABC transporter G family member 20      609   0.0      
ref|XP_010534454.1|  PREDICTED: ABC transporter G family member 1...    607   0.0      
emb|CDX76122.1|  BnaA04g03860D                                          624   0.0      
ref|XP_002468066.1|  hypothetical protein SORBIDRAFT_01g038970          608   0.0      Sorghum bicolor [broomcorn]
emb|CDY02906.1|  BnaC04g25800D                                          623   0.0      
emb|CBI25312.3|  unnamed protein product                                600   0.0      
ref|XP_009406965.1|  PREDICTED: ABC transporter G family member 6...    603   0.0      
gb|EYU41661.1|  hypothetical protein MIMGU_mgv1a002205mg                599   0.0      
ref|XP_010504355.1|  PREDICTED: ABC transporter G family member 1...    597   0.0      
ref|XP_010427259.1|  PREDICTED: ABC transporter G family member 18      595   0.0      
gb|KFK36824.1|  hypothetical protein AALP_AA4G176300                    593   0.0      
dbj|BAJ97356.1|  predicted protein                                      594   0.0      
ref|XP_006290668.1|  hypothetical protein CARUB_v10016759mg             592   0.0      
ref|NP_191071.1|  ABC transporter G family member 18                    592   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003558198.1|  PREDICTED: ABC transporter G family member 1...    594   0.0      
dbj|BAF00471.1|  ABC transporter - like protein                         591   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KFK36826.1|  hypothetical protein AALP_AA4G176500                    590   0.0      
ref|XP_002878018.1|  abc transporter family protein                     591   0.0      
gb|ACN28998.1|  unknown                                                 581   0.0      Zea mays [maize]
ref|XP_003561756.1|  PREDICTED: ABC transporter G family member 6...    591   0.0      
emb|CDX67624.1|  BnaA07g16640D                                          587   0.0      
gb|AEP23076.1|  ATP-binding cassette protein subfamily G member 5       590   0.0      
ref|XP_009103951.1|  PREDICTED: ABC transporter G family member 1...    585   0.0      
ref|XP_008657087.1|  PREDICTED: ABC transporter G family member 1...    587   0.0      
ref|XP_008674853.1|  PREDICTED: ABC transporter G family member 16      587   0.0      
sp|B8ALI0.1|AB5G_ORYSI  RecName: Full=ABC transporter G family me...    586   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001049746.1|  Os03g0281900                                       586   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ26488.1|  hypothetical protein OsJ_10380                          579   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EMS46278.1|  ABC transporter G family member 16                      583   0.0      
ref|XP_006649877.1|  PREDICTED: ABC transporter G family member 6...    583   0.0      
ref|XP_002456598.1|  hypothetical protein SORBIDRAFT_03g039110          583   0.0      Sorghum bicolor [broomcorn]
ref|XP_009139198.1|  PREDICTED: ABC transporter G family member 1...    580   0.0      
emb|CDM84867.1|  unnamed protein product                                582   0.0      
ref|XP_007027150.1|  ABC transporter G family member 2                  578   0.0      
ref|XP_004987055.1|  PREDICTED: ABC transporter G family member 1...    580   0.0      
ref|XP_010504358.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    578   0.0      
gb|AAN64479.1|  putative ATP-binding-cassette transporter protein       578   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY89510.1|  hypothetical protein OsI_11045                          578   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006292173.1|  hypothetical protein CARUB_v10018379mg             577   0.0      
ref|XP_006644973.1|  PREDICTED: ABC transporter G family member 1...    572   0.0      
ref|XP_006403491.1|  hypothetical protein EUTSA_v10010159mg             575   0.0      
gb|EEE62138.1|  hypothetical protein OsJ_16925                          574   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004970499.1|  PREDICTED: ABC transporter G family member 1...    576   0.0      
ref|XP_003564558.1|  PREDICTED: ABC transporter G family member 6...    576   0.0      
ref|XP_010504354.1|  PREDICTED: ABC transporter G family member 1...    572   0.0      
gb|EAY96335.1|  hypothetical protein OsI_18238                          573   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010427258.1|  PREDICTED: ABC transporter G family member 17      572   0.0      
ref|XP_010516068.1|  PREDICTED: ABC transporter G family member 1...    573   0.0      
ref|XP_004960311.1|  PREDICTED: ABC transporter G family member 1...    572   0.0      
ref|XP_010427269.1|  PREDICTED: ABC transporter G family member 1...    573   0.0      
ref|XP_003569021.1|  PREDICTED: ABC transporter G family member 1       573   0.0      
ref|XP_010516066.1|  PREDICTED: ABC transporter G family member 1...    571   0.0      
ref|NP_001054490.2|  Os05g0120200                                       574   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002878020.1|  hypothetical protein ARALYDRAFT_906929             573   0.0      
gb|EMT08074.1|  ABC transporter G family member 16                      572   0.0      
ref|XP_007027151.1|  ABC transporter G family member 2                  572   0.0      
dbj|BAA90508.1|  unnamed protein product                                572   0.0      Oryza sativa [red rice]
ref|NP_191070.1|  ABC transporter G family member 17                    569   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX73404.1|  BnaC08g25990D                                          573   0.0      
ref|XP_009116211.1|  PREDICTED: ABC transporter G family member 1...    570   0.0      
ref|NP_191073.1|  ABC transporter G family member 19                    570   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503151.1|  PREDICTED: ABC transporter G family member 1...    569   0.0      
emb|CDY40201.1|  BnaA09g34830D                                          568   0.0      
gb|ABB97036.1|  ABC transporter-like protein                            567   0.0      Brassica rapa
ref|XP_006292545.1|  hypothetical protein CARUB_v10018780mg             565   0.0      
emb|CDY65003.1|  BnaAnng19960D                                          566   0.0      
ref|XP_004960315.1|  PREDICTED: ABC transporter G family member 1...    565   0.0      
ref|XP_010430990.1|  PREDICTED: ABC transporter G family member 1...    573   0.0      
ref|NP_001044732.1|  Os01g0836600                                       567   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY76412.1|  hypothetical protein OsI_04343                          567   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001145981.1|  uncharacterized protein LOC100279509               565   0.0      Zea mays [maize]
ref|XP_002440493.1|  hypothetical protein SORBIDRAFT_09g001900          564   0.0      Sorghum bicolor [broomcorn]
ref|XP_002878017.1|  abc transporter family protein                     561   0.0      
ref|XP_008648601.1|  PREDICTED: ABC transporter G family member 16      563   0.0      
ref|XP_006480523.1|  PREDICTED: ABC transporter G family member 2...    561   0.0      
ref|XP_010068854.1|  PREDICTED: ABC transporter G family member 6...    560   0.0      
ref|XP_006428968.1|  hypothetical protein CICLE_v10011234mg             560   0.0      
ref|XP_006403492.1|  hypothetical protein EUTSA_v10010176mg             558   0.0      
ref|XP_006651261.1|  PREDICTED: ABC transporter G family member 1...    563   0.0      
ref|XP_009124228.1|  PREDICTED: ABC transporter G family member 1...    560   0.0      
dbj|BAJ94806.1|  predicted protein                                      556   0.0      
ref|XP_009139199.1|  PREDICTED: ABC transporter G family member 17      555   0.0      
emb|CDY37656.1|  BnaC04g29980D                                          556   0.0      
ref|XP_006403489.1|  hypothetical protein EUTSA_v10010975mg             556   0.0      
ref|XP_002439184.1|  hypothetical protein SORBIDRAFT_09g001940          553   0.0      Sorghum bicolor [broomcorn]
ref|XP_010516067.1|  PREDICTED: ABC transporter G family member 1...    553   0.0      
ref|XP_002312057.2|  hypothetical protein POPTR_0008s04780g             549   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006379565.1|  hypothetical protein POPTR_0008s047701g            537   0.0      
gb|EMT27092.1|  ABC transporter G family member 1                       543   0.0      
gb|EAY96333.1|  hypothetical protein OsI_18236                          547   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001054488.2|  Os05g0120000                                       547   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010096686.1|  ABC transporter G family member 6                  546   0.0      
ref|XP_009139197.1|  PREDICTED: ABC transporter G family member 19      540   0.0      
ref|XP_007027152.1|  ABC transporter G family member 2                  538   0.0      
ref|XP_009403872.1|  PREDICTED: ABC transporter G family member 2...    540   0.0      
ref|XP_006654931.1|  PREDICTED: ABC transporter G family member 1...    531   2e-180   
gb|KDO47516.1|  hypothetical protein CISIN_1g048028mg                   534   2e-180   
gb|EMS52133.1|  ABC transporter G family member 1                       536   4e-180   
gb|EPS67070.1|  abc transporter family protein                          534   5e-179   
ref|XP_006292174.1|  hypothetical protein CARUB_v10018380mg             535   7e-179   
ref|XP_003561649.2|  PREDICTED: ABC transporter G family member 1...    532   5e-178   
ref|XP_009403873.1|  PREDICTED: ABC transporter G family member 1...    527   2e-176   
ref|XP_009787941.1|  PREDICTED: ABC transporter G family member 2...    524   3e-175   
dbj|BAA90507.1|  unnamed protein product                                522   6e-175   Oryza sativa [red rice]
gb|KDO42779.1|  hypothetical protein CISIN_1g007474mg                   520   1e-174   
ref|XP_006428973.1|  hypothetical protein CICLE_v10013485mg             520   2e-173   
emb|CBI32651.3|  unnamed protein product                                514   3e-172   
gb|EMS46245.1|  ABC transporter G family member 16                      502   1e-169   
emb|CDY02907.1|  BnaC04g25790D                                          506   7e-169   
emb|CDM80772.1|  unnamed protein product                                507   1e-168   
gb|EMT28272.1|  ABC transporter G family member 16                      497   3e-168   
emb|CDX76119.1|  BnaA04g03830D                                          503   5e-167   
ref|XP_006480709.1|  PREDICTED: ABC transporter G family member 2...    494   5e-163   
ref|XP_006428974.1|  hypothetical protein CICLE_v10011167mg             494   5e-163   
dbj|BAJ96842.1|  predicted protein                                      490   4e-162   
ref|XP_010412783.1|  PREDICTED: ABC transporter G family member 1...    493   2e-161   
ref|XP_002971450.1|  hypothetical protein SELMODRAFT_95523              492   3e-161   
ref|XP_002966047.1|  ATP-binding cassette transporter                   489   2e-160   
ref|XP_010427270.1|  PREDICTED: ABC transporter G family member 1...    482   3e-159   
ref|XP_010686386.1|  PREDICTED: ABC transporter G family member 2...    468   3e-153   
gb|EMS61049.1|  ABC transporter G family member 16                      447   7e-149   
gb|KDO42780.1|  hypothetical protein CISIN_1g036088mg                   454   2e-147   
ref|XP_010431371.1|  PREDICTED: ABC transporter G family member 1...    445   1e-146   
gb|KCW65322.1|  hypothetical protein EUGRSUZ_G027752                    439   2e-143   
emb|CDY44641.1|  BnaC04g06210D                                          426   2e-142   
ref|XP_009116043.1|  PREDICTED: ABC transporter G family member 20      426   2e-142   
ref|XP_001767039.1|  ATP-binding cassette transporter, subfamily ...    437   4e-142   
gb|AAR06253.1|  stigma/style ABC transporter                            429   1e-139   
gb|EPS65094.1|  hypothetical protein M569_09685                         419   8e-136   
ref|XP_010095941.1|  ABC transporter G family member 16                 413   6e-132   
gb|EMT16368.1|  ABC transporter G family member 2                       387   3e-127   
dbj|BAC42186.1|  putative ABC transporter                               379   1e-124   
gb|EMT29324.1|  ABC transporter G family member 16                      376   1e-120   
ref|XP_010095943.1|  ABC transporter G family member 2                  366   3e-117   
ref|XP_006478358.1|  PREDICTED: ABC transporter G family member 2...    363   6e-114   
emb|CDP00014.1|  unnamed protein product                                363   2e-113   
dbj|BAJ94640.1|  predicted protein                                      351   2e-112   
ref|XP_010096689.1|  ABC transporter G family member 16                 356   2e-111   
gb|AAS76671.1|  WBC1 ABC transporter                                    329   6e-106   
emb|CDX76121.1|  BnaA04g03850D                                          310   5e-95    
gb|AEP23077.1|  ATP-binding cassette protein subfamily G member 6       307   1e-91    
ref|XP_009139358.1|  PREDICTED: ABC transporter G family member 1...    297   2e-90    
emb|CBI15591.3|  unnamed protein product                                300   7e-89    
ref|XP_002321525.2|  hypothetical protein POPTR_0015s04860g             293   2e-86    
ref|XP_002991813.1|  ATP-binding cassette transporter                   287   7e-84    
dbj|BAD28517.1|  putative white pigment protein                         284   4e-82    
emb|CDY02909.1|  BnaC04g25770D                                          276   4e-81    
ref|XP_002973980.1|  hypothetical protein SELMODRAFT_100089             277   2e-80    
ref|XP_001763780.1|  ATP-binding cassette transporter, subfamily ...    271   9e-80    
ref|XP_002969083.1|  ATP-binding cassette transporter                   274   4e-79    
gb|KDO78699.1|  hypothetical protein CISIN_1g039035mg                   271   1e-78    
ref|XP_006856623.1|  hypothetical protein AMTR_s00046p00226870          264   5e-75    
ref|XP_001764842.1|  ATP-binding cassette transporter, subfamily ...    241   2e-68    
gb|EPS59916.1|  abc transporter family protein                          226   3e-67    
gb|EMS58412.1|  ABC transporter G family member 1                       232   3e-67    
ref|XP_001764895.1|  ATP-binding cassette transporter, subfamily ...    236   4e-66    
ref|XP_004147363.1|  PREDICTED: ABC transporter G family member 5...    236   2e-65    
ref|XP_008460882.1|  PREDICTED: ABC transporter G family member 5       236   2e-65    
ref|XP_001775040.1|  ATP-binding cassette transporter, subfamily ...    233   2e-65    
gb|AIU41646.1|  ABC transporter family protein                          232   5e-64    
ref|XP_002970307.1|  ATP-binding cassette transporter                   230   2e-63    
gb|KGN62206.1|  hypothetical protein Csa_2G335550                       230   3e-63    
ref|XP_002978471.1|  hypothetical protein SELMODRAFT_109153             228   8e-63    
ref|XP_006348289.1|  PREDICTED: ABC transporter G family member 1...    228   1e-62    
gb|KDP39428.1|  hypothetical protein JCGZ_03710                         228   1e-62    
gb|KFK26886.1|  hypothetical protein AALP_AA8G306400                    227   2e-62    
ref|XP_008451772.1|  PREDICTED: ABC transporter G family member 10      228   2e-62    
ref|XP_010324385.1|  PREDICTED: ABC transporter G family member 10      227   4e-62    
ref|XP_004137243.1|  PREDICTED: ABC transporter G family member 1...    225   1e-61    
ref|XP_004156505.1|  PREDICTED: ABC transporter G family member 1...    224   2e-61    
ref|XP_011006501.1|  PREDICTED: ABC transporter G family member 1...    224   2e-61    
ref|XP_008227400.1|  PREDICTED: ABC transporter G family member 5       225   3e-61    
ref|XP_011099722.1|  PREDICTED: ABC transporter G family member 5       224   4e-61    
ref|XP_010680229.1|  PREDICTED: ABC transporter G family member 5       224   5e-61    
ref|XP_002274622.1|  PREDICTED: ABC transporter G family member 5       224   5e-61    
ref|XP_010448382.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    223   6e-61    
ref|XP_007214262.1|  hypothetical protein PRUPE_ppa024858mg             223   2e-60    
ref|XP_003522483.1|  PREDICTED: ABC transporter G family member 5...    222   2e-60    
gb|KHN31160.1|  ABC transporter G family member 5                       222   3e-60    
ref|XP_004288110.1|  PREDICTED: ABC transporter G family member 5...    221   4e-60    
ref|XP_006451720.1|  hypothetical protein CICLE_v10010503mg             221   4e-60    
ref|NP_194305.1|  ABC transporter G family member 4                     220   4e-60    
ref|XP_006485827.1|  PREDICTED: ABC transporter G family member 1...    221   5e-60    
ref|NP_200098.1|  ABC transporter G family member 8                     220   6e-60    
ref|XP_006283410.1|  hypothetical protein CARUB_v10004458mg             219   7e-60    
ref|XP_006281494.1|  hypothetical protein CARUB_v10027587mg             220   7e-60    
ref|XP_010027639.1|  PREDICTED: ABC transporter G family member 5...    221   8e-60    
gb|KDO50720.1|  hypothetical protein CISIN_1g006505mg                   221   8e-60    
gb|KHN34087.1|  ABC transporter G family member 5                       221   9e-60    
gb|KEH38631.1|  white-brown-complex ABC transporter family protein      220   9e-60    
ref|XP_009619739.1|  PREDICTED: ABC transporter G family member 1...    220   9e-60    
ref|XP_001775079.1|  ATP-binding cassette transporter, subfamily ...    221   9e-60    
ref|XP_003525127.1|  PREDICTED: ABC transporter G family member 5...    221   9e-60    
ref|XP_010027638.1|  PREDICTED: ABC transporter G family member 5...    220   9e-60    
ref|XP_006432169.1|  hypothetical protein CICLE_v10000557mg             220   1e-59    
ref|XP_010060079.1|  PREDICTED: ABC transporter G family member 4...    220   1e-59    
ref|XP_010442831.1|  PREDICTED: ABC transporter G family member 8       219   1e-59    
ref|XP_006584647.1|  PREDICTED: ABC transporter G family member 5...    220   1e-59    
ref|XP_010276664.1|  PREDICTED: ABC transporter G family member 8...    219   1e-59    
gb|KFK39940.1|  hypothetical protein AALP_AA3G309600                    220   1e-59    
ref|XP_010260431.1|  PREDICTED: ABC transporter G family member 5...    220   1e-59    
ref|XP_006446771.1|  hypothetical protein CICLE_v10017566mg             219   1e-59    
ref|XP_011029552.1|  PREDICTED: ABC transporter G family member 1...    219   2e-59    
ref|XP_002867592.1|  abc transporter family protein                     218   2e-59    
ref|XP_006401773.1|  hypothetical protein EUTSA_v10013050mg             219   2e-59    
ref|XP_009766560.1|  PREDICTED: ABC transporter G family member 1...    219   2e-59    
ref|XP_003630284.1|  ABC transporter G family member                    219   2e-59    
ref|XP_002865932.1|  abc transporter family protein                     219   2e-59    
ref|XP_006469126.1|  PREDICTED: ABC transporter G family member 1...    219   3e-59    
ref|XP_009342292.1|  PREDICTED: ABC transporter G family member 1...    218   3e-59    
gb|EYU23735.1|  hypothetical protein MIMGU_mgv1a027025mg                219   3e-59    
ref|XP_011022930.1|  PREDICTED: ABC transporter G family member 5...    219   3e-59    
gb|KDO56854.1|  hypothetical protein CISIN_1g007383mg                   218   3e-59    
emb|CDY27043.1|  BnaA02g10630D                                          218   3e-59    
gb|KDO63336.1|  hypothetical protein CISIN_1g044112mg                   218   4e-59    
ref|XP_007048427.1|  ABC-2 type transporter family protein              219   4e-59    
ref|XP_010474041.1|  PREDICTED: ABC transporter G family member 8...    218   4e-59    
ref|XP_006490601.1|  PREDICTED: ABC transporter G family member 8...    218   5e-59    
ref|XP_006422082.1|  hypothetical protein CICLE_v10004505mg             218   7e-59    
ref|XP_006590207.1|  PREDICTED: ABC transporter G family member 8...    217   1e-58    
ref|XP_007159853.1|  hypothetical protein PHAVU_002G273300g             217   2e-58    
ref|XP_009127210.1|  PREDICTED: ABC transporter G family member 8       216   2e-58    
ref|XP_002309921.2|  hypothetical protein POPTR_0007s04270g             217   3e-58    
ref|XP_006300140.1|  hypothetical protein CARUB_v10016369mg             216   3e-58    
ref|XP_004503928.1|  PREDICTED: ABC transporter G family member 5...    216   4e-58    
ref|XP_002306254.2|  ABC transporter family protein                     216   4e-58    
gb|EYU25163.1|  hypothetical protein MIMGU_mgv1a003070mg                215   5e-58    
ref|XP_010482662.1|  PREDICTED: ABC transporter G family member 8...    214   6e-58    
ref|XP_009136218.1|  PREDICTED: ABC transporter G family member 5       216   6e-58    
ref|XP_008226519.1|  PREDICTED: ABC transporter G family member 10      215   7e-58    
ref|XP_009335188.1|  PREDICTED: ABC transporter G family member 1...    214   7e-58    
ref|XP_002456777.1|  hypothetical protein SORBIDRAFT_03g042560          216   8e-58    
emb|CDX93119.1|  BnaA03g38410D                                          214   9e-58    
ref|XP_002516304.1|  ATP-binding cassette transporter, putative         214   9e-58    
ref|XP_010090828.1|  ABC transporter G family member 5                  215   1e-57    
ref|XP_010527096.1|  PREDICTED: ABC transporter G family member 5       215   1e-57    
emb|CDX89610.1|  BnaC03g45240D                                          214   1e-57    
ref|XP_009355839.1|  PREDICTED: ABC transporter G family member 5       215   2e-57    
ref|XP_008382071.1|  PREDICTED: ABC transporter G family member 10      214   2e-57    
ref|XP_010911492.1|  PREDICTED: ABC transporter G family member 5       215   2e-57    
ref|XP_008348825.1|  PREDICTED: ABC transporter G family member 1...    213   2e-57    
ref|XP_011031169.1|  PREDICTED: ABC transporter G family member 5       214   2e-57    
ref|XP_010555696.1|  PREDICTED: ABC transporter G family member 8...    214   2e-57    
gb|EPS58594.1|  hypothetical protein M569_16219                         212   3e-57    
ref|XP_007212414.1|  hypothetical protein PRUPE_ppa016488mg             213   3e-57    
ref|XP_006852446.1|  hypothetical protein AMTR_s00021p00104980          213   3e-57    
ref|XP_002317467.1|  ABC transporter family protein                     213   4e-57    
ref|XP_010521368.1|  PREDICTED: ABC transporter G family member 8...    213   4e-57    
ref|XP_011076083.1|  PREDICTED: ABC transporter G family member 8...    212   5e-57    
ref|XP_006409681.1|  hypothetical protein EUTSA_v10022588mg             213   8e-57    
ref|XP_002891739.1|  abc transporter family protein                     211   8e-57    
ref|XP_010108255.1|  ABC transporter G family member 10                 212   1e-56    
ref|XP_010062803.1|  PREDICTED: ABC transporter G family member 10      211   1e-56    
ref|XP_002285381.1|  PREDICTED: ABC transporter G family member 10      211   1e-56    
emb|CAN66605.1|  hypothetical protein VITISV_017552                     211   1e-56    
ref|XP_003592180.1|  ABC transporter G family member                    211   1e-56    
ref|XP_010467187.1|  PREDICTED: ABC transporter G family member 5...    212   2e-56    
ref|XP_010671584.1|  PREDICTED: ABC transporter G family member 8       211   2e-56    
ref|XP_010488858.1|  PREDICTED: ABC transporter G family member 5       211   2e-56    
ref|XP_008663764.1|  PREDICTED: ABC transporter G family member 5       213   2e-56    
emb|CDX96159.1|  BnaC02g14920D                                          210   3e-56    
ref|XP_007021688.1|  White-brown-complex ABC transporter family         211   3e-56    
ref|XP_008810921.1|  PREDICTED: ABC transporter G family member 5       211   3e-56    
ref|XP_006376343.1|  hypothetical protein POPTR_0013s12200g             210   3e-56    
ref|XP_003602630.1|  ABC transporter G family member                    211   4e-56    
ref|NP_178984.1|  ABC transporter G family member 5                     211   4e-56    
ref|XP_010479884.1|  PREDICTED: ABC transporter G family member 1...    209   4e-56    
ref|XP_008361085.1|  PREDICTED: ABC transporter G family member 5...    211   5e-56    
ref|XP_006581771.1|  PREDICTED: ABC transporter G family member 5...    210   5e-56    
ref|XP_006307076.1|  hypothetical protein CARUB_v10008662mg             209   6e-56    
ref|XP_010270351.1|  PREDICTED: ABC transporter G family member 5...    210   7e-56    
ref|NP_175734.1|  ABC transporter G family member 10                    209   7e-56    
ref|XP_003566887.1|  PREDICTED: ABC transporter G family member 10      209   9e-56    
ref|XP_002276422.1|  PREDICTED: ABC transporter G family member 10      209   1e-55    
ref|XP_011100210.1|  PREDICTED: ABC transporter G family member 1...    208   1e-55    
ref|XP_010526988.1|  PREDICTED: ABC transporter G family member 5...    209   1e-55    
ref|XP_002967773.1|  ATP-binding cassette transporter                   208   1e-55    
gb|ACG29639.1|  ATPase, coupled to transmembrane movement of subs...    209   2e-55    
ref|XP_009786358.1|  PREDICTED: ABC transporter G family member 1...    208   2e-55    
gb|AFW77835.1|  ATPase, coupled to transmembrane movement of subs...    209   2e-55    
emb|CBJ30358.1|  conserved unknown protein                              208   3e-55    
ref|XP_009106985.1|  PREDICTED: ABC transporter G family member 10      207   3e-55    
gb|AFG66500.1|  hypothetical protein 0_12721_01                         193   4e-55    
ref|XP_009594606.1|  PREDICTED: ABC transporter G family member 8...    207   4e-55    
emb|CAO94661.1|  ATP Binding Cassette Transporter (CrWBC1)              207   6e-55    
ref|XP_004496513.1|  PREDICTED: ABC transporter G family member 4...    206   7e-55    
emb|CDY02908.1|  BnaC04g25780D                                          193   8e-55    
ref|XP_010675410.1|  PREDICTED: ABC transporter G family member 10      206   9e-55    
ref|XP_002992644.1|  hypothetical protein SELMODRAFT_135648             206   9e-55    
ref|XP_007143484.1|  hypothetical protein PHAVU_007G075700g             206   1e-54    
ref|XP_010462208.1|  PREDICTED: ABC transporter G family member 1...    206   1e-54    
emb|CAN60804.1|  hypothetical protein VITISV_020682                     207   1e-54    
ref|XP_009611306.1|  PREDICTED: ABC transporter G family member 1...    206   1e-54    
ref|XP_008234817.1|  PREDICTED: ABC transporter G family member 4       206   1e-54    
ref|XP_004502947.1|  PREDICTED: ABC transporter G family member 5...    206   1e-54    
ref|XP_001769263.1|  ATP-binding cassette transporter, subfamily ...    205   2e-54    
ref|XP_004959919.1|  PREDICTED: ABC transporter G family member 5...    206   2e-54    
gb|AFG66497.1|  hypothetical protein 0_12721_01                         192   2e-54    
ref|XP_010924121.1|  PREDICTED: ABC transporter G family member 1...    205   2e-54    
gb|KHN46645.1|  ABC transporter G family member 23                      203   2e-54    
gb|KDP31788.1|  hypothetical protein JCGZ_12249                         205   2e-54    
ref|XP_008227284.1|  PREDICTED: ABC transporter G family member 23      206   2e-54    
emb|CDY59400.1|  BnaC03g78180D                                          204   2e-54    
ref|XP_002885884.1|  abc transporter family protein                     205   3e-54    
emb|CDX94418.1|  BnaC01g17660D                                          204   3e-54    
ref|XP_004289783.1|  PREDICTED: ABC transporter G family member 8...    203   8e-54    
ref|XP_007221106.1|  hypothetical protein PRUPE_ppa017858mg             203   9e-54    
ref|XP_003556918.1|  PREDICTED: ABC transporter G family member 2...    204   1e-53    
ref|XP_010923191.1|  PREDICTED: ABC transporter G family member 1...    203   1e-53    
ref|XP_001769607.1|  ATP-binding cassette transporter, subfamily ...    202   1e-53    
ref|XP_010527510.1|  PREDICTED: ABC transporter G family member 10      202   1e-53    
ref|XP_006413276.1|  hypothetical protein EUTSA_v10026876mg             202   1e-53    
ref|NP_001148099.1|  ATPase, coupled to transmembrane movement of...    204   2e-53    
ref|XP_007212910.1|  hypothetical protein PRUPE_ppa022225mg             203   2e-53    
emb|CDX89396.1|  BnaA01g14970D                                          202   2e-53    
ref|XP_010105723.1|  ABC transporter G family member 8                  202   2e-53    
ref|XP_009139481.1|  PREDICTED: ABC transporter G family member 4       202   2e-53    
ref|XP_007048669.1|  White-brown-complex ABC transporter family         202   2e-53    
emb|CBI21607.3|  unnamed protein product                                200   2e-53    
ref|XP_002441022.1|  hypothetical protein SORBIDRAFT_09g019010          203   2e-53    
ref|XP_011047752.1|  PREDICTED: ABC transporter G family member 4...    202   3e-53    
ref|XP_009415757.1|  PREDICTED: ABC transporter G family member 5...    202   4e-53    
gb|EMS61215.1|  ABC transporter G family member 19                      204   5e-53    
gb|AFG66498.1|  hypothetical protein 0_12721_01                         188   5e-53    
ref|XP_006374284.1|  ABC transporter family protein                     201   5e-53    
ref|XP_009414604.1|  PREDICTED: ABC transporter G family member 5...    202   5e-53    
ref|XP_003609516.1|  ABC transporter G family member                    201   6e-53    
ref|XP_011038229.1|  PREDICTED: ABC transporter G family member 1...    201   7e-53    
ref|XP_008803919.1|  PREDICTED: ABC transporter G family member 1...    203   7e-53    
dbj|BAJ90696.1|  predicted protein                                      202   7e-53    
dbj|BAJ90968.1|  predicted protein                                      201   8e-53    
gb|AFW85307.1|  ATPase, coupled to transmembrane movement of subs...    201   9e-53    
ref|XP_009360169.1|  PREDICTED: ABC transporter G family member 1...    200   1e-52    
ref|XP_006646099.1|  PREDICTED: ABC transporter G family member 1...    198   1e-52    
ref|XP_004962233.1|  PREDICTED: ABC transporter G family member 2...    201   1e-52    
ref|XP_004301505.1|  PREDICTED: ABC transporter G family member 2...    201   2e-52    
emb|CDP03494.1|  unnamed protein product                                202   2e-52    
ref|XP_008393442.1|  PREDICTED: ABC transporter G family member 1...    201   2e-52    
ref|XP_007210016.1|  hypothetical protein PRUPE_ppa016313mg             201   2e-52    
ref|XP_010087013.1|  ABC transporter G family member 16                 201   2e-52    
ref|XP_006653927.1|  PREDICTED: ABC transporter G family member 5...    200   2e-52    
ref|XP_004301244.1|  PREDICTED: ABC transporter G family member 1...    201   3e-52    
dbj|BAJ87640.1|  predicted protein                                      200   3e-52    
ref|XP_009356016.1|  PREDICTED: ABC transporter G family member 1...    201   3e-52    



>emb|CDP00016.1| unnamed protein product [Coffea canephora]
Length=726

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/480 (78%), Positives = 409/480 (85%), Gaps = 9/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG TVY
Sbjct  247   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRLIFLSRGHTVY  306

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW--------  1279
             +G P NLPQF +DFGH +PE +NR EFALDLIRELEGSP GT+SLVEF+R W        
Sbjct  307   SGPPTNLPQFFADFGHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNRTWQNMKRGTN  366

Query  1278  SGGRNSEPATAVHNLSLKEAISASVSQGKLVSGATN-DANPVSSVPAYANSLWTEMAVLS  1102
             + G  +  ++  H LSLKEAISAS+S+GKLVSGATN DA+P S VP YAN  W EMAVLS
Sbjct  367   TAGTGNVESSPTHGLSLKEAISASISRGKLVSGATNTDASPTSMVPRYANPFWIEMAVLS  426

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
             KRSFTN RRMPE+ G R G V VTGFILATMFWR+DNSPKGIQERLGFFAFAMSTTFYTC
Sbjct  427   KRSFTNSRRMPELFGIRCGAVMVTGFILATMFWRLDNSPKGIQERLGFFAFAMSTTFYTC  486

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
             AD LPVF+QERYIF+RETAHNAYRR SYCLSHALVS P L+ L+  F+A TFW+ GL GG
Sbjct  487   ADALPVFLQERYIFMRETAHNAYRRISYCLSHALVSLPALIFLSFAFAAITFWSVGLDGG  546

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
             T+GFFFY+AIILASFWAGNSFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP
Sbjct  547   TSGFFFYFAIILASFWAGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIP  606

Query  561   LYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
              YWIWFHYISL+KYPYEAVLQNEF+DP KCFVRG Q+FD TPL AVP +LK KLL +M  
Sbjct  607   PYWIWFHYISLVKYPYEAVLQNEFDDPAKCFVRGIQIFDSTPLGAVPDSLKIKLLASMSN  666

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TL V+ITSSTCVTTG DIL  QGVTDL+KW CLWIT+AWGF FRILFYFSLLLGS+NKRR
Sbjct  667   TLGVKITSSTCVTTGVDILKQQGVTDLTKWACLWITIAWGFFFRILFYFSLLLGSKNKRR  726



>ref|XP_004239760.1| PREDICTED: ABC transporter G family member 6 [Solanum lycopersicum]
Length=750

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/477 (76%), Positives = 410/477 (86%), Gaps = 6/477 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDR++ LSRG+TVY
Sbjct  274   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMLFLSRGQTVY  333

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR----  1267
             +GSP+NLP F +DFGH +P+ +NR EFALDLIRELEGSP GTKSLVEF++ W   +    
Sbjct  334   SGSPMNLPHFFADFGHPIPDSENRTEFALDLIRELEGSPGGTKSLVEFNKTWENTKRSNE  393

Query  1266  NSEPATAVHNLSLKEAISASVSQGKLVSGATND--ANPVSSVPAYANSLWTEMAVLSKRS  1093
             NSE  T  H L+LKEAISAS+S+GKLVSG T+D   +P S VP YAN  W EM VLSKRS
Sbjct  394   NSEMLTPTHGLTLKEAISASISRGKLVSGTTSDIHTSPASMVPTYANPFWIEMVVLSKRS  453

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
             FTN  R+PE+ G RLG + VTGFILATMFW++D+SPKG+QERLGFFAFAMSTTFYTCAD 
Sbjct  454   FTNSWRVPELFGIRLGAIVVTGFILATMFWQLDDSPKGVQERLGFFAFAMSTTFYTCADA  513

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVF+QERYIF+RETA+NAYRRSSYCLSHALVS P L+ L+  F+A TFWA GL GG  G
Sbjct  514   LPVFLQERYIFMRETAYNAYRRSSYCLSHALVSLPALIFLSFAFAAITFWAVGLEGGFLG  573

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F FY+AIILASFWAGNSFVTFLS VVP VML Y +VVAILAYFLLFSGFF+NR RIP YW
Sbjct  574   FLFYFAIILASFWAGNSFVTFLSGVVPSVMLGYTIVVAILAYFLLFSGFFINRDRIPPYW  633

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHY+SL+KYPYEAVLQNEF+DPTKCFV+G Q+FD++PL  VP ALKEKLL+ M  TLN
Sbjct  634   IWFHYLSLVKYPYEAVLQNEFDDPTKCFVKGIQLFDNSPLGNVPNALKEKLLSTMSNTLN  693

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             V+ITSSTCVTTGADIL  QG+TDLSKWNCLWIT+AWGF FR+LFYFSLLLGS+NKRR
Sbjct  694   VKITSSTCVTTGADILVQQGITDLSKWNCLWITIAWGFFFRVLFYFSLLLGSKNKRR  750



>ref|XP_006361395.1| PREDICTED: ABC transporter G family member 6-like [Solanum tuberosum]
Length=724

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/473 (75%), Positives = 413/473 (87%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG+TVY
Sbjct  252   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRLIFLSRGQTVY  311

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG-GRNSE  1258
             +GSP+NLPQF +DFGH +PE +N+ EFALDLIRELEGSP+GT +LVEF+R+W    RNS 
Sbjct  312   SGSPLNLPQFFADFGHSIPENENKTEFALDLIRELEGSPDGTDNLVEFNRKWKNTNRNSA  371

Query  1257  PATAVHNLSLKEAISASVSQGKLVSGATNDA-NPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
                A ++LSLKEAISAS+S+GKLVSGA NDA NP S VP +AN +WTEMAVLSKRSFTN 
Sbjct  372   ATPARYDLSLKEAISASISRGKLVSGAANDAANPTSMVPTFANPIWTEMAVLSKRSFTNS  431

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              RMPEI   R G V VTGFILATMFWR+D+SPKG++ER+GFFAFAMSTT+YTCAD LPVF
Sbjct  432   WRMPEIFFVRFGAVMVTGFILATMFWRLDDSPKGVRERIGFFAFAMSTTYYTCADALPVF  491

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             I ER+IF+RETA+NAYRRSSYCLSHALVS P L+ L++ F+A TFWA GL GG +GF FY
Sbjct  492   IHERFIFMRETAYNAYRRSSYCLSHALVSIPALIFLSISFAALTFWAVGLDGGASGFLFY  551

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
              +++LASFWAGNSFVTFLS V+PHVM+ Y++VVAI AY+LLFSGFF+NR RIP YWIWFH
Sbjct  552   LSVVLASFWAGNSFVTFLSGVIPHVMIGYVIVVAIFAYYLLFSGFFLNRDRIPSYWIWFH  611

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPYEAVLQNEF+DPTKCFVRG Q+FD++PL  +  +LKEKLL ++ +TLNVRIT
Sbjct  612   YLSLVKYPYEAVLQNEFKDPTKCFVRGIQLFDNSPLGDISISLKEKLLDSISKTLNVRIT  671

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             SSTCV TGADIL  QG+T L+KWNCLW+T+AWGF FRILFYFSLLLGS+NKRR
Sbjct  672   SSTCVMTGADILVQQGITQLNKWNCLWVTIAWGFFFRILFYFSLLLGSKNKRR  724



>ref|XP_006345915.1| PREDICTED: ABC transporter G family member 1-like [Solanum tuberosum]
Length=750

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/477 (75%), Positives = 409/477 (86%), Gaps = 6/477 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDR++ LSRG+TVY
Sbjct  274   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMLFLSRGQTVY  333

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR----  1267
             +GSP+NLP F SDFGH +P+ +NR EFALDLIRELEGSP GTKSLVEF++ W   +    
Sbjct  334   SGSPMNLPHFFSDFGHPIPDSENRTEFALDLIRELEGSPGGTKSLVEFNKTWENTKRSNE  393

Query  1266  NSEPATAVHNLSLKEAISASVSQGKLVSGATND--ANPVSSVPAYANSLWTEMAVLSKRS  1093
             N E  T  H LSLKEAISAS+S+GKLVSG T+D   +P S VP YAN  W EM VLSKRS
Sbjct  394   NPEIQTPTHGLSLKEAISASISRGKLVSGTTSDIHTSPASMVPTYANPFWIEMLVLSKRS  453

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
             FTN  R+PE+ G RLG + VTGFILATMFW++D+SPKG+QERLGFFAFAMSTTFYTCAD 
Sbjct  454   FTNSWRVPELFGIRLGAIVVTGFILATMFWQLDDSPKGVQERLGFFAFAMSTTFYTCADA  513

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVF+QERYIF+RETA+NAYRRSSYCLSHA+VS P L+ L+  F+A TFWA GL GG +G
Sbjct  514   LPVFLQERYIFMRETAYNAYRRSSYCLSHAIVSLPALIFLSFAFAAITFWAVGLVGGFSG  573

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F FY+AIILASFWAGNSFVTFLS VVP VML Y +VVAILAYFLLFSGFF+NR RIP YW
Sbjct  574   FLFYFAIILASFWAGNSFVTFLSGVVPSVMLGYTIVVAILAYFLLFSGFFINRDRIPPYW  633

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHY+SL+KYPYEAVLQNEF+D TKCFV+G Q+FD++PL  VP ALKEKLL+ M  TLN
Sbjct  634   IWFHYLSLVKYPYEAVLQNEFDDATKCFVKGIQLFDNSPLGNVPNALKEKLLSTMSNTLN  693

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             V+ITSSTCVTTGADIL  QG+TDLSKWNCLWIT+AWGF FR+LFYFSLLLGS+NKRR
Sbjct  694   VKITSSTCVTTGADILVQQGITDLSKWNCLWITIAWGFFFRVLFYFSLLLGSKNKRR  750



>ref|XP_009796484.1| PREDICTED: ABC transporter G family member 1-like [Nicotiana 
sylvestris]
Length=750

 Score =   724 bits (1869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/477 (75%), Positives = 406/477 (85%), Gaps = 6/477 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDR++ LSRG+TVY
Sbjct  274   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMLFLSRGQTVY  333

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG-----G  1270
             +GSP+NLP F +DFGH +P+ +NR EFALDLIRELEGSP GTKSLVEF++ W        
Sbjct  334   SGSPMNLPHFFADFGHPIPDNENRTEFALDLIRELEGSPGGTKSLVEFNKTWQNTKRQSN  393

Query  1269  RNSEPATAVHNLSLKEAISASVSQGKLVSGATND-ANPVSSVPAYANSLWTEMAVLSKRS  1093
             +N E AT  H LSLKEAISAS+S+GKLVSG T+D  +P S VP YAN  W EM  LSKRS
Sbjct  394   QNCEIATPTHGLSLKEAISASISRGKLVSGTTSDHTSPASMVPTYANPFWIEMTTLSKRS  453

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
             FTN  R+PE+ G RLG + VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD 
Sbjct  454   FTNSWRVPELFGIRLGAIVVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADA  513

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVF+QERYIF+RETA+NAYRRSSYCLSHALVS P L+ L+  F+A TFWA GL GG +G
Sbjct  514   LPVFLQERYIFMRETAYNAYRRSSYCLSHALVSLPALIFLSFAFAAITFWAVGLDGGFSG  573

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F FY+ IILASFWAGNSFVTFLS VVP VML Y +VVAILAYFLLFSGFFMNR RIP YW
Sbjct  574   FMFYFGIILASFWAGNSFVTFLSGVVPSVMLGYTIVVAILAYFLLFSGFFMNRDRIPPYW  633

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHY+SL+KYPYEAVLQNEF+DPTKCFV+G QMFD++PL +VP  LKEKLL+ M  TLN
Sbjct  634   IWFHYLSLVKYPYEAVLQNEFDDPTKCFVKGIQMFDNSPLGSVPIELKEKLLSTMSNTLN  693

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             V+IT STCVTTGADIL  QG+T+LS W CLWIT+AWGF FR+LFYFSLLLGS+NKRR
Sbjct  694   VKITGSTCVTTGADILVQQGITELSMWGCLWITIAWGFFFRVLFYFSLLLGSKNKRR  750



>ref|XP_009626224.1| PREDICTED: ABC transporter G family member 6 [Nicotiana tomentosiformis]
Length=750

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/477 (75%), Positives = 405/477 (85%), Gaps = 6/477 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+ LLDR++ LSRG+TVY
Sbjct  274   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDRMLFLSRGQTVY  333

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG-----G  1270
             +GSP+NLP F +DFGH +P+ +NR EFALDLIRELEGSP GTKSLVEF++ W        
Sbjct  334   SGSPMNLPHFFADFGHPIPDNENRTEFALDLIRELEGSPGGTKSLVEFNKTWQNTKRQSN  393

Query  1269  RNSEPATAVHNLSLKEAISASVSQGKLVSGATND-ANPVSSVPAYANSLWTEMAVLSKRS  1093
             +N E  T  H LSLKEAISAS+S+GKLVSG T+D  +P S VP YAN  W EM  LSKRS
Sbjct  394   QNCEIVTPTHGLSLKEAISASISRGKLVSGTTSDHTSPASMVPTYANPFWIEMTTLSKRS  453

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
             FTN  R+PE+ G RLG + VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD 
Sbjct  454   FTNSWRVPELFGIRLGAIVVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADA  513

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVF+QERYIF+RETA+NAYRRSSYCLSHALVS P L+ L+  F+A TFWA GL GG +G
Sbjct  514   LPVFLQERYIFMRETAYNAYRRSSYCLSHALVSLPALIFLSFAFAAITFWAVGLDGGFSG  573

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F FY+ IILASFWAGNSFVTFLS VVP VML Y +VVAILAYFLLFSGFFMNR RIP YW
Sbjct  574   FLFYFGIILASFWAGNSFVTFLSGVVPSVMLGYTIVVAILAYFLLFSGFFMNRDRIPPYW  633

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHY+SL+KYPYEAVLQNEF+DPTKCFV+G QMFD++PL +VP ALKEKLL+ M  TLN
Sbjct  634   IWFHYLSLVKYPYEAVLQNEFDDPTKCFVKGIQMFDNSPLGSVPIALKEKLLSTMSNTLN  693

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             V+IT STCVTTGADIL  QG+T+LS W CLWIT+AWGF FR+LFYFSLLLGS+NKRR
Sbjct  694   VKITGSTCVTTGADILVQQGITELSMWGCLWITIAWGFFFRVLFYFSLLLGSKNKRR  750



>ref|XP_004236771.1| PREDICTED: ABC transporter G family member 6-like [Solanum lycopersicum]
Length=718

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/471 (74%), Positives = 407/471 (86%), Gaps = 6/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF +VKVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG+TVY
Sbjct  254   LFLDEPTSGLDSTSAFMMVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRLIFLSRGQTVY  313

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLPQF +DFGH +PE +N+ EFALDLIRELEGSP GT SLVEF+R+W   +NS  
Sbjct  314   SGSPFNLPQFFADFGHPIPENENKTEFALDLIRELEGSPNGTSSLVEFNRKW---KNSST  370

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
              + +++LSLKEAISAS+S+GKLVSGA   ANP S VP +AN +W EMAVLS RSFTN  R
Sbjct  371   TSTIYDLSLKEAISASISRGKLVSGA---ANPTSMVPTFANPIWIEMAVLSNRSFTNSWR  427

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
             MPEI   R G V VTGFILAT+FWR+D+SP+G++ER+GFFAFAMSTT+YTCA+ LPVFI 
Sbjct  428   MPEIFAVRFGAVMVTGFILATLFWRLDDSPRGVRERIGFFAFAMSTTYYTCAEALPVFIH  487

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ER+IF+RETA+NAYRRSSYCLSHALVS P L+ L+L F+A TFWA GL GG + F FY +
Sbjct  488   ERFIFMRETAYNAYRRSSYCLSHALVSIPSLIFLSLSFAALTFWAVGLDGGASSFLFYLS  547

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
             ++LASFWAGNSFVTFLSCV+PHVM+ Y++VVAI AY+LLFSGFF+NR RIP YWIWFHYI
Sbjct  548   VVLASFWAGNSFVTFLSCVIPHVMIGYVIVVAIFAYYLLFSGFFLNRDRIPSYWIWFHYI  607

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYEAVLQNEF+DP KCFVRG Q+FD++PL  VP +LKEKLL ++  TLNVRITSS
Sbjct  608   SLVKYPYEAVLQNEFKDPMKCFVRGIQLFDNSPLGDVPISLKEKLLDSISNTLNVRITSS  667

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCV TGADIL  QG+T L+KWNCLW+T+AWGF FRILFYF+LLLGS+NKRR
Sbjct  668   TCVVTGADILVQQGITQLNKWNCLWVTIAWGFFFRILFYFTLLLGSKNKRR  718



>ref|XP_002525084.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF37331.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=746

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/474 (76%), Positives = 406/474 (86%), Gaps = 4/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRL+ LSRG+TVY
Sbjct  274   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLVFLSRGQTVY  333

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G P+ LP F ++FGH +PE +NR EFALDLIRELEGSP GTKSLVEF++ W   +++ P
Sbjct  334   SGPPIYLPSFFAEFGHPIPENENRTEFALDLIRELEGSPGGTKSLVEFNKTWQSTKHA-P  392

Query  1254  ATAV--HNLSLKEAISASVSQGKLVSGATNDANPVSS-VPAYANSLWTEMAVLSKRSFTN  1084
              T V  H LSLKEAISAS+S+GKLVSGATN+    +S VP +AN +W EMAVLSKRS TN
Sbjct  393   NTEVDSHGLSLKEAISASISKGKLVSGATNNGAGTNSLVPTFANPVWIEMAVLSKRSVTN  452

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RRMPE+ G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD LPV
Sbjct  453   SRRMPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPV  512

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERYIF+RETAHNAYRRSSY LSHALVS P L+ L+L FSA TFWA GL GG AGF F
Sbjct  513   FLQERYIFMRETAHNAYRRSSYVLSHALVSLPSLIFLSLAFSALTFWAVGLDGGLAGFLF  572

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y+ II ASFWAGNSFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIWF
Sbjct  573   YFLIIFASFWAGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPPYWIWF  632

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HY+SL+KYPYEAVLQNEF+DP KCFVRG Q+FD+TPL AVP  +K  LL  +  TL + I
Sbjct  633   HYMSLVKYPYEAVLQNEFQDPVKCFVRGVQIFDNTPLGAVPTPMKVNLLATLSNTLGMTI  692

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TSSTC+TTG+DIL  QG+TDLSKWNCLW+TVAWGFLFRILFYFSLL+GS+NKRR
Sbjct  693   TSSTCLTTGSDILQQQGITDLSKWNCLWVTVAWGFLFRILFYFSLLIGSKNKRR  746



>gb|AAR06252.1| stigma/style ABC transporter [Nicotiana tabacum]
Length=730

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/479 (75%), Positives = 410/479 (86%), Gaps = 10/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF V+KVLQRIAQSGSIVI+SIHQPS RIVGLLDRLI LSRG+TVY
Sbjct  252   LFLDEPTSGLDSTSAFMVIKVLQRIAQSGSIVIMSIHQPSYRIVGLLDRLIFLSRGQTVY  311

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW-------S  1276
             +GSP+NLPQF +DFG+ +PE +NR+EFALDLIRELEGS   T+SLV+F++ W       S
Sbjct  312   SGSPLNLPQFFADFGNPIPENENRIEFALDLIRELEGSGR-TRSLVDFNKTWQHMKRTSS  370

Query  1275  GGRNSEPATAVHN-LSLKEAISASVSQGKLVSGATNDA-NPVSSVPAYANSLWTEMAVLS  1102
               +N+E      N LSLKEAISAS+S+GKLV G+T+ A +P S VP +AN +WTE+AVLS
Sbjct  371   TNQNTETTGRNRNRLSLKEAISASISRGKLVPGSTHVATSPTSMVPTFANPIWTEIAVLS  430

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
             KRSFTN  RMPEI   R G V VTGFILATMFWR+D+SPKG+QERLGFFAFAMSTT+YTC
Sbjct  431   KRSFTNSWRMPEIFAVRFGAVMVTGFILATMFWRLDSSPKGVQERLGFFAFAMSTTYYTC  490

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
             AD LPVFIQERYIF+RETA+N YRRSSYCLSHAL S P L+ LAL F+A TFWA GL GG
Sbjct  491   ADALPVFIQERYIFMRETAYNGYRRSSYCLSHALTSIPALIFLALSFAAVTFWAVGLDGG  550

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
              + F FY+ +ILASFWAGNSFVTFLS VVPHVML Y +VVAILAYFLLFSGFFMNR RIP
Sbjct  551   FSSFLFYFTVILASFWAGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFMNRDRIP  610

Query  561   LYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
              YWIWFHYISL+KYPYEAVLQNEF+DPTKCFVRG QMFD++PL AVP +LKEKLL+++  
Sbjct  611   SYWIWFHYISLVKYPYEAVLQNEFDDPTKCFVRGIQMFDNSPLGAVPNSLKEKLLSSISS  670

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             TLN+RITSSTCVTTG+DIL  QG+T LSKWNCLW+T+AWGFLFRILFYF LLLGS+NKR
Sbjct  671   TLNMRITSSTCVTTGSDILVQQGITQLSKWNCLWVTIAWGFLFRILFYFCLLLGSKNKR  729



>ref|XP_009767486.1| PREDICTED: ABC transporter G family member 6-like [Nicotiana 
sylvestris]
Length=730

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/479 (75%), Positives = 410/479 (86%), Gaps = 10/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF V+KVLQRIAQSGSIVI+SIHQPS RIVGLLDRLI LSRG+TVY
Sbjct  252   LFLDEPTSGLDSTSAFMVIKVLQRIAQSGSIVIMSIHQPSYRIVGLLDRLIFLSRGQTVY  311

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW-------S  1276
             +GSP+NLPQF +DFG+ +PE +NR+EFALDLIRELEGS   T+SLV+F++ W       S
Sbjct  312   SGSPLNLPQFFADFGNPIPENENRIEFALDLIRELEGSGR-TRSLVDFNKTWQHMKRTSS  370

Query  1275  GGRNSEPATAVHN-LSLKEAISASVSQGKLVSGATNDA-NPVSSVPAYANSLWTEMAVLS  1102
               +N+E      N LSLKEAISAS+S+GKLV G+T+ A +P S VP +AN +WTE+AVLS
Sbjct  371   TIQNTETTGRNRNRLSLKEAISASISRGKLVPGSTHVATSPTSMVPTFANPIWTEIAVLS  430

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
             KRSFTN  RMPEI   R G V VTGFILATMFWR+D+SPKG+QERLGFFAFAMSTT+YTC
Sbjct  431   KRSFTNSWRMPEIFAVRFGAVMVTGFILATMFWRLDSSPKGVQERLGFFAFAMSTTYYTC  490

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
             AD LPVFIQERYIF+RETA+N YRRSSYCLSHAL S P L+ LAL F+A TFWA GL GG
Sbjct  491   ADALPVFIQERYIFMRETAYNGYRRSSYCLSHALTSIPALIFLALSFAAVTFWAVGLDGG  550

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
              + F FY+ +ILASFWAGNSFVTFLS VVPHVML Y +VVAILAYFLLFSGFFMNR RIP
Sbjct  551   FSSFLFYFTVILASFWAGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFMNRDRIP  610

Query  561   LYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
              YWIWFHYISL+KYPYEAVLQNEF+DPTKCFVRG QMFD++PL AVP +LKEKLL+++  
Sbjct  611   SYWIWFHYISLVKYPYEAVLQNEFDDPTKCFVRGIQMFDNSPLGAVPNSLKEKLLSSISS  670

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             TLN+RITSSTCVTTG+DIL  QG+T LSKWNCLW+T+AWGFLFRILFYF LLLGS+NKR
Sbjct  671   TLNMRITSSTCVTTGSDILVQQGITQLSKWNCLWVTIAWGFLFRILFYFCLLLGSKNKR  729



>ref|XP_009597347.1| PREDICTED: ABC transporter G family member 6-like [Nicotiana 
tomentosiformis]
Length=725

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/475 (75%), Positives = 405/475 (85%), Gaps = 5/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF V+KVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG+TVY
Sbjct  252   LFLDEPTSGLDSTSAFMVIKVLQRIAQSGSIVIMSIHQPSYRILGLLDRLIFLSRGQTVY  311

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP+NLPQ+ +DFG+ +PE +N  EFALDLIRELEGS  GTKSLV+F++ W   +    
Sbjct  312   SGSPMNLPQYFADFGNPIPENENPTEFALDLIRELEGS-GGTKSLVDFNKTWQHTKRINS  370

Query  1254  ATAVHN---LSLKEAISASVSQGKLVSGATNDA-NPVSSVPAYANSLWTEMAVLSKRSFT  1087
                  N   LSLKEAISAS+S+GKLV G+T+ A +P S VP +AN +WTE+AVLSKRSF+
Sbjct  371   TNQARNRNRLSLKEAISASISRGKLVPGSTHVATSPTSMVPTFANPIWTEIAVLSKRSFS  430

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N  RMPEI   R G V VTGFILATMFWR+D+SPKG++ERL FFAFAMSTT+YTCAD LP
Sbjct  431   NSWRMPEIFAVRFGAVMVTGFILATMFWRLDSSPKGVKERLAFFAFAMSTTYYTCADALP  490

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VFIQERYIF+RETA+NAYRRSSYCLSHAL S P L+ LAL F+A TFWA GL GG + F 
Sbjct  491   VFIQERYIFMRETAYNAYRRSSYCLSHALTSIPALIFLALSFAAVTFWAVGLDGGFSSFL  550

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             FY+ +ILASFWAGNSFVTFLS VVPHVML Y +VVAILAYFLLFSGFFMNR RIP YW+W
Sbjct  551   FYFGVILASFWAGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFMNRDRIPSYWVW  610

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FHYISL+KYPYEAVLQNEFEDPTKCFVRG QMFD++PL AVP +LKEKLL+++  TLN+R
Sbjct  611   FHYISLVKYPYEAVLQNEFEDPTKCFVRGIQMFDNSPLGAVPNSLKEKLLSSISSTLNMR  670

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             ITSSTCVTTG+DIL  QGVT LSKWNCLW+T+AWG LFRILFYF LLLGS+NKRR
Sbjct  671   ITSSTCVTTGSDILVQQGVTQLSKWNCLWVTIAWGLLFRILFYFCLLLGSKNKRR  725



>ref|XP_011027346.1| PREDICTED: ABC transporter G family member 6-like [Populus euphratica]
Length=741

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/476 (75%), Positives = 400/476 (84%), Gaps = 5/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLI LSRG TVY
Sbjct  266   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGHTVY  325

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG---GRN  1264
             +GSP+NLP + SDFGH +PE +NR EFALDLIRELEGSP GT+SLVEF++ W      RN
Sbjct  326   SGSPMNLPVYFSDFGHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQDLKHSRN  385

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDA--NPVSSVPAYANSLWTEMAVLSKRSF  1090
                      LSLKEAISAS+S+GKLVSGATN+   +P S VP +AN +W EMAVLSKRSF
Sbjct  386   GGSEPDRGGLSLKEAISASISKGKLVSGATNNDAISPNSMVPTFANPVWIEMAVLSKRSF  445

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N RRMPE+ G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD L
Sbjct  446   LNSRRMPELFGIRLGAVMVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADAL  505

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QERYIF+RETA+NAYRRSSY LSH LV  P L+ L+L FSATTFWA GL GG +GF
Sbjct  506   PVFLQERYIFMRETAYNAYRRSSYVLSHGLVVLPSLIFLSLAFSATTFWAVGLDGGLSGF  565

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  566   LFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPDYWI  625

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPYEAVL NEF+DP KCFVRG Q+FD +PL  VP +LK +LL +M  TL  
Sbjct  626   WFHYLSLVKYPYEAVLLNEFQDPAKCFVRGVQIFDQSPLGEVPTSLKLQLLESMSNTLGT  685

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +ITSSTC+TTGADIL  QG+TDLSKWNCLW+TVAWGFLFRILFY SLL GS+NKRR
Sbjct  686   KITSSTCLTTGADILQQQGITDLSKWNCLWVTVAWGFLFRILFYISLLFGSKNKRR  741



>ref|XP_002315262.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEF01433.1| ABC transporter family protein [Populus trichocarpa]
Length=686

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/476 (75%), Positives = 400/476 (84%), Gaps = 5/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLI LSRG+TVY
Sbjct  211   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVY  270

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG---GRN  1264
             +GSP+NLP + SDFGH +PE +NR EFALDLIRELEGSP GT+SLVEF++ W      RN
Sbjct  271   SGSPMNLPVYFSDFGHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQDLKHSRN  330

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDA--NPVSSVPAYANSLWTEMAVLSKRSF  1090
                      LSLKEAISAS+S+GKLVSGATN+   +P S VP +ANS+  EMAVLSKRSF
Sbjct  331   GGSEPDRGGLSLKEAISASISKGKLVSGATNNDAISPNSMVPTFANSVLIEMAVLSKRSF  390

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N RRMPE+ G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD L
Sbjct  391   LNSRRMPELFGIRLGAVMVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADAL  450

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QERYIF+RETA+NAYRRSSY LSH LV  P L+ L+L FSATTFWA GL GG +GF
Sbjct  451   PVFLQERYIFMRETAYNAYRRSSYVLSHGLVVLPSLIFLSLAFSATTFWAVGLDGGLSGF  510

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  511   LFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPAYWI  570

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPYEAVL NEF+DP KCFVRG Q+FD +PL  V  +LK +LL +M  TL  
Sbjct  571   WFHYLSLVKYPYEAVLLNEFQDPAKCFVRGVQIFDQSPLGEVSTSLKLQLLESMSNTLGT  630

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +ITSSTC+TTGADIL  QG+TDLSKWNCLW+TVAWGFLFRILFY SLL GS+NKRR
Sbjct  631   KITSSTCLTTGADILLQQGITDLSKWNCLWVTVAWGFLFRILFYISLLFGSKNKRR  686



>ref|XP_010101507.1| ABC transporter G family member 16 [Morus notabilis]
 gb|EXB88504.1| ABC transporter G family member 16 [Morus notabilis]
Length=758

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/479 (74%), Positives = 406/479 (85%), Gaps = 8/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLI LSRG+TV+
Sbjct  280   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVF  339

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR---N  1264
             +GSPVNLPQF ++FGH +PE +NR EFALDLIRELEGSP GT++LVEF++ W   +    
Sbjct  340   SGSPVNLPQFFAEFGHPIPENENRTEFALDLIRELEGSPGGTRALVEFNKTWQSKKVKST  399

Query  1263  SEPATAVH---NLSLKEAISASVSQGKLVSGATN--DANPVSSVPAYANSLWTEMAVLSK  1099
             S+  T ++    LSLKEAISAS+S+GKLVSGA N  D +P S VP +AN  W EM VLSK
Sbjct  400   SDRPTDININQALSLKEAISASISRGKLVSGANNSVDPSPNSMVPTFANPFWIEMVVLSK  459

Query  1098  RSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCA  919
             RS TN RRMPE+ G RLG V VTGFILATMFW +D+SPKG+QERLGFFAFAMSTTFYTCA
Sbjct  460   RSVTNSRRMPELFGIRLGAVMVTGFILATMFWNLDDSPKGVQERLGFFAFAMSTTFYTCA  519

Query  918   DTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggt  739
             D LPVF+QERYIF+RETAHNAYRRSSY LSH+ V+ P LV L+L FSA TFWA GL GG 
Sbjct  520   DALPVFLQERYIFMRETAHNAYRRSSYVLSHSFVALPPLVFLSLGFSAATFWAVGLDGGF  579

Query  738   agffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPL  559
             +GF FY+ II ASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP 
Sbjct  580   SGFLFYFLIIFASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPS  639

Query  558   YWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET  379
             YWIWFHY+SL+KYPYEAVLQNEFE+P KCFVRG Q+FD+TPL++VP+++K KLL  M +T
Sbjct  640   YWIWFHYLSLVKYPYEAVLQNEFENPLKCFVRGIQIFDNTPLASVPSSMKLKLLENMSQT  699

Query  378   LNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             L +RIT STC+TTG DILA Q VTDL KW+CLW+TVAWGFLFRILFYFSLLLGS+NKRR
Sbjct  700   LGMRITRSTCLTTGTDILAQQAVTDLDKWSCLWVTVAWGFLFRILFYFSLLLGSKNKRR  758



>gb|KDP46092.1| hypothetical protein JCGZ_06603 [Jatropha curcas]
Length=751

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/475 (74%), Positives = 410/475 (86%), Gaps = 6/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQ+GSIVI+S+HQPS RI+GLLDRLI LSRG+TVY
Sbjct  279   LFLDEPTSGLDSTSAFMVVKVLQRIAQTGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVY  338

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR---N  1264
             +GSPV+LP F ++FGH +PE +N+ EFALDLIRELEGSP GTKSLVEF++ W   +   N
Sbjct  339   SGSPVHLPAFFAEFGHPIPENENKTEFALDLIRELEGSPGGTKSLVEFNKSWQNMKHTPN  398

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSS-VPAYANSLWTEMAVLSKRSFT  1087
             +EP    + LSLKEAISAS+S+GKLVSGATN+ + ++S VP +AN  W EMAVLSKRS T
Sbjct  399   TEPER--NGLSLKEAISASISKGKLVSGATNNGSSMNSMVPTFANPFWIEMAVLSKRSVT  456

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N +R+PE+ G RLG V VTGFILATMFW++D+SPKG+QERLGFFAFAMSTTFYTCAD LP
Sbjct  457   NSKRVPELFGIRLGAVLVTGFILATMFWQLDSSPKGVQERLGFFAFAMSTTFYTCADALP  516

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+QERYIF+RETA+NAYRRSSY LSHA+VS P L+ L+  FSA TFWA GL GG +GFF
Sbjct  517   VFLQERYIFMRETAYNAYRRSSYVLSHAIVSLPALIFLSFAFSAITFWAVGLDGGFSGFF  576

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             FY+ IILASFWAGNSFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIW
Sbjct  577   FYFIIILASFWAGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYWIW  636

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FHY+SL+KYPYEAVLQNEF+DPTKCFVRG Q+FD+TPL +VP ++K +LL  +  TL ++
Sbjct  637   FHYLSLVKYPYEAVLQNEFQDPTKCFVRGVQIFDNTPLGSVPDSMKVRLLQTLSSTLGMK  696

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             ITSSTC+TTG+ IL  QG+TDLSKWNC W+TVAWGF FRILFYFSLLLGS+NKRR
Sbjct  697   ITSSTCLTTGSGILQQQGITDLSKWNCFWVTVAWGFFFRILFYFSLLLGSKNKRR  751



>ref|XP_003633443.1| PREDICTED: ABC transporter G family member 6-like [Vitis vinifera]
Length=747

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/473 (74%), Positives = 402/473 (85%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLI LSRG+TVY
Sbjct  275   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVY  334

Query  1434  TGSPVNLPQFLSDFGHQVP-EGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE  1258
             +G P+NLP F ++FGH +P + +NR EFALDLIRELEGSP GTKSLVEF+++W   +++ 
Sbjct  335   SGPPMNLPLFFAEFGHPIPPDNENRTEFALDLIRELEGSPGGTKSLVEFNKQWQSTKHTR  394

Query  1257  PATAVHN-LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
                A  N LS+KEAISAS+S+GKLVSGATNDA+  S VP +ANS W EMAVLSKRS TN 
Sbjct  395   SYEAGTNGLSMKEAISASISKGKLVSGATNDASSTSLVPTFANSFWVEMAVLSKRSITNS  454

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             RRMPE+ G RLG V +TGFILAT++W++DNSPKG QERLGFFAFAMSTTFYTCAD LPVF
Sbjct  455   RRMPELFGIRLGAVLITGFILATIYWQLDNSPKGAQERLGFFAFAMSTTFYTCADALPVF  514

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QERYIFLRETA+NAYRRSSY LSH+L S P L+ L+  F+ATTF+A GL GG +GF FY
Sbjct  515   LQERYIFLRETAYNAYRRSSYVLSHSLTSLPALIFLSFAFAATTFFAVGLDGGLSGFLFY  574

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
             + II ASFWAGNSFVTFLS VVPHVML Y +VVA+LAYFLLFSGFF+NR RIP YWIWFH
Sbjct  575   FLIIFASFWAGNSFVTFLSGVVPHVMLGYTIVVALLAYFLLFSGFFINRNRIPSYWIWFH  634

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPYE VLQNEF DP KC+VRG Q+FD+TPL AV  A+K  LL ++  TL + IT
Sbjct  635   YVSLVKYPYEGVLQNEFNDPAKCYVRGVQIFDNTPLGAVSQAMKVNLLKSLSNTLGMEIT  694

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             SSTCVTTG DIL  QG+TDLSKWNCLW+TVAWGF FRILFYF+LL+GS+NKRR
Sbjct  695   SSTCVTTGVDILKQQGITDLSKWNCLWVTVAWGFFFRILFYFALLMGSKNKRR  747



>ref|XP_006361394.1| PREDICTED: ABC transporter G family member 1-like [Solanum tuberosum]
Length=721

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/473 (73%), Positives = 403/473 (85%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS+RI+GLLDRLI LS G+TVY
Sbjct  249   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSNRILGLLDRLIFLSHGQTVY  308

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG-GRNSE  1258
             + SP+NLPQF +DFGH +PE +NR EFALDLIRELE SP+GT +LVEF+R+W    RNS 
Sbjct  309   SDSPLNLPQFFADFGHPIPENENRTEFALDLIRELEDSPDGTNNLVEFNRKWKNTNRNSA  368

Query  1257  PATAVHNLSLKEAISASVSQGKLVSGATNDA-NPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
                A ++LSLKEAISAS+S+GKLVSGATN+A NP   VP +AN +WTE+AVLSKRSFTN 
Sbjct  369   TTPARYDLSLKEAISASISRGKLVSGATNNAANPTVMVPTFANPIWTEIAVLSKRSFTNS  428

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              RMPEI   R   V VTGFILAT+FWR+DNSPKGI ERLGF AFA+STT+Y C + LPVF
Sbjct  429   WRMPEIFFVRFSAVMVTGFILATIFWRLDNSPKGIWERLGFIAFAVSTTYYICTEALPVF  488

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             IQERYIF+RETA+NAYRRSSYC+SHALVS P L+ L+L+F A TFWA GL GG +GF FY
Sbjct  489   IQERYIFMRETAYNAYRRSSYCISHALVSLPGLIFLSLLFVALTFWAVGLDGGASGFLFY  548

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
             + + LAS WAGNSFVTFLS VVPHVM+ YI+VVA+L YFLLFSGF+MNR RIP YWIWFH
Sbjct  549   FCVFLASIWAGNSFVTFLSGVVPHVMIGYIIVVALLGYFLLFSGFYMNRDRIPSYWIWFH  608

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPYEAVL NEF+DPTKCFVRG Q+FD++ L  +P ++KEKLL  + ETLNV IT
Sbjct  609   YLSLVKYPYEAVLLNEFKDPTKCFVRGVQLFDNSQLGDLPNSIKEKLLENISETLNVTIT  668

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             SSTC+T+GADIL  QG+T L+KWNCLW+T+AWGF FRILFYFSLLLGS+NKRR
Sbjct  669   SSTCLTSGADILVQQGITQLNKWNCLWVTIAWGFFFRILFYFSLLLGSKNKRR  721



>ref|XP_008233528.1| PREDICTED: ABC transporter G family member 6-like [Prunus mume]
Length=749

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/479 (74%), Positives = 408/479 (85%), Gaps = 8/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+GLLDRL+ LSRG+TVY
Sbjct  271   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRLLFLSRGQTVY  330

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP + ++FGH +PE DNR EFALDL+RELEGSP GTKSLVEF+R W   ++S  
Sbjct  331   SGSPTTLPSYFAEFGHPIPESDNRTEFALDLVRELEGSPGGTKSLVEFNRTWQSMKHSNN  390

Query  1254  ATAV-------HNLSLKEAISASVSQGKLVSGATN-DANPVSSVPAYANSLWTEMAVLSK  1099
              T+        H++SL+EAISAS+S+GKLVSGATN D +P S VP +AN  W EMAVLSK
Sbjct  391   DTSCQIACEPRHSVSLQEAISASISRGKLVSGATNNDPSPNSMVPTFANPFWIEMAVLSK  450

Query  1098  RSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCA  919
             RS  N RRMPE+ G RLG V VTGFILATMFW +DN+PKG+QERLGF AFAMSTTFYTCA
Sbjct  451   RSMKNARRMPELFGIRLGAVMVTGFILATMFWNLDNTPKGVQERLGFIAFAMSTTFYTCA  510

Query  918   DTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggt  739
             D LPVF+QERYIF+RETA+NAYRRSSY LSH+LV+ P LV L++ FSA TFWA GL GG 
Sbjct  511   DALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVALPSLVFLSITFSALTFWAVGLDGGL  570

Query  738   agffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPL  559
             +GF FY+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP 
Sbjct  571   SGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPG  630

Query  558   YWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET  379
             YWIWFHY+SL+KYPYE VLQNEF+DPTKCFVRG Q+FD+TPL++VPAA+K KLL +M +T
Sbjct  631   YWIWFHYMSLVKYPYEGVLQNEFQDPTKCFVRGVQIFDNTPLASVPAAMKLKLLDSMSQT  690

Query  378   LNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             L  RITSSTC+TTG+DIL  QGVTDLSKWNCL++TVAWGFLFRILFYFSLLLGS+NKRR
Sbjct  691   LGTRITSSTCLTTGSDILQQQGVTDLSKWNCLYVTVAWGFLFRILFYFSLLLGSKNKRR  749



>ref|XP_008463532.1| PREDICTED: ABC transporter G family member 6 [Cucumis melo]
Length=742

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/473 (75%), Positives = 407/473 (86%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+GLLDRL+ LSRG+TVY
Sbjct  270   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRLLFLSRGQTVY  329

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP + S+FGH +PE +NR EFALD IRELEGSP GTKSLVEF + W   +N   
Sbjct  330   SGSPANLPLYFSEFGHPIPENENRTEFALDRIRELEGSPGGTKSLVEFHKSWQSMKNIPK  389

Query  1254  ATAVH-NLSLKEAISASVSQGKLVSGATN-DANPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
             + + H N+SLKEAISAS+S+GKLVSGATN DA+P S VP +AN  W EMAVLSKRSF N 
Sbjct  390   SESDHQNMSLKEAISASISRGKLVSGATNNDASPNSMVPTFANPFWIEMAVLSKRSFLNS  449

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             RRMPE+ G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD LPVF
Sbjct  450   RRMPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPVF  509

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QERYIF+RETA+NAYRRSSY LSH+LV+ P L+ L+L F+ATTFWA GL GG +GF FY
Sbjct  510   LQERYIFMRETAYNAYRRSSYVLSHSLVALPALIFLSLAFAATTFWAVGLDGGISGFLFY  569

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
             + IILA+FWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP YWIWFH
Sbjct  570   FLIILAAFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPGYWIWFH  629

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPYEAVLQNEFE+PTKCFVRG Q+FD+TPL  VP A+K KLL  + +TL +RIT
Sbjct  630   YLSLVKYPYEAVLQNEFENPTKCFVRGVQIFDNTPLGMVPGAMKLKLLENLSKTLGMRIT  689

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              STC+TTGADIL  QGV DLSKWNCL +TVAWGFLFRILFYFSLL+GS+NKRR
Sbjct  690   RSTCLTTGADILEQQGVMDLSKWNCLVVTVAWGFLFRILFYFSLLIGSKNKRR  742



>ref|XP_010259980.1| PREDICTED: ABC transporter G family member 6-like [Nelumbo nucifera]
Length=752

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/474 (73%), Positives = 397/474 (84%), Gaps = 3/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL+RIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG+TVY
Sbjct  279   LFLDEPTSGLDSTSAFMVVNVLKRIAQSGSIVIMSIHQPSYRIIGLLDRLIFLSRGQTVY  338

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGG--RNS  1261
             +GSP NLP F  DFGH +PE +NR EFALDLIR+LEGSP GTKSLVEF++ W       +
Sbjct  339   SGSPANLPNFFRDFGHPIPEHENRTEFALDLIRQLEGSPGGTKSLVEFNKSWQQNVKHPT  398

Query  1260  EPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSS-VPAYANSLWTEMAVLSKRSFTN  1084
              P    H  SLK+AISAS+S+GKLVSGATNDA+P+SS +P YAN  WTE+AVLS RS TN
Sbjct  399   IPEHNQHEHSLKDAISASISRGKLVSGATNDASPMSSSMPTYANPFWTEIAVLSNRSVTN  458

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              +RMPE++G R   V VTGFILAT+FW +DNSPKG+QERLGFFAFAMSTTFYTCA+ LPV
Sbjct  459   SKRMPELVGIRFAAVMVTGFILATIFWHVDNSPKGVQERLGFFAFAMSTTFYTCAEALPV  518

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERYIF+RETA+NAYRRSSY LSH++V+ P L+ L+L F+A TFW+ GL GG +GF F
Sbjct  519   FLQERYIFMRETAYNAYRRSSYVLSHSIVAIPSLIFLSLAFAAITFWSVGLAGGFSGFLF  578

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y+ II ASFWAG+SFVTFLS VV HVML Y +VVAILAYFLLFSGFF+ R RIP YWIWF
Sbjct  579   YFLIIFASFWAGSSFVTFLSGVVSHVMLGYTVVVAILAYFLLFSGFFITRDRIPAYWIWF  638

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HYISL+KYPYEAVLQNEF DPTKCFVRG Q+FD+TPL  VP ALK +LL  +  +L + I
Sbjct  639   HYISLVKYPYEAVLQNEFLDPTKCFVRGVQIFDNTPLGVVPEALKLRLLKTLSNSLGMNI  698

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              S TCVTTG DIL +QG+TDLSKWNCLWITVAWGF FRILFYF+LLLGS+NKRR
Sbjct  699   GSDTCVTTGVDILRMQGITDLSKWNCLWITVAWGFFFRILFYFALLLGSKNKRR  752



>ref|XP_004149819.1| PREDICTED: ABC transporter G family member 16-like [Cucumis sativus]
 ref|XP_004166147.1| PREDICTED: ABC transporter G family member 16-like [Cucumis sativus]
 gb|KGN51254.1| hypothetical protein Csa_5G505150 [Cucumis sativus]
Length=744

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/473 (75%), Positives = 406/473 (86%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+GLLDRL+ LSRG+TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRLLFLSRGQTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP + S+FGH +PE +NR EFALD IRELEGSP GTKSLVEF + W   +N   
Sbjct  332   SGSPANLPLYFSEFGHPIPENENRTEFALDRIRELEGSPGGTKSLVEFHKSWQSMKNIPK  391

Query  1254  ATAVH-NLSLKEAISASVSQGKLVSGATN-DANPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
             + + H N+SLKEAISAS+S+GKLVSGATN DA+P S VP +AN  W EMAVLSKRS  N 
Sbjct  392   SESDHQNMSLKEAISASISRGKLVSGATNNDASPNSMVPTFANPFWIEMAVLSKRSILNS  451

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             RRMPE+ G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD LPVF
Sbjct  452   RRMPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPVF  511

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QERYIF+RETA+NAYRRSSY LSH+LV+ P L+ L+L F+ATTFWA GL GG +GF FY
Sbjct  512   LQERYIFMRETAYNAYRRSSYVLSHSLVALPALIFLSLAFAATTFWAVGLDGGISGFLFY  571

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
             + IILA+FWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP YWIWFH
Sbjct  572   FLIILAAFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPGYWIWFH  631

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPYEAVLQNEFE+PTKCFVRG Q+FD+TPL  VP A+K KLL  + +TL +RIT
Sbjct  632   YVSLVKYPYEAVLQNEFENPTKCFVRGVQIFDNTPLGMVPGAMKLKLLENLSKTLGMRIT  691

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              STC+TTGADIL  QGV DLSKWNCL +TVAWGFLFRILFYFSLL+GS+NKRR
Sbjct  692   QSTCLTTGADILVQQGVMDLSKWNCLLVTVAWGFLFRILFYFSLLIGSKNKRR  744



>ref|XP_011101624.1| PREDICTED: ABC transporter G family member 1-like [Sesamum indicum]
Length=747

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/479 (76%), Positives = 403/479 (84%), Gaps = 11/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDR+I LSRG TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMIFLSRGHTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR----  1267
             +G P NLP F SDFGH +P+ +NR EFALDLIRELEGSP GTKSLVEF++ W   +    
Sbjct  332   SGPPSNLPVFFSDFGHPIPDNENRTEFALDLIRELEGSPGGTKSLVEFNKSWQALKRGNQ  391

Query  1266  -NSEPATAVHNLSLKEAISASVSQGKLVSGAT--NDAN-PVSSVPAYANSLWTEMAVLSK  1099
              NSE    + NLSLKEAISAS+S+GKLVSGAT  N AN P S VP +AN  W EMAVLSK
Sbjct  392   MNSESPANILNLSLKEAISASISKGKLVSGATATNGANSPTSMVPTFANPSWIEMAVLSK  451

Query  1098  RSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCA  919
             RSFTN RRMPE+ G RLG V VTGFILATMFWR+DNSPKGIQERLGFFAFAMSTTFYTCA
Sbjct  452   RSFTNSRRMPELFGVRLGAVMVTGFILATMFWRLDNSPKGIQERLGFFAFAMSTTFYTCA  511

Query  918   DTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggt  739
             D LPVF+QERYIF+RETA+NAYRRSSY LSH+LVS P L+ L+L F+ATTFWA GL G  
Sbjct  512   DALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVSLPSLLFLSLAFAATTFWAVGLDGSF  571

Query  738   agffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPL  559
                  Y+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP 
Sbjct  572   FF---YFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPP  628

Query  558   YWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET  379
             YWIWFHYISL+KYPYEAVLQNEFEDP KCFVRG Q+FD+TPL AVP ALK KLL ++  +
Sbjct  629   YWIWFHYISLVKYPYEAVLQNEFEDPVKCFVRGVQIFDNTPLGAVPNALKVKLLDSLSNS  688

Query  378   LNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             L ++ITS+TCVTTGADIL  QG+TDLSKW+CLW+TVAWGF FRILFY SLL+GS+NKRR
Sbjct  689   LGMKITSTTCVTTGADILQQQGITDLSKWSCLWVTVAWGFFFRILFYLSLLVGSKNKRR  747



>ref|XP_007027149.1| ABC-2 type transporter family protein [Theobroma cacao]
 gb|EOY07651.1| ABC-2 type transporter family protein [Theobroma cacao]
Length=742

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/472 (73%), Positives = 399/472 (85%), Gaps = 1/472 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+ LLDRLI LS G TVY
Sbjct  271   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILSLLDRLIFLSHGHTVY  330

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP F ++FGH +PE +NR EFALDLIRELE +P GTKSLVEF+  W   +N   
Sbjct  331   SGSPGNLPHFFAEFGHPIPENENRTEFALDLIRELEETPGGTKSLVEFNTSWQARKNPRS  390

Query  1254  ATAVH-NLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
               +   NLSLK+AISAS+S+GKLVSGATND+N  SSVP +AN  W EM V++KRS TN +
Sbjct  391   GFSCKPNLSLKDAISASISRGKLVSGATNDSNLTSSVPTFANPFWIEMIVIAKRSMTNSK  450

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             RMPE+ G RLG V VTG ILATMFW++DNSPKGIQERLGFFAFAMSTTFYTCA+ +PVF+
Sbjct  451   RMPELFGIRLGAVLVTGIILATMFWKLDNSPKGIQERLGFFAFAMSTTFYTCAEAIPVFL  510

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETA+NAYRRSSY L+H+L+S P LV+L++ F+ATTFWA GL GG +GFFF++
Sbjct  511   QERYIFMRETAYNAYRRSSYVLAHSLISIPALVVLSISFAATTFWAVGLAGGLSGFFFFF  570

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
               I ASFWAG+SFVTFLS +V HVML + +VVAILAYFLLFSGFF++R RIPLYWIWFHY
Sbjct  571   LTIFASFWAGSSFVTFLSGIVAHVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHY  630

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             ISL+KYPYEAVLQNEF+DPTKCFVRG QMFD+TPL AVP +LK KLL +M   L V IT 
Sbjct  631   ISLVKYPYEAVLQNEFDDPTKCFVRGVQMFDNTPLGAVPVSLKLKLLQSMSSVLGVNITG  690

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             STCVTTG  IL  QG+TD+SKWNCLWI +AWGFLFRILFYF+LLLGS+NKRR
Sbjct  691   STCVTTGRGILVQQGITDISKWNCLWIIIAWGFLFRILFYFTLLLGSKNKRR  742



>ref|XP_009344892.1| PREDICTED: ABC transporter G family member 6-like [Pyrus x bretschneideri]
Length=751

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/480 (73%), Positives = 408/480 (85%), Gaps = 9/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+GLLDRL+ L+RG+TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRLLFLTRGQTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP + ++FGH +PE +NR EFALD+IRELEGSP GTKSLVEF+R W   ++S P
Sbjct  332   SGSPTNLPSYFAEFGHPIPESENRTEFALDIIRELEGSPGGTKSLVEFNRTWQNKKHSNP  391

Query  1254  --------ATAVHNLSLKEAISASVSQGKLVSGATND-ANPVSSVPAYANSLWTEMAVLS  1102
                     + A H + L+EAISAS+S+GKLVSGATN+  +P S VP +AN +W EMAVL+
Sbjct  392   NDASYRGASDARHVVPLQEAISASISRGKLVSGATNNNPSPNSMVPTFANPIWVEMAVLA  451

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
              RS  N RRMPE+ G RLG V VTGFILATMFW++DN+PKG+QERLGF AFAMSTTFYTC
Sbjct  452   NRSMKNARRMPELFGIRLGAVMVTGFILATMFWKLDNTPKGVQERLGFIAFAMSTTFYTC  511

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
             AD LPVF+QERYIF+RETA+NAYRRSSY LSH+LV+ P L+ L+  FSATTFWA GL GG
Sbjct  512   ADALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVALPSLIFLSTAFSATTFWAVGLDGG  571

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
              +GF FY+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP
Sbjct  572   LSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIP  631

Query  561   LYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
              YWIWFHY+SL+KYPYE V+QNEF+DPTKCFVRG Q+FD+TPL  VPAA+K KLL +M +
Sbjct  632   AYWIWFHYLSLVKYPYEGVMQNEFQDPTKCFVRGVQIFDNTPLGTVPAAMKLKLLKSMSQ  691

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TL +RIT+STC+TTGADIL  QGVTDLSKWNCLWITVAWGFLFRILFYF+LLLGS+NKRR
Sbjct  692   TLGMRITTSTCLTTGADILEQQGVTDLSKWNCLWITVAWGFLFRILFYFALLLGSKNKRR  751



>ref|XP_007219556.1| hypothetical protein PRUPE_ppa001878mg [Prunus persica]
 gb|EMJ20755.1| hypothetical protein PRUPE_ppa001878mg [Prunus persica]
Length=749

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/479 (73%), Positives = 407/479 (85%), Gaps = 8/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+GLLDRL+ LSRG+TVY
Sbjct  271   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRLLFLSRGQTVY  330

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP + ++FGH +PE +NR EFALDLIRELEGSP GTKSLVEF+R W   ++S+ 
Sbjct  331   SGSPTTLPSYFAEFGHPIPESENRTEFALDLIRELEGSPGGTKSLVEFNRTWQSMKHSDN  390

Query  1254  ATAV-------HNLSLKEAISASVSQGKLVSGATN-DANPVSSVPAYANSLWTEMAVLSK  1099
              T+        H++SL+EAISAS+S+GKLVSGATN D +P S VP +AN  W EMAVLSK
Sbjct  391   NTSCQIACEPRHSVSLQEAISASISRGKLVSGATNNDPSPNSMVPTFANPFWIEMAVLSK  450

Query  1098  RSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCA  919
             RS  N RRMPE+ G RLG V VTGFILAT+FW +DNSPKG+QERLGF AFAMSTTFYTCA
Sbjct  451   RSMKNARRMPELFGIRLGAVMVTGFILATIFWNLDNSPKGVQERLGFIAFAMSTTFYTCA  510

Query  918   DTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggt  739
             D LPVF+QERYIF+RETA+NAYRRSSY LSH+LV+ P LV L++ FSA TFWA GL GG 
Sbjct  511   DALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVALPSLVFLSIAFSALTFWAVGLDGGL  570

Query  738   agffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPL  559
             +GF FY+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP 
Sbjct  571   SGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPA  630

Query  558   YWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET  379
             YWIWFHY+SL+KYPYE VLQNEF+D TKCFVRG Q+FD+TPL++VP+A+K KLL +M +T
Sbjct  631   YWIWFHYMSLVKYPYEGVLQNEFQDATKCFVRGVQIFDNTPLASVPSAMKLKLLESMSQT  690

Query  378   LNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             L  RITSSTC+TTG DIL  QGVTDLSKWNCL++TVAWGFLFRILFYFSLLLGS+NKRR
Sbjct  691   LGTRITSSTCLTTGTDILKQQGVTDLSKWNCLYVTVAWGFLFRILFYFSLLLGSKNKRR  749



>ref|XP_008354104.1| PREDICTED: ABC transporter G family member 6-like [Malus domestica]
Length=751

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/480 (73%), Positives = 406/480 (85%), Gaps = 9/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+GLLDRL+ L+RG+TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRLLFLTRGQTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP + ++FGH +PE +NR EFALD+IRELEGSP GTKSLVEF+R W   ++S P
Sbjct  332   SGSPANLPSYFAEFGHPIPESENRTEFALDIIRELEGSPGGTKSLVEFNRTWLNKKHSNP  391

Query  1254  --------ATAVHNLSLKEAISASVSQGKLVSGATND-ANPVSSVPAYANSLWTEMAVLS  1102
                     + A H + L+EAISAS+S+GKLVSGATN+  +P S VP +AN +W EMAVL+
Sbjct  392   NDASYRGASDARHVVPLREAISASISRGKLVSGATNNNPSPNSMVPTFANPIWVEMAVLA  451

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
              RS  N RR+PE+ G RLG V VTGFILATMFW +DN+PKG+QERLGF AFAMSTTFYTC
Sbjct  452   NRSMKNARRLPELFGIRLGAVMVTGFILATMFWNLDNTPKGVQERLGFIAFAMSTTFYTC  511

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
             AD LPVF+QERYIF+RETA+NAYRRSSY LSH+LV+ P LVIL+  FS TTFWA GL GG
Sbjct  512   ADALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVALPSLVILSAAFSTTTFWAVGLDGG  571

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
              +GF FY+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP
Sbjct  572   LSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIP  631

Query  561   LYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
              YWIWFHY+SL+KYPYE VLQNEF+DPTKCFVRG Q+FD+TPL  VP A+K KLL +M +
Sbjct  632   AYWIWFHYLSLVKYPYEGVLQNEFQDPTKCFVRGVQIFDNTPLGTVPGAMKLKLLESMSK  691

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TL VRIT+STC+TTGADIL  QGVTDLSKWNCLWITVAWGFLFRILFYF+LLLGS+NKRR
Sbjct  692   TLGVRITTSTCLTTGADILEQQGVTDLSKWNCLWITVAWGFLFRILFYFALLLGSKNKRR  751



>ref|XP_008370127.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
6-like [Malus domestica]
Length=751

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/480 (73%), Positives = 406/480 (85%), Gaps = 9/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+GLLDRL+ L+RG+TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRLLFLTRGQTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP + ++FGH +PE +NR EFALD+IRELEGSP GTKSLVEF+R W   ++S P
Sbjct  332   SGSPANLPSYFAEFGHPIPESENRTEFALDIIRELEGSPGGTKSLVEFNRTWLNKKHSNP  391

Query  1254  --------ATAVHNLSLKEAISASVSQGKLVSGATND-ANPVSSVPAYANSLWTEMAVLS  1102
                     + A H + L+EAISAS+S+GKLVSGATN+  +P S VP +AN +W EMAVL+
Sbjct  392   NDASYRGASDARHVVPLREAISASISRGKLVSGATNNNPSPNSMVPTFANPIWVEMAVLA  451

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
              RS  N RR+PE+ G RLG V VTGFILATMFW +DN+PKG+QERLGF AFAMSTTFYTC
Sbjct  452   NRSMKNARRLPELFGIRLGAVMVTGFILATMFWNLDNTPKGVQERLGFIAFAMSTTFYTC  511

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
             AD LPVF+QERYIF+RETA+NAYRRSSY LSH+LV+ P LVIL+  FS TTFWA GL GG
Sbjct  512   ADALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVALPSLVILSAAFSTTTFWAVGLDGG  571

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
              +GF FY+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP
Sbjct  572   LSGFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIP  631

Query  561   LYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
              YWIWFHY+SL+KYPYE VLQNEF+DPTKCFVRG Q+FD+TPL  VP A+K KLL +M +
Sbjct  632   AYWIWFHYLSLVKYPYEGVLQNEFQDPTKCFVRGXQIFDNTPLGTVPGAMKLKLLESMSK  691

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TL VRIT+STC+TTGADIL  QGVTDLSKWNCLWITVAWGFLFRILFYF+LLLGS+NKRR
Sbjct  692   TLGVRITTSTCLTTGADILEQQGVTDLSKWNCLWITVAWGFLFRILFYFALLLGSKNKRR  751



>ref|XP_003556547.1| PREDICTED: ABC transporter G family member 1-like [Glycine max]
Length=750

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/473 (74%), Positives = 394/473 (83%), Gaps = 3/473 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDR+I LSRG+TVY
Sbjct  277   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMIFLSRGQTVY  336

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG--GRNS  1261
             +GSP  LP + S+FGH +PE DNR EFALDLIRELEGSP GTKSLVEF++ W      + 
Sbjct  337   SGSPSQLPLYFSEFGHPIPETDNRTEFALDLIRELEGSPGGTKSLVEFNKSWQSMTKHHQ  396

Query  1260  EPATAVHNLSLKEAISASVSQGKLVSGATN-DANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
             E     + LSLKEAISAS+S+GKLVSGA+N + NP S VP +AN  W EMA LSKRSF N
Sbjct  397   EKEEERNGLSLKEAISASISRGKLVSGASNTNPNPSSMVPTFANQFWVEMATLSKRSFLN  456

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RRMPE++G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYT AD LPV
Sbjct  457   SRRMPELIGIRLGTVMVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTTADALPV  516

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERYIF+RETA+NAYRR SY +SHALV+ P L  L+L F+A TFWA GL GG +GF F
Sbjct  517   FLQERYIFMRETAYNAYRRLSYLVSHALVALPALAFLSLAFAAATFWAVGLDGGISGFLF  576

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y+ II ASFWAGNSFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIWF
Sbjct  577   YFLIIFASFWAGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYWIWF  636

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HY+SL+KYPYEAVLQNEF+DP KCFVRG Q+FD+TPL +VP  LK KLL  M  TL  +I
Sbjct  637   HYLSLVKYPYEAVLQNEFDDPVKCFVRGVQIFDNTPLGSVPEPLKVKLLETMSSTLGTKI  696

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             T+STC+TTGADIL   GVTDL+KWNC WITVAWGF FR LFY SLLLGS+NKR
Sbjct  697   TTSTCLTTGADILQQNGVTDLTKWNCFWITVAWGFFFRFLFYLSLLLGSKNKR  749



>ref|XP_004236770.1| PREDICTED: ABC transporter G family member 6-like [Solanum lycopersicum]
Length=714

 Score =   683 bits (1762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/471 (72%), Positives = 400/471 (85%), Gaps = 6/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS+RI+ LLDRLI LS G+TVY
Sbjct  250   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSNRILSLLDRLIFLSHGQTVY  309

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             + SP NLPQF +DFGH +PE +NR EFALDLIREL+G+P+GT +LVEF+R+W   ++   
Sbjct  310   SDSPFNLPQFFTDFGHPIPENENRTEFALDLIRELDGTPDGTNNLVEFNRKW---KSCST  366

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
              + +++LSLKEAISAS+S+GKLVSGATN   P S VP +AN +WTEMAVLSKRSFTN  R
Sbjct  367   TSTIYDLSLKEAISASISRGKLVSGATN---PTSMVPTFANPIWTEMAVLSKRSFTNSWR  423

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
             MPEI   R   V VTGFIL+T+FWR+DNSPKGI ERLGF AFA+STT+Y CA+ LPVFI 
Sbjct  424   MPEIFFVRFSAVMVTGFILSTIFWRLDNSPKGIWERLGFIAFAVSTTYYICAEALPVFIH  483

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSYCLSHALVS P L+IL+L F+A TFWA GL GG +GF FY++
Sbjct  484   ERYIFMRETAYNAYRRSSYCLSHALVSLPSLIILSLSFAALTFWAVGLDGGASGFLFYFS  543

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
             ++LAS WAGNSFVTFLS VVPHVM+ Y +VVA+L YFLLFSGF+MNR RIP YWIWFHY+
Sbjct  544   VVLASIWAGNSFVTFLSSVVPHVMIGYTIVVALLGYFLLFSGFYMNRDRIPSYWIWFHYL  603

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYEAVL NEF+DPTKCFVRG Q+FD++ L  +P ++KEKLL  + ETLNV ITSS
Sbjct  604   SLVKYPYEAVLLNEFKDPTKCFVRGVQLFDNSQLGDLPNSIKEKLLDNISETLNVTITSS  663

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TC T+GADIL  QG+T L+KW CLW+T+AWGF +RILFYF+LLLGS+NKRR
Sbjct  664   TCFTSGADILVQQGITQLNKWICLWVTIAWGFSYRILFYFTLLLGSKNKRR  714



>ref|XP_007009605.1| ABC-2 type transporter family protein [Theobroma cacao]
 gb|EOY18415.1| ABC-2 type transporter family protein [Theobroma cacao]
Length=743

 Score =   684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/473 (73%), Positives = 397/473 (84%), Gaps = 5/473 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLI LSRG+TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP + S+FGH +PE +NR EFALDLIRELEGSP GTKSLVEF++ W   ++   
Sbjct  332   SGSPTSLPLYFSEFGHPIPENENRTEFALDLIRELEGSPGGTKSLVEFNKSWQNTKHPIY  391

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
             +EP      LSLK+AISAS+S+GKLVSGA+ND    S VP +AN  W EM VLS RS  N
Sbjct  392   TEPDRL--GLSLKDAISASISRGKLVSGASNDVTSTSMVPRFANPFWKEMVVLSNRSILN  449

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RRMPE+ GTR G V VTGFILAT+FWR+DNSP+G+QER+GFFAFAMSTTFYTCA+ LP 
Sbjct  450   SRRMPELFGTRFGAVMVTGFILATVFWRLDNSPRGVQERIGFFAFAMSTTFYTCANALPD  509

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERYIF+RETA+NAYRR SY +S+ALV+ P L+ L+L F+ATTFWA GL GG +GF F
Sbjct  510   FLQERYIFMRETAYNAYRRLSYVISNALVALPGLIFLSLAFAATTFWAVGLDGGFSGFLF  569

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y+ I+  SFW+G SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIWF
Sbjct  570   YFLIMFGSFWSGCSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPAYWIWF  629

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HY+SLIKYPYEAVLQNEF+ PTKCFVRG Q+FD+TPL+AVP  +K +LL ++  TL + I
Sbjct  630   HYLSLIKYPYEAVLQNEFDHPTKCFVRGIQIFDNTPLAAVPGPMKVRLLQSLSNTLGMTI  689

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             TSSTC+TTG DIL  QG TDLSKWNCLWITVAWGFLFRILFYFSLLLGS+NKR
Sbjct  690   TSSTCLTTGVDILKQQGATDLSKWNCLWITVAWGFLFRILFYFSLLLGSKNKR  742



>ref|XP_010068855.1| PREDICTED: ABC transporter G family member 6-like [Eucalyptus 
grandis]
 gb|KCW65324.1| hypothetical protein EUGRSUZ_G02776 [Eucalyptus grandis]
Length=731

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/475 (73%), Positives = 399/475 (84%), Gaps = 6/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQ GSIV++++HQPS RI+GLLDRL+ LSRG+TVY
Sbjct  259   LFLDEPTSGLDSTSAYMVVKVLQRIAQRGSIVVMTVHQPSYRILGLLDRLLFLSRGQTVY  318

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG----GR  1267
             +GSP +LP F S+FGH +PE +NR EFALDLIRELEGSP GT+SLVEF++ W       R
Sbjct  319   SGSPTSLPLFFSEFGHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQSRKQDAR  378

Query  1266  NSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFT  1087
             NSEP    + LSLKEAI  S+S+GKL+SGATND +P S VP +AN  W EMA+LSKRS T
Sbjct  379   NSEPDR--NGLSLKEAIGVSISRGKLLSGATNDPSPASMVPTFANPFWIEMAILSKRSTT  436

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RRMPE+ G RLG V VTGFILATMFW++DNSPKG+QERLGF AFAMSTTFYTCAD LP
Sbjct  437   NSRRMPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFIAFAMSTTFYTCADALP  496

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+QERYIF+RETAHNAYRR SY LSH+L + P LVILAL FSA TF+  GL GG +GF 
Sbjct  497   VFLQERYIFMRETAHNAYRRWSYVLSHSLTALPALVILALAFSAMTFFPVGLDGGLSGFL  556

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             FY+ II ASFWAG+SFVTFLS V+PHVML Y +VVAILAYFLLFSGFF+NR RIP YWIW
Sbjct  557   FYFLIIFASFWAGSSFVTFLSGVIPHVMLGYTIVVAILAYFLLFSGFFINRDRIPPYWIW  616

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FHY+SL+KYPYE VL+NEF+DP KCFV+G Q+FD+ PL AVP ALK KLL+ +  TL  +
Sbjct  617   FHYLSLVKYPYEGVLRNEFQDPAKCFVKGVQIFDNMPLGAVPDALKLKLLSTISSTLGRK  676

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             IT+STC+TTG  IL  QGVTDLSKW+CLW+TVAWGFLFRILFYFSLLLGS+NKRR
Sbjct  677   ITASTCLTTGTGILQQQGVTDLSKWSCLWVTVAWGFLFRILFYFSLLLGSKNKRR  731



>ref|XP_010558773.1| PREDICTED: ABC transporter G family member 6 [Tarenaya hassleriana]
Length=746

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/471 (73%), Positives = 401/471 (85%), Gaps = 0/471 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIAQSGS+V++++HQPS R++GLLDRL+ LSRG+TV+
Sbjct  276   LFLDEPTSGLDSTSAFIVVKVLKRIAQSGSMVVMTLHQPSYRLLGLLDRLLFLSRGQTVF  335

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP+F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++RW+  +    
Sbjct  336   SGSPTVLPRFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKRWNQTKAEPT  395

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
             +T   N SLKEAISAS+S+GKLVSG T  ++PVSSVP +AN  W E+AVL++RS TN RR
Sbjct  396   STQATNQSLKEAISASISRGKLVSGGTTGSSPVSSVPTFANPFWVELAVLARRSMTNSRR  455

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE+ G RLG V +TGFILATMFWR+DNSPKG+QERLGFFAFAMSTTFYTCAD LPVF+Q
Sbjct  456   RPELFGIRLGAVLITGFILATMFWRLDNSPKGVQERLGFFAFAMSTTFYTCADALPVFLQ  515

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ER+IF+RETA+NAYRRSSY LSH+L + P L++L+L F+ATTFW  GL GG  GF FY+ 
Sbjct  516   ERFIFMRETAYNAYRRSSYVLSHSLTALPALIVLSLAFAATTFWGVGLDGGLMGFLFYFL  575

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
             IILASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIWFHYI
Sbjct  576   IILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYWIWFHYI  635

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYEAVL NEF DPTKCFVRG Q+FD+TPL AVP  +K KLL  M  +L +RITSS
Sbjct  636   SLVKYPYEAVLMNEFSDPTKCFVRGIQIFDNTPLRAVPRGMKVKLLETMSRSLGMRITSS  695

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TC+TTG DIL  QGVTDLSKWNCLW+TVAWGF FRILFY SLLLGS+NKRR
Sbjct  696   TCLTTGYDILQQQGVTDLSKWNCLWVTVAWGFFFRILFYLSLLLGSKNKRR  746



>ref|XP_003592758.1| ABC transporter G family member [Medicago truncatula]
 gb|AES63009.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=754

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/486 (71%), Positives = 397/486 (82%), Gaps = 16/486 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDR+I LSRG+TVY
Sbjct  268   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMIFLSRGQTVY  327

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG-----G  1270
             +GSP  LP + ++FGH +PEGDNR EFALDLIRELEGSP GTKSLVEF++ W        
Sbjct  328   SGSPSQLPSYFAEFGHPIPEGDNRTEFALDLIRELEGSPGGTKSLVEFNKSWQSMTKLHN  387

Query  1269  RNSEPATAVHNLSLKEAISASVSQGKLVSGAT--NDANPVSS---------VPAYANSLW  1123
              N     A  +LSLKEAISAS+S+GKLVSGAT   ++N +++         VP YAN  W
Sbjct  388   NNDISQNATPSLSLKEAISASISRGKLVSGATAATNSNAIATSPSSSSSSIVPTYANPFW  447

Query  1122  TEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAM  943
              E+  LSKRS TN RRMPE+ G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAM
Sbjct  448   IELLTLSKRSITNSRRMPELFGIRLGAVMVTGFILATMFWQLDNSPKGVQERLGFFAFAM  507

Query  942   STTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfw  763
             STTFYT AD LPVFIQER+IF+RET+HNAYRR SY +SHA+V+ P L+ L+L F+  TFW
Sbjct  508   STTFYTTADALPVFIQERFIFMRETSHNAYRRWSYVISHAIVALPALLFLSLAFACITFW  567

Query  762   aaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF  583
             A GL GG +GF FY+ IILASFWAGNSFV+FLS VVPHVML Y +VVAILAYFLLFSGFF
Sbjct  568   AVGLDGGFSGFLFYFVIILASFWAGNSFVSFLSGVVPHVMLGYTIVVAILAYFLLFSGFF  627

Query  582   MNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEK  403
             +NR RIP YWIWFHY+SL+KYPYEAVLQNEF D  KCFVRG Q+FD++PL++V  ALK K
Sbjct  628   INRDRIPGYWIWFHYMSLVKYPYEAVLQNEFSDAAKCFVRGVQIFDNSPLASVSDALKLK  687

Query  402   LLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLL  223
             LL +M +TL ++IT+STC+TTG D+L    VTDLSKWNCLW+TVAWGF FRILFY SLLL
Sbjct  688   LLDSMSDTLGMKITASTCLTTGTDLLKQNAVTDLSKWNCLWVTVAWGFFFRILFYLSLLL  747

Query  222   GSRNKR  205
             GS+NKR
Sbjct  748   GSKNKR  753



>ref|XP_010067225.1| PREDICTED: ABC transporter G family member 6-like [Eucalyptus 
grandis]
Length=760

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/475 (75%), Positives = 410/475 (86%), Gaps = 6/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIV++++HQPS RI+GLLDRL+ LSRG+TVY
Sbjct  288   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVVMTVHQPSYRILGLLDRLLFLSRGQTVY  347

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS----GGR  1267
             +GSP +LP F S+FGH +PE +NR EFALDLIRELEGSP GT+SLVEF++ W     G R
Sbjct  348   SGSPTSLPLFFSEFGHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQSMKQGAR  407

Query  1266  NSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFT  1087
             NSEP    + LSLKEAI AS+S+GKLVSGATNDA+P S VP +AN  W EMAVLSKRS T
Sbjct  408   NSEPDR--NGLSLKEAIGASISRGKLVSGATNDASPASMVPTFANPFWIEMAVLSKRSIT  465

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RRMPE+ G RLG V VTGFILATMFW++DNSPKG+QERLGF AFAMSTTFYTCAD LP
Sbjct  466   NSRRMPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFIAFAMSTTFYTCADALP  525

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+QERYIF+RETA+NAYRR SY LSH+LV+ P LV+LAL FSATTF+A GL GG +GF 
Sbjct  526   VFLQERYIFMRETAYNAYRRWSYVLSHSLVALPALVLLALAFSATTFFAVGLDGGFSGFL  585

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             FY+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIW
Sbjct  586   FYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYWIW  645

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FHY+SL+KYPYE VLQNEF+DPTKCFV+G Q+FD+TPL AVP ++K KLL+ +  TL ++
Sbjct  646   FHYLSLVKYPYEGVLQNEFQDPTKCFVKGVQIFDNTPLGAVPDSVKLKLLSTISNTLGMK  705

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             IT+STC+TTG DIL  QGVTDLSKW+CLW+TVAWGFLFRILFYFSLLLGS+NKRR
Sbjct  706   ITASTCLTTGTDILQQQGVTDLSKWSCLWVTVAWGFLFRILFYFSLLLGSKNKRR  760



>ref|XP_011091494.1| PREDICTED: ABC transporter G family member 1 [Sesamum indicum]
Length=725

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/476 (71%), Positives = 382/476 (80%), Gaps = 9/476 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDR+I LSRG+TVY
Sbjct  253   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRIMGLLDRMIFLSRGKTVY  312

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS----GGR  1267
             +G P NLP F SDFGH +P+ +NR EF LDLIRELEGS  GTKSLVEF++ W     G +
Sbjct  313   SGPPSNLPLFFSDFGHPIPDNENRTEFTLDLIRELEGSSGGTKSLVEFNKSWQALERGNQ  372

Query  1266  NSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFT  1087
              + PA    NLSLKEAISAS+S+GKLVSGA    +  S +P + N  W E AVLSKRSFT
Sbjct  373   INSPAANGSNLSLKEAISASISRGKLVSGAAPSNSSTSMIPTFTNPSWFEFAVLSKRSFT  432

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RRMPE+ G RL  V VTGFILATMFWR+DNSPKGIQERLGFFAFAMSTTFYTCAD LP
Sbjct  433   NSRRMPELFGVRLATVLVTGFILATMFWRLDNSPKGIQERLGFFAFAMSTTFYTCADALP  492

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+QERYIF+RETA+NAYRRSSY LSH+LVS P L+ L+L F+          G    F 
Sbjct  493   VFLQERYIFMRETAYNAYRRSSYVLSHSLVSLPALLFLSLAFA---AITFWPVGLDGSFL  549

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF--MNRARIPLYW  553
             FY+ IILASFWAG+SFVTFLS VVPHVML Y++VVAILAYFLLFSGFF      RIP YW
Sbjct  550   FYFLIILASFWAGSSFVTFLSGVVPHVMLGYVIVVAILAYFLLFSGFFPGAXXXRIPPYW  609

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHYISL+KYPYEAVLQNEF DPTKCFVRG Q+FD TPL AVP ALK K+L +M  +L 
Sbjct  610   IWFHYISLVKYPYEAVLQNEFTDPTKCFVRGIQIFDGTPLGAVPDALKLKILESMSSSLG  669

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             ++ITS TCV TGADIL  Q VTDLSKW+CLW+T+AWGF FR LFY SLL+GS+NKR
Sbjct  670   MKITSGTCVMTGADILKQQVVTDLSKWSCLWVTLAWGFFFRFLFYLSLLIGSKNKR  725



>ref|XP_004308829.1| PREDICTED: ABC transporter G family member 6-like [Fragaria vesca 
subsp. vesca]
Length=747

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/474 (73%), Positives = 406/474 (86%), Gaps = 3/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRL+ LSRG+TV+
Sbjct  274   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLLFLSRGQTVF  333

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP + ++FG  +P+ +N+ EFALDLIRELEGSP GTKSLVEF++ W   +++  
Sbjct  334   SGSPAQLPPYFAEFGRPIPDSENKTEFALDLIRELEGSPGGTKSLVEFNKSWQAMKHTTN  393

Query  1254  ATA--VHNLSLKEAISASVSQGKLVSGATN-DANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
              T    H + L+EAISAS+S+GKLVSGATN DA+P S VP +AN +  E+AVL+KRS  N
Sbjct  394   RTTDTRHVVPLQEAISASISRGKLVSGATNNDASPNSMVPTFANPILVEIAVLAKRSMKN  453

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RRMPE+ G RLG V VTGFILATMFW +DN+PKG+QERLGF AFAMSTTFYTCAD LPV
Sbjct  454   ARRMPELFGIRLGAVMVTGFILATMFWNLDNTPKGVQERLGFIAFAMSTTFYTCADALPV  513

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERYIF+RETA+NAYRRSSY LSH+LV+ P L+ L+  FSATTFWA GL GG +GF F
Sbjct  514   FLQERYIFMRETAYNAYRRSSYVLSHSLVALPSLIFLSAAFSATTFWAVGLDGGLSGFLF  573

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIWF
Sbjct  574   YFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPDYWIWF  633

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HY+SL+KYPYE V+QNEF+DPTKCFVRG Q+FD+TPL+AVPAALK KLL +M ETL ++I
Sbjct  634   HYMSLVKYPYEGVMQNEFQDPTKCFVRGVQIFDNTPLAAVPAALKLKLLDSMSETLGMKI  693

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             T STC+TTG+DIL  QGVTDLSKW+CLWITVAWGFLFRILFYFSLL+GS+NKRR
Sbjct  694   TRSTCLTTGSDILKQQGVTDLSKWSCLWITVAWGFLFRILFYFSLLVGSKNKRR  747



>ref|XP_011019683.1| PREDICTED: ABC transporter G family member 6-like [Populus euphratica]
Length=762

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/475 (74%), Positives = 404/475 (85%), Gaps = 5/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLILLSRG+TVY
Sbjct  287   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLILLSRGQTVY  346

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG---GRN  1264
             +GSP++LP + SDFGH +P+G+NR E+ALDLIRELEGSP GTKSLVEF++ W      RN
Sbjct  347   SGSPMSLPVYFSDFGHPIPDGENRTEYALDLIRELEGSPGGTKSLVEFNKSWHNLKLSRN  406

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDA--NPVSSVPAYANSLWTEMAVLSKRSF  1090
                      LSLKEAISA++S+GKLVSGATN+   +P S VPA+AN +W EMAVLSKRSF
Sbjct  407   GRGEPDGDGLSLKEAISAAISKGKLVSGATNNDAISPNSMVPAFANPVWKEMAVLSKRSF  466

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N RR+PE+ G RLG V VTGFILAT+FW++D+SPKG++ERLGFFAFAMSTTFYTCA+ L
Sbjct  467   MNSRRVPELFGIRLGAVMVTGFILATVFWQLDSSPKGVRERLGFFAFAMSTTFYTCAEAL  526

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QERYIF+RETA+NAYRRSSY LSH LV  P L+ L+  F+ATTFWA GL GG +GF
Sbjct  527   PVFLQERYIFMRETAYNAYRRSSYVLSHGLVVLPSLIFLSFAFAATTFWAVGLDGGLSGF  586

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP  WI
Sbjct  587   LFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSCWI  646

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPYEAVLQNEF+DPTKCFVRG Q+FD +PL  VP +LK KLL +M  TL +
Sbjct  647   WFHYLSLVKYPYEAVLQNEFQDPTKCFVRGVQIFDQSPLGEVPTSLKLKLLESMSNTLGM  706

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              ITSSTC+TTGAD+L  QG+TDLSKWNCLW+TVAWGFLFRILFY SLLLGS+NKR
Sbjct  707   EITSSTCLTTGADVLQQQGITDLSKWNCLWVTVAWGFLFRILFYVSLLLGSKNKR  761



>ref|XP_010669774.1| PREDICTED: ABC transporter G family member 6-like [Beta vulgaris 
subsp. vulgaris]
Length=762

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/479 (71%), Positives = 397/479 (83%), Gaps = 8/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++SIHQPS RI+GLLDRLI LS+G+TV+
Sbjct  284   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVMMSIHQPSYRIMGLLDRLIFLSKGQTVF  343

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNS--  1261
             +GSP +LP +  +FG  +PE +N+ E+ALDLIRELEG+P G K+LVEF + W   + S  
Sbjct  344   SGSPSDLPGYFDEFGKSIPENENKTEYALDLIRELEGAPGGAKALVEFHKGWQMKKRSVF  403

Query  1260  -----EPATAVHNLSLKEAISASVSQGKLVSGATN-DANPVSSVPAYANSLWTEMAVLSK  1099
                   P  +   LSLKEAISAS+S+GKLVSGATN DA+P S VP +AN  W E+  LSK
Sbjct  404   PNIEGAPQDSRGGLSLKEAISASISRGKLVSGATNADASPASMVPTFANPFWNEIVTLSK  463

Query  1098  RSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCA  919
             RS  N RR PE+ G RLG V VTGFILAT+FW++DNSPKG+QERLGFFAFAMSTTFYTCA
Sbjct  464   RSVMNSRRTPELFGIRLGAVLVTGFILATIFWQLDNSPKGVQERLGFFAFAMSTTFYTCA  523

Query  918   DTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggt  739
             D LPVF+QERYIF+RETA+NAYRRSSY LSHAL + P L+ L+  F+ATTFWA GL GG 
Sbjct  524   DALPVFLQERYIFMRETAYNAYRRSSYVLSHALTALPSLIFLSFAFAATTFWAVGLDGGV  583

Query  738   agffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPL  559
             +GFFFY+ II ASFWAGNSFV+FLS VVPHVML Y++VVAILAYFLLFSGFF+NR RIP 
Sbjct  584   SGFFFYFGIIFASFWAGNSFVSFLSGVVPHVMLGYVIVVAILAYFLLFSGFFINRDRIPN  643

Query  558   YWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET  379
             YWIWFHY+SL+KYPYE VLQNEF+DPTKCF+RG Q+FD+TPL AVP A+K +LL  +  +
Sbjct  644   YWIWFHYMSLVKYPYEGVLQNEFQDPTKCFIRGVQIFDNTPLGAVPNAMKVRLLQTISGS  703

Query  378   LNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             L + IT STCVTTGADIL  QGVTDL+KW CLW+TVAWGF FRILFYFSLLLGS+NKRR
Sbjct  704   LGMTITPSTCVTTGADILQQQGVTDLTKWGCLWVTVAWGFFFRILFYFSLLLGSKNKRR  762



>ref|XP_004497331.1| PREDICTED: ABC transporter G family member 1-like [Cicer arietinum]
Length=757

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/488 (70%), Positives = 394/488 (81%), Gaps = 18/488 (4%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQR+AQSGSIVI+SIHQPS RI+GLLDR+I LSRG+TVY
Sbjct  269   LFLDEPTSGLDSTSAFLVVKVLQRVAQSGSIVIMSIHQPSYRILGLLDRMIFLSRGQTVY  328

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP + ++FGH +PEGDNR EFALD+IRELEGSP GTKSLVEF++ W       P
Sbjct  329   SGSPSQLPLYFAEFGHSIPEGDNRTEFALDVIRELEGSPGGTKSLVEFNKSWQSMTKLHP  388

Query  1254  ATAVHN----LSLKEAISASVSQGKLVSG--------------ATNDANPVSSVPAYANS  1129
               +  N    LSLKEAISAS+S+GKLVSG              AT+     S VP YANS
Sbjct  389   EDSSQNATSSLSLKEAISASISKGKLVSGANAAATTTNNSNGNATSSTTTSSMVPTYANS  448

Query  1128  LWTEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAF  949
              W E+A LSKRS TN +RMPE+ G RLG V VTGFILAT+FW +D++PKG+QERLGFFAF
Sbjct  449   FWIELATLSKRSLTNSKRMPELFGIRLGAVFVTGFILATVFWHLDDTPKGVQERLGFFAF  508

Query  948   AMSTTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSatt  769
             AMSTTFYT AD LPVFIQER+IF+RET+HNAYR SSY +SHA+V+ P LV+L+ VF+A T
Sbjct  509   AMSTTFYTTADALPVFIQERFIFMRETSHNAYRISSYLVSHAIVALPALVVLSFVFAAMT  568

Query  768   fwaaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSG  589
             FWA GL GG  GF FY+ I+ ASFWAGNSFV+FLS VVPHVML Y +VVAILAYFLLFSG
Sbjct  569   FWAVGLDGGFKGFMFYFFIMFASFWAGNSFVSFLSGVVPHVMLGYTIVVAILAYFLLFSG  628

Query  588   FFMNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALK  409
             FF+NR RIP YWIWF+Y+SLIKYPYEAVLQNEF DP KCFVRG Q+FD TPLS++P ALK
Sbjct  629   FFINRNRIPKYWIWFNYMSLIKYPYEAVLQNEFSDPMKCFVRGVQIFDSTPLSSIPNALK  688

Query  408   EKLLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSL  229
              KLL  M  TL V+IT STC+TTG D+L   GVTDLSKWNCLW+T+AWGF FRILFYFSL
Sbjct  689   LKLLGDMSNTLGVKITGSTCLTTGVDVLIQTGVTDLSKWNCLWVTLAWGFFFRILFYFSL  748

Query  228   LLGSRNKR  205
             L+GS+NKR
Sbjct  749   LVGSKNKR  756



>ref|XP_009335931.1| PREDICTED: ABC transporter G family member 6-like [Pyrus x bretschneideri]
Length=751

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/480 (71%), Positives = 400/480 (83%), Gaps = 9/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+GLLDRL+ L+RG+TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRLLFLTRGQTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP + ++FG+ +P  +NR EFALD+IRELEGSP GTKSLVEF+R W   ++S P
Sbjct  332   SGSPANLPSYFAEFGYPIPASENRTEFALDVIRELEGSPGGTKSLVEFNRTWQSKKHSNP  391

Query  1254  --------ATAVHNLSLKEAISASVSQGKLVSGATND-ANPVSSVPAYANSLWTEMAVLS  1102
                     + A H + L+EAISAS+S+GKLVSGATN+  +P S VP +AN +W EMAVL+
Sbjct  392   NDASYRGASDARHVVPLQEAISASISRGKLVSGATNNNPSPNSMVPTFANPIWVEMAVLA  451

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
              RS  N RRMPE+ G RLG V VTGFILATMFW +D+SPKG+QERLGF AFAMSTTFYTC
Sbjct  452   NRSMKNARRMPELFGIRLGTVMVTGFILATMFWNLDDSPKGVQERLGFIAFAMSTTFYTC  511

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
             AD LP+F+QERYIF+RETA+NAYRRSSY LSH+LV  P LV L++ FS TTFWA GL GG
Sbjct  512   ADALPIFLQERYIFMRETAYNAYRRSSYVLSHSLVVLPSLVFLSIAFSVTTFWAVGLDGG  571

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
              +GF FY+ II ASFWAG+SFVTFLS VVP VML Y +VVAILAYFLLFSGFF+ R RIP
Sbjct  572   LSGFLFYFLIIFASFWAGSSFVTFLSGVVPQVMLGYTIVVAILAYFLLFSGFFITRNRIP  631

Query  561   LYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
              YWIWFHY+SL+KYPYE VLQNEF++  KCFVRG Q+FD+TPL  VP A+K KLL +M E
Sbjct  632   AYWIWFHYLSLVKYPYEGVLQNEFQNTAKCFVRGIQIFDNTPLGTVPDAMKLKLLDSMSE  691

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TL +RIT STC+TTGADIL  QGVTDLSKWNCLW+TVAWGFLFRILFYF+LLLGS+NKRR
Sbjct  692   TLGMRITRSTCLTTGADILEQQGVTDLSKWNCLWVTVAWGFLFRILFYFALLLGSKNKRR  751



>ref|XP_009357635.1| PREDICTED: ABC transporter G family member 6-like [Pyrus x bretschneideri]
Length=751

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/480 (71%), Positives = 400/480 (83%), Gaps = 9/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+GLLDRL+ L+RG+TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRLLFLTRGQTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP + ++FG+ +PE +NR EFALD+IRELEGSP GTKSLVEF+R W   ++S P
Sbjct  332   SGSPANLPSYFAEFGYPIPESENRTEFALDVIRELEGSPGGTKSLVEFNRTWQSKKHSNP  391

Query  1254  --------ATAVHNLSLKEAISASVSQGKLVSGATND-ANPVSSVPAYANSLWTEMAVLS  1102
                     + A H + L+EAISAS+S+GKLVSGATN+  +P S VP +AN +W EMAVL+
Sbjct  392   NDESYRGASDARHVVPLQEAISASISRGKLVSGATNNNPSPNSMVPTFANPIWVEMAVLA  451

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
              RS  N RRMPE+ G RLG V VTGFILATMFW +D+SPKG+QERLGF AFAMSTTFYTC
Sbjct  452   NRSMKNARRMPELFGIRLGTVMVTGFILATMFWNLDDSPKGVQERLGFIAFAMSTTFYTC  511

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
             AD LP+F+QERYIF+RETA+NAYRRSSY LSH+LV  P LV L++ FS TTFWA GL GG
Sbjct  512   ADALPIFLQERYIFMRETAYNAYRRSSYVLSHSLVVLPSLVFLSIAFSVTTFWAVGLDGG  571

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
              +GF FY+ II ASFWAG+SFVTFLS VVP VML Y +VVAILAYFLLFSGFF+ R RIP
Sbjct  572   LSGFLFYFLIIFASFWAGSSFVTFLSGVVPQVMLGYTIVVAILAYFLLFSGFFITRNRIP  631

Query  561   LYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
              YWIWFHY+SL+KYPYE VLQNEF++  KCFVRG Q+FD+TPL  VP ++K KLL +M E
Sbjct  632   AYWIWFHYLSLVKYPYEGVLQNEFQNTAKCFVRGIQIFDNTPLGTVPDSMKLKLLDSMSE  691

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TL +RIT STC+TTG DIL  QGVTDLSKWNCLW+TVAWGFLFRILFYF+LLLGS+NKRR
Sbjct  692   TLGMRITRSTCLTTGTDILEQQGVTDLSKWNCLWVTVAWGFLFRILFYFALLLGSKNKRR  751



>gb|KDO67830.1| hypothetical protein CISIN_1g037973mg, partial [Citrus sinensis]
Length=525

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/476 (72%), Positives = 394/476 (83%), Gaps = 8/476 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDR+I LSRG+TVY
Sbjct  53    LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMIFLSRGQTVY  112

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG---GRN  1264
             +GSP+NLP F  +FGH +PE +NR EFALDLIRELEGSP GTKSLVEF++ W      RN
Sbjct  113   SGSPMNLPHFFDEFGHPIPENENRTEFALDLIRELEGSPGGTKSLVEFNKTWQNMKQSRN  172

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATND--ANPVSSVPAYANSLWTEMAVLSKRSF  1090
             +   +    LSLKEAISAS+S+GKLVSGATN+  ++P S VP +AN  W EM VLS+RS 
Sbjct  173   TNAHSDSQGLSLKEAISASISRGKLVSGATNNDASSPTSMVPNFANPAWKEMVVLSQRSV  232

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN RRMPE+ G R G V VTGFILAT+FW++D+SPKG+QERLGFFAFAMSTTFYTCAD L
Sbjct  233   TNSRRMPELFGIRAGAVIVTGFILATIFWQLDSSPKGVQERLGFFAFAMSTTFYTCADAL  292

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QERYIF+RETAHNAYRRSSY LSH L S P LV L+  FSA TFWA GL GG    
Sbjct  293   PVFLQERYIFMRETAHNAYRRSSYVLSHTLTSLPALVFLSFAFSAITFWAVGLDGGFFF-  351

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
               Y+ ++ ASFWAGNSFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP YWI
Sbjct  352   --YFLMMFASFWAGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPPYWI  409

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPYEAVLQ+EF +P KCFVRG Q+FD+TPL+AVP A+K +LL  +G TLN+
Sbjct  410   WFHYLSLVKYPYEAVLQSEFGNPVKCFVRGVQIFDNTPLAAVPTAMKVRLLETLGRTLNM  469

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             RIT+STC+TTG DIL  + V  LSKW+CLWITVAWGF FR LFYFSLLLGS+NKRR
Sbjct  470   RITTSTCLTTGVDILDKEAVNQLSKWSCLWITVAWGFFFRFLFYFSLLLGSKNKRR  525



>gb|KFK25590.1| hypothetical protein AALP_AA8G134300 [Arabis alpina]
Length=723

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/476 (72%), Positives = 402/476 (84%), Gaps = 6/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA +V+KVL+RIAQSGS+VI+++HQPS R++ LLDRL+ LSRG+TV+
Sbjct  249   LFLDEPTSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVF  308

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++ +   R +EP
Sbjct  309   SGSPAMLPSFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQ-RKAEP  367

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGAT-----NDANPVSSVPAYANSLWTEMAVLSKRSF  1090
              T    LSLKEAISAS+S+GKLVSGAT     + +NPVS++P +AN  W E  VL+KRS 
Sbjct  368   RTQTTGLSLKEAISASISKGKLVSGATTTTPSSGSNPVSTIPTFANPFWVEFLVLAKRSM  427

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN RR PE+ G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD L
Sbjct  428   TNYRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADAL  487

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QER+IF+RETA+NAYRRSSY LSH+LV+ P L+IL+L F+ATTFW  GL GG  GF
Sbjct  488   PVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAATTFWGVGLDGGLMGF  547

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY+ I+LA+FWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  548   LFYFLIVLAAFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYWI  607

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF DPTKCFV+G Q+FD+TPL AVP  +K KLL  M ++L +
Sbjct  608   WFHYISLVKYPYEAVLINEFSDPTKCFVKGVQIFDNTPLVAVPQGMKVKLLATMSKSLGM  667

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             RITSSTC+TTG DIL  QG+TDLSKWNCLW+TVAWGF FRILFYFSLLLGS+NKRR
Sbjct  668   RITSSTCLTTGYDILQQQGITDLSKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  723



>ref|XP_006403679.1| hypothetical protein EUTSA_v10010147mg [Eutrema salsugineum]
 gb|ESQ45132.1| hypothetical protein EUTSA_v10010147mg [Eutrema salsugineum]
Length=738

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/471 (69%), Positives = 395/471 (84%), Gaps = 3/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQR+AQSGSIVI+SIHQPS RI+GLLDRLI LSRG TVY
Sbjct  271   LFLDEPTSGLDSTSAYMVVKVLQRVAQSGSIVIMSIHQPSYRILGLLDRLIFLSRGNTVY  330

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP ++P+F S++GH +PE +N+ EFALDLIRELE SP+GTK+LVEF ++W   ++S  
Sbjct  331   SGSPTHIPRFFSEYGHPIPENENKTEFALDLIRELEDSPQGTKTLVEFHKQWRAKQSSRQ  390

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
             +    N+SLK+AI+AS+S+GKLVSGA   AN  SS   +AN  WTE+ V+ KRS  N RR
Sbjct  391   SRRNTNVSLKDAINASISRGKLVSGA---ANLKSSFQTFANPFWTEILVIGKRSMLNSRR  447

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE+ G RLG V +TG ILAT+FW++DNSP+GIQERLGFFAFAMSTTFYTCA+ +PVF+Q
Sbjct  448   QPELFGIRLGAVLITGIILATIFWKLDNSPRGIQERLGFFAFAMSTTFYTCAEAIPVFLQ  507

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY L+H ++S P L+IL+  F+ATTFWA GL G + GFFF++ 
Sbjct  508   ERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSASFAATTFWAVGLAGDSEGFFFFFL  567

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              ILA+FWAG+SFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIPLYWIWFHY+
Sbjct  568   TILAAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYL  627

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYE VLQNEFEDPTKCFVRG QMFD++PL  VPAA+K  LL +M   L + +T+ 
Sbjct  628   SLVKYPYEGVLQNEFEDPTKCFVRGIQMFDNSPLGQVPAAVKISLLKSMSGVLGINVTAE  687

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCVTTG DIL  QG+T++SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  688   TCVTTGIDILKQQGITEISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  738



>ref|XP_008364101.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
6-like [Malus domestica]
Length=752

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/481 (72%), Positives = 399/481 (83%), Gaps = 10/481 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+GLLDRL+ L+RG+TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRLLFLTRGQTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP + ++FG+ +PE +NR EFALD+IRELEGSP GTKSLVEFSR W   ++S P
Sbjct  332   SGSPANLPSYFAEFGYPIPESENRTEFALDVIRELEGSPGGTKSLVEFSRTWQSRKHSNP  391

Query  1254  --------ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSS--VPAYANSLWTEMAVL  1105
                     + A H + L+EAISAS+S+GKLVSGA  + NP  +  VP +AN +W EMAVL
Sbjct  392   NDASYRGASDARHVVPLQEAISASISRGKLVSGAXPNNNPSPNSMVPTFANPIWVEMAVL  451

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             + RS  N RRMPE+ G RLG V VTGFILATMFW +D+SPKG+QERLGF AFAMSTTFYT
Sbjct  452   ANRSMKNARRMPELFGIRLGTVMVTGFILATMFWNLDDSPKGVQERLGFIAFAMSTTFYT  511

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             CAD LPVF+QERYIF+RETA+NAYRRSSY LSH+LV  P LV L++ FS TTFWA GL G
Sbjct  512   CADALPVFLQERYIFMRETAYNAYRRSSYVLSHSLVVLPSLVFLSIAFSVTTFWAVGLDG  571

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G +GF FY+ II ASFWAG+SFVTFLS VVP VML Y +VVAILAYFLLFSGFF+ R RI
Sbjct  572   GLSGFLFYFLIIFASFWAGSSFVTFLSGVVPQVMLGYTIVVAILAYFLLFSGFFITRDRI  631

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             P YWIWFHY+SL+KYPYE VLQNEF++  KCFVRGTQ+FD+TPL  VP A+K KLL +M 
Sbjct  632   PAYWIWFHYLSLVKYPYEGVLQNEFQNTAKCFVRGTQIFDNTPLGTVPDAMKLKLLDSMS  691

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             ETL +RIT STC+TTG DIL  QGVTDLSKWNCLW+TVAWGFLFRILFYF+LLLGS+NKR
Sbjct  692   ETLGMRITRSTCLTTGTDILEQQGVTDLSKWNCLWVTVAWGFLFRILFYFALLLGSKNKR  751

Query  204   R  202
             R
Sbjct  752   R  752



>ref|NP_190919.1| ABC transporter G family member 20 [Arabidopsis thaliana]
 sp|Q9LFG8.1|AB20G_ARATH RecName: Full=ABC transporter G family member 20; Short=ABC transporter 
ABCG.20; Short=AtABCG20; AltName: Full=Probable white-brown 
complex homolog protein 20; Short=AtWBC20 [Arabidopsis 
thaliana]
 emb|CAB67658.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AEE79099.1| ABC transporter G family member 20 [Arabidopsis thaliana]
Length=739

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/471 (70%), Positives = 391/471 (83%), Gaps = 3/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LSRG TVY
Sbjct  272   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDKLIFLSRGNTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LPQF S+FGH +PE +N+ EFALDLIRELE SPEGTKSLVEF ++W   + S  
Sbjct  332   SGSPTHLPQFFSEFGHPIPENENKPEFALDLIRELEDSPEGTKSLVEFHKQWRAKQTSSQ  391

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
             +    N+SLK+AISAS+S+GKLVSGATN     SS   +AN  WTEM V+ KRS  N RR
Sbjct  392   SRRNTNVSLKDAISASISRGKLVSGATNLR---SSFQTFANPFWTEMLVIGKRSILNSRR  448

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE+ G RLG V VTG ILAT+FW++DNSP+GIQERLGFFAFAMSTTFYTCA+ +PVF+Q
Sbjct  449   QPELFGIRLGAVLVTGMILATIFWKLDNSPRGIQERLGFFAFAMSTTFYTCAEAIPVFLQ  508

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY L+H ++S P L+IL+  F+A+TF A GL GG+ GF F++ 
Sbjct  509   ERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSAAFAASTFSAVGLAGGSEGFLFFFF  568

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              IL +FWAG+SFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIPLYWIWFHY+
Sbjct  569   TILTAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYL  628

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYE VLQNEFEDPTKCFVRG QMFD++PL  VP A+K  LL +M   L + +T+ 
Sbjct  629   SLVKYPYEGVLQNEFEDPTKCFVRGIQMFDNSPLGQVPTAVKISLLKSMSGVLGINVTAE  688

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCVTTG DIL  QG+T++SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  689   TCVTTGIDILKQQGITEISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  739



>ref|XP_002277271.1| PREDICTED: ABC transporter G family member 20 [Vitis vinifera]
Length=722

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/473 (71%), Positives = 395/473 (84%), Gaps = 5/473 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG TVY
Sbjct  251   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRLIFLSRGNTVY  310

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LP F ++FGH +PE +NR EFALDLIRELEGSP GTK+LVEF++ W   R + P
Sbjct  311   SGSPSSLPLFFAEFGHPIPETENRTEFALDLIRELEGSPGGTKTLVEFNKSWQ--RMTNP  368

Query  1254  ATAVH---NLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
              T V      SLK+AISAS+S+GKLVSGA+NDANP S VP +AN +W EM VL KRS  N
Sbjct  369   QTDVEEGAKPSLKDAISASISRGKLVSGASNDANPASLVPTFANPIWIEMVVLGKRSLKN  428

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              +RMPE+ G RLG V VTG ILAT+F ++D+SPKG+QERLGFFAFAMSTTFYTCA+ +PV
Sbjct  429   SKRMPELFGIRLGAVLVTGIILATIFLQLDSSPKGVQERLGFFAFAMSTTFYTCAEAIPV  488

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERYIF+RETA+NAYRRSSY L+H+++S P LV L+  F+ATT+WA GL GG +GF F
Sbjct  489   FLQERYIFMRETAYNAYRRSSYVLAHSIISIPALVFLSFAFAATTYWAVGLAGGVSGFLF  548

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             ++ +I ASFWAG+SFVTFLS VV HVML Y +VVAILAYFLLFSGFF++R RIP YWIWF
Sbjct  549   FFFMIFASFWAGSSFVTFLSGVVSHVMLGYTVVVAILAYFLLFSGFFISRNRIPPYWIWF  608

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HYISL+KYPYE VL NEFEDP KCFVRG QMFD+TPL AVP ALK +LL +M +TL + I
Sbjct  609   HYISLVKYPYEGVLHNEFEDPMKCFVRGIQMFDNTPLGAVPEALKVRLLKSMSDTLGMSI  668

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             TSSTCVTTG+D+L  QGVTD+SKWNCLWIT+A GF FR +FY +LL GS+NKR
Sbjct  669   TSSTCVTTGSDVLKQQGVTDISKWNCLWITLALGFFFRFMFYLTLLFGSKNKR  721



>ref|XP_010910345.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
1-like [Elaeis guineensis]
Length=677

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/477 (70%), Positives = 394/477 (83%), Gaps = 10/477 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLI LSRG+TVY
Sbjct  205   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVY  264

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGS-PEGTKSLVEFSRRWS-----G  1273
             +G P  LP F S+FGH +PE +NR EFALDLIRELE S P G+K LV+F+R W       
Sbjct  265   SGPPAGLPVFFSEFGHPIPENENRTEFALDLIRELETSGPTGSKPLVDFNRSWQLMKLPP  324

Query  1272  GRNSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRS  1093
             GR S  A     LSLK+AISAS+S+GKLVSGAT+ +   SSVP +AN  W EM VL+KRS
Sbjct  325   GRRSPGA----RLSLKDAISASISRGKLVSGATDGSGSASSVPIFANPFWIEMGVLTKRS  380

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
             FTN RRMPE+   RLG V VTGFILAT+FWR+D+SP+G+QERLGFFAFAMST FYTCAD 
Sbjct  381   FTNTRRMPELFLIRLGAVMVTGFILATIFWRLDSSPRGVQERLGFFAFAMSTMFYTCADA  440

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVFIQERYIF+RETA+NAYRRSSY LS+A+V FP LV+L+  F+ATTF+A GL GG +G
Sbjct  441   LPVFIQERYIFMRETAYNAYRRSSYVLSNAVVGFPSLVLLSAAFAATTFFAVGLSGGLSG  500

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F F++ IILASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YW
Sbjct  501   FVFFFLIILASFWAGSGFVTFLSGVVPHVMLGYTVVVAILAYFLLFSGFFINRERIPGYW  560

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHY+SL+KYPYEAVL+NEF   ++CFVRG Q+FD+TPL  +P A+K+++L A+   L 
Sbjct  561   IWFHYLSLVKYPYEAVLRNEFGMASECFVRGEQIFDNTPLGNIPEAMKQRVLGAISGVLG  620

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +RITS TCVTTG DIL  QG+T L KW+CLW+TVAWGF FR+LFYFSLL+GS+NKRR
Sbjct  621   MRITSGTCVTTGDDILRQQGITQLGKWDCLWVTVAWGFFFRVLFYFSLLIGSKNKRR  677



>ref|XP_010529750.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
20-like [Tarenaya hassleriana]
Length=757

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/483 (68%), Positives = 395/483 (82%), Gaps = 15/483 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG TVY
Sbjct  278   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRLIFLSRGNTVY  337

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW--------  1279
             +GSP NLP+F ++FGH +PE +N+ EFALDLIRELE SPEGTK+LVEF ++W        
Sbjct  338   SGSPENLPRFFAEFGHPIPENENKTEFALDLIRELEDSPEGTKTLVEFHKQWRTKNSSSS  397

Query  1278  ---SGGRNSEPATAVHNLSLKEAISASVSQGKLVSGAT-NDANPVSSVPAYANSLWTEMA  1111
                   +N    T   N+SLK+AISAS+S+GKLVSGA  N +N  SSVP +AN  W EM 
Sbjct  398   CSSCSSKNQNRNT---NVSLKDAISASISRGKLVSGAKKNGSNLTSSVPTFANPYWIEMI  454

Query  1110  VLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTF  931
             V++KR+  N RR PE+ G RLG V VTG ILAT+FW++D+SPKG+QERLGFFAFAMSTTF
Sbjct  455   VIAKRALLNSRRQPELFGIRLGAVLVTGIILATIFWKLDSSPKGVQERLGFFAFAMSTTF  514

Query  930   YTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaagl  751
             YTCA+ +PVF+QERYIF+RETA+NAYRRSSY L+ +++S P L++L+L F+ATT+WA GL
Sbjct  515   YTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAQSIISIPSLIVLSLSFAATTYWAVGL  574

Query  750   gggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRA  571
              GG  GF +++  ILASFWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R 
Sbjct  575   AGGGNGFLYFFLTILASFWAGSSFVTFLSGVVSHVMLGFTVVVAILAYFLLFSGFFISRD  634

Query  570   RIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTA  391
             RIPLYWIWFHYISL+KYPYE VLQNEFEDPTKCFVRG QMFD++PL   P A+K +LL++
Sbjct  635   RIPLYWIWFHYISLVKYPYEGVLQNEFEDPTKCFVRGIQMFDNSPLGQAPLAVKTRLLSS  694

Query  390   MGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRN  211
             M   L + +T+ TCVTTG DIL  QG+TDL KW+C WIT+AWGF FR+LFYF+LL+GS+N
Sbjct  695   MSSVLGINVTAETCVTTGIDILKQQGITDLGKWDCFWITIAWGFFFRVLFYFTLLIGSKN  754

Query  210   KRR  202
             KRR
Sbjct  755   KRR  757



>ref|XP_002877923.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54182.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=737

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/471 (69%), Positives = 393/471 (83%), Gaps = 3/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LSRG TVY
Sbjct  270   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDKLIFLSRGNTVY  329

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LPQF S+FGH +PE +N+ EFALDLIRELE SP+GTK+LVEF ++W   + S  
Sbjct  330   SGSPTHLPQFFSEFGHPIPENENKPEFALDLIRELEDSPQGTKALVEFHKQWRAKQTSSQ  389

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
             +    N+SLK+AISAS+S+GKLVSGATN     SS   +AN  WTEM V+ KRS  N RR
Sbjct  390   SRRNTNVSLKDAISASISKGKLVSGATNLR---SSFQTFANPFWTEMLVIGKRSILNSRR  446

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE+ G RLG V VTG ILAT+FW++DNSP+GIQERLGFFAFAMSTTFYTCA+ +PVF+Q
Sbjct  447   QPELFGMRLGAVLVTGIILATIFWKLDNSPRGIQERLGFFAFAMSTTFYTCAEAIPVFLQ  506

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY L+H ++S P L+IL+  F+ATTFWA GL GG+ GF F++ 
Sbjct  507   ERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSAAFAATTFWAVGLAGGSEGFLFFFF  566

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              IL +FWAG+SFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIP+YWIWFHY+
Sbjct  567   TILTAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIPVYWIWFHYL  626

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYE VLQNEFEDPTKCF+RG QMFD++PL  VPAA+K  LL +M   L + +T+ 
Sbjct  627   SLVKYPYEGVLQNEFEDPTKCFIRGIQMFDNSPLGQVPAAVKISLLKSMSGVLGINVTAE  686

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCVTTG DIL  QG+T++SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  687   TCVTTGIDILKQQGITEISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  737



>ref|XP_010920754.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
6-like [Elaeis guineensis]
Length=749

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/471 (71%), Positives = 393/471 (83%), Gaps = 2/471 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA SGSIVI+S+HQPS RI+GLLDRLI LSRG+TVY
Sbjct  281   LFLDEPTSGLDSTSAFMVVKVLQRIAHSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVY  340

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G+P  LP F SD GH +PE +N  EFALDLIRELE +P G +SLVE+++     + S  
Sbjct  341   SGAPDGLPSFFSDLGHPMPENENPTEFALDLIRELESTPAGCRSLVEYNKSRQATKPS--  398

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
              T   +LSLK+AISAS+S+GKLVSGAT   +P SSVP +AN  W EMAVL+KRS TN RR
Sbjct  399   LTEKPSLSLKDAISASISRGKLVSGATEGTSPASSVPTFANPFWIEMAVLTKRSATNTRR  458

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE+ G RLG V +TGFILAT+FWR+DNSPKG QERLGFFA AMST FYTCAD LPVF+Q
Sbjct  459   TPELFGIRLGAVLLTGFILATIFWRLDNSPKGAQERLGFFAIAMSTMFYTCADALPVFLQ  518

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY LS+A+V FP LV+L++ F+ TTF+A GL GG +GFFF++ 
Sbjct  519   ERYIFMRETAYNAYRRSSYVLSNAIVGFPSLVVLSIAFALTTFFAVGLAGGASGFFFFFL  578

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
             IILASFWAG+ FVTFLS V+ HVM+ Y +VVAILAYFLLFSGFF+NR RIP YWIWFHY+
Sbjct  579   IILASFWAGSGFVTFLSGVISHVMVGYTVVVAILAYFLLFSGFFINRDRIPDYWIWFHYL  638

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYEAVLQNEF+D TKCFVRG QMFD+TPL ++P A+K  +L AM  TL V IT +
Sbjct  639   SLVKYPYEAVLQNEFDDTTKCFVRGVQMFDNTPLGSLPTAVKLNVLKAMSNTLGVSITGN  698

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TC+TTG+DIL  QG+TDLSKWNCLW+TVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  699   TCITTGSDILKQQGITDLSKWNCLWVTVAWGFFFRVLFYFTLLVGSKNKRR  749



>ref|XP_006287124.1| hypothetical protein CARUB_v10000296mg, partial [Capsella rubella]
 gb|EOA20022.1| hypothetical protein CARUB_v10000296mg, partial [Capsella rubella]
Length=749

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/476 (71%), Positives = 403/476 (85%), Gaps = 6/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA +V+KVL+RIAQSGS+VI+++HQPS R++ LLDRL+ LSRG+TV+
Sbjct  275   LFLDEPTSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVF  334

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP+F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++ +   + +EP
Sbjct  335   SGSPAMLPRFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQRKAAEP  394

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGAT-----NDANPVSSVPAYANSLWTEMAVLSKRSF  1090
              T    LSLKEAISAS+S+GKLVSGAT     + +NPVS++P +AN  W E+AVL+KRS 
Sbjct  395   RTQT-GLSLKEAISASISKGKLVSGATTTTPASGSNPVSTIPTFANPFWVELAVLAKRSM  453

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN RR PE+ G RLG V VTGFILATMFW++DNSPKG+QERLG FAFAMSTTFYTCAD L
Sbjct  454   TNSRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGCFAFAMSTTFYTCADAL  513

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QER+IF+RETA+NAYRRSSY LSH+LV+ P L+IL+L F+A TFW  GL GG  GF
Sbjct  514   PVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAAITFWGVGLDGGLMGF  573

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY+ +ILASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  574   LFYFLVILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPGYWI  633

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF DPTKCFVRG Q+FD+TPL AVP  +K +LL  M ++L +
Sbjct  634   WFHYISLVKYPYEAVLLNEFGDPTKCFVRGVQIFDNTPLVAVPQGMKVRLLATMSKSLGM  693

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             RITSSTC+TTG DIL  QGVTDL+KWNCLW+TVAWGF FRILFYFSLLLGS+NKRR
Sbjct  694   RITSSTCLTTGYDILQQQGVTDLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  749



>ref|XP_007142686.1| hypothetical protein PHAVU_007G008200g [Phaseolus vulgaris]
 gb|ESW14680.1| hypothetical protein PHAVU_007G008200g [Phaseolus vulgaris]
Length=757

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/474 (75%), Positives = 393/474 (83%), Gaps = 4/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDR+I LSRG+TVY
Sbjct  283   LFLDEPTSGLDSTSAFLVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMIFLSRGQTVY  342

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG--GRNS  1261
             +GSP  LP F S+FGH +PE DNR EFALDLIRELEGSP GTKSLVEF++ W      N 
Sbjct  343   SGSPSQLPVFFSEFGHPIPETDNRTEFALDLIRELEGSPGGTKSLVEFNKSWQSMTKHNQ  402

Query  1260  EPATAVHN-LSLKEAISASVSQGKLVSGATN-DANPVSSVPAYANSLWTEMAVLSKRSFT  1087
                 A  N LSLKEAISAS+S+GKLVSGATN + NP S VP  AN  W EMA L KRSF 
Sbjct  403   TTTEAERNGLSLKEAISASISRGKLVSGATNTNPNPSSMVPTSANPFWIEMATLWKRSFL  462

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RRMPE+ G RLG V VTGFILATMFW++D+SPKG+QERLGFFAFAMSTTFYT AD LP
Sbjct  463   NSRRMPEVFGIRLGAVMVTGFILATMFWQLDDSPKGVQERLGFFAFAMSTTFYTTADALP  522

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+QERYIF+RETA+NAYRR SY +SHALV+ P L  L+L F+ATTFWA GL GG +GF 
Sbjct  523   VFLQERYIFMRETAYNAYRRLSYLVSHALVALPALAFLSLAFAATTFWAVGLDGGVSGFL  582

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             FY+ II ASFWAGNSFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIW
Sbjct  583   FYFLIIFASFWAGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYWIW  642

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FHY+SL+KYPYEAVLQNEFE   KCFVRG Q+FD+TPL +VP ALK +LL AM  TL + 
Sbjct  643   FHYLSLVKYPYEAVLQNEFEHSLKCFVRGVQIFDNTPLGSVPQALKLQLLDAMSNTLGIN  702

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             IT+STC+TTG+DIL   GVTD SKWNCLWITVAWGF FR LFYFSLLLGS+NKR
Sbjct  703   ITTSTCLTTGSDILRQNGVTDFSKWNCLWITVAWGFFFRFLFYFSLLLGSKNKR  756



>ref|XP_006399852.1| hypothetical protein EUTSA_v10012786mg [Eutrema salsugineum]
 gb|ESQ41305.1| hypothetical protein EUTSA_v10012786mg [Eutrema salsugineum]
Length=733

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/477 (72%), Positives = 404/477 (85%), Gaps = 8/477 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA +V+KVL+RIAQSGS+VI+++HQPS R++ LLDRL+ LSRG+TV+
Sbjct  259   LFLDEPTSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVF  318

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++ +   R +EP
Sbjct  319   SGSPAMLPSFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQ-RKAEP  377

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGAT------NDANPVSSVPAYANSLWTEMAVLSKRS  1093
              T    LSLKEAISAS+S+GKLVSGAT      + +NPVS++P +AN  W E+AVL+KRS
Sbjct  378   RTQT-GLSLKEAISASISKGKLVSGATTTTTPGSGSNPVSTIPTFANPFWVELAVLAKRS  436

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
              TN RR PE+ G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD 
Sbjct  437   MTNYRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADA  496

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVF+QER+IF+RETA+NAYRRSSY LSH+LV+ P L+IL+L F+ATTFW  GL GG  G
Sbjct  497   LPVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAATTFWGVGLDGGLMG  556

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F FY+ I+LA+FWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YW
Sbjct  557   FLFYFLIVLAAFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYW  616

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHYISL+KYPYEAVL NEF DPTKCFVRG Q+FD+TPL AVP  +K +LL  M ++L 
Sbjct  617   IWFHYISLVKYPYEAVLINEFSDPTKCFVRGVQIFDNTPLVAVPQGMKVRLLATMSKSLG  676

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +RITSSTC+TTG DIL  QGVTDLSKWNCLW+TVAWGF FRILFYFSLLLGS+NKRR
Sbjct  677   MRITSSTCLTTGYDILQQQGVTDLSKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  733



>ref|XP_008793934.1| PREDICTED: ABC transporter G family member 20-like [Phoenix dactylifera]
Length=682

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/474 (69%), Positives = 390/474 (82%), Gaps = 7/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA SGSIVI+S+HQPS RI+GLLDRLI LSRG+TVY
Sbjct  213   LFLDEPTSGLDSTSAFMVVKVLQRIAHSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVY  272

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNS--  1261
             +G P  LP F S  GH +PE +N  EFALDLIRELE +P G +SL+E ++     + S  
Sbjct  273   SGPPDGLPPFFSGLGHPMPENENPTEFALDLIRELESTPAGCRSLIEHNKSRQAAKPSIA  332

Query  1260  -EPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
              +P+T    LSLK+AISAS+S+GKLVSGAT    P SSVP +AN  W E AVL+KRS TN
Sbjct  333   EKPST----LSLKDAISASISRGKLVSGATEGTGPASSVPTFANPFWIETAVLTKRSATN  388

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RRMPE+ G RLG V +TGFILAT+FWR+DNSPKG QERLGFFA AMST FYTCAD LPV
Sbjct  389   TRRMPELFGIRLGAVMLTGFILATIFWRLDNSPKGAQERLGFFAIAMSTMFYTCADALPV  448

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERYIF+RETA+NAYRRSSY L +A+V FP L+IL++ F+ TTF+A GL GG +GFFF
Sbjct  449   FLQERYIFMRETAYNAYRRSSYVLCNAIVGFPPLIILSIGFALTTFFAVGLAGGASGFFF  508

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             ++ I+LASFWAG+ FVTFLS V+PHVM+ Y +VVAILAYFLLFSGFF+NR RIP YWIWF
Sbjct  509   FFLIVLASFWAGSGFVTFLSGVIPHVMVGYTVVVAILAYFLLFSGFFINRDRIPDYWIWF  568

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HY+SL+KYPYEAVLQNEF+D TKCFVRG QMFD+TPL ++P A+K  +L AM  TL   +
Sbjct  569   HYLSLVKYPYEAVLQNEFDDTTKCFVRGVQMFDNTPLGSLPTAVKLNVLKAMSNTLGQSL  628

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             T +TC+TTG+DIL  QG+TDLSKWNCLW+TVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  629   TGNTCITTGSDILKQQGITDLSKWNCLWVTVAWGFFFRVLFYFTLLVGSKNKRR  682



>ref|XP_006436144.1| hypothetical protein CICLE_v10030782mg [Citrus clementina]
 ref|XP_006485994.1| PREDICTED: ABC transporter G family member 6-like [Citrus sinensis]
 gb|ESR49384.1| hypothetical protein CICLE_v10030782mg [Citrus clementina]
Length=752

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/476 (72%), Positives = 393/476 (83%), Gaps = 8/476 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDR+I LSRG+TVY
Sbjct  280   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMIFLSRGQTVY  339

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG---GRN  1264
             +GSP+NLP F  +FGH +PE +NR EFALDLIRELEGSP GTKSLVEF++ W      RN
Sbjct  340   SGSPMNLPHFFDEFGHPIPENENRTEFALDLIRELEGSPGGTKSLVEFNKTWQNMKQSRN  399

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATND--ANPVSSVPAYANSLWTEMAVLSKRSF  1090
             +   +    LSLKEAISAS+S+GKLVSGATN+  ++P S VP +AN  W EM VLS+RS 
Sbjct  400   TNAHSDSQGLSLKEAISASISRGKLVSGATNNDASSPTSMVPNFANPAWKEMVVLSQRSV  459

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN RRMPE+ G R G V VTGFILAT+FW++D+SPKG+QERLGFFAFAMSTTFYTCAD L
Sbjct  460   TNSRRMPELFGIRAGAVIVTGFILATIFWQLDSSPKGVQERLGFFAFAMSTTFYTCADAL  519

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QERYIF+RETAHNAYRRSSY LSH L S P LV L+  FSA TFWA GL GG    
Sbjct  520   PVFLQERYIFMRETAHNAYRRSSYVLSHTLTSLPALVFLSFAFSAITFWAVGLDGGFFF-  578

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
               Y+ ++ ASFWAGNSFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP YWI
Sbjct  579   --YFLMMFASFWAGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPPYWI  636

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPYEAVLQ+EF +P KCFVRG Q+FD+TPL+AVP A+K +LL  +  TLN+
Sbjct  637   WFHYLSLVKYPYEAVLQSEFGNPVKCFVRGVQIFDNTPLAAVPTAMKVRLLETLSRTLNM  696

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             RIT+STC+TTG DIL  + V  LSKW+CLWITVAWGF FR LFYFSLLLGS+NKRR
Sbjct  697   RITTSTCLTTGVDILDKEAVNQLSKWSCLWITVAWGFFFRFLFYFSLLLGSKNKRR  752



>ref|XP_002320112.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEE98427.2| ABC transporter family protein [Populus trichocarpa]
Length=746

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/472 (69%), Positives = 392/472 (83%), Gaps = 1/472 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA+SGSIVI+S+HQPS RI+ +LD LI LS G+TVY
Sbjct  275   LFLDEPTSGLDSTSAFMVVKVLQRIARSGSIVIMSVHQPSYRILTVLDSLIFLSHGQTVY  334

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP  LP+F   FGH +PE +NR EFALDLIRELE +P+GTK+LVEF++ W   +N   
Sbjct  335   GGSPGGLPEFFGQFGHPIPENENRTEFALDLIRELEEAPDGTKTLVEFNKSWQTKKNPTN  394

Query  1254  ATA-VHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
              T  V  LSLK+AISAS+S+GKLVSGA N++N  SSVP +AN LW EM V+SKRS  N +
Sbjct  395   RTCNVSKLSLKDAISASISRGKLVSGAPNNSNSTSSVPTFANPLWAEMMVISKRSLLNAK  454

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             RMPE+ G RLG V VTG ILAT+F+ +DNSP+G QERLGFFAFAMSTT+YTCA+++P F+
Sbjct  455   RMPELFGIRLGAVLVTGIILATVFYHLDNSPRGAQERLGFFAFAMSTTYYTCAESIPAFL  514

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETA+NAYRRSSY L+H+L+S P L++L++ F+ATTFWA GL GG +GF FY+
Sbjct  515   QERYIFMRETAYNAYRRSSYVLAHSLISIPSLIVLSIAFAATTFWAVGLDGGFSGFCFYF  574

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
               IL++FWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R R+P YWIWFHY
Sbjct  575   FAILSAFWAGSSFVTFLSGVVSHVMLGFTIVVAILAYFLLFSGFFISRDRVPSYWIWFHY  634

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             ISL+KYPYEA LQNEF DPTKCFVRG QMFD TPL+AVP +LK K+L ++  TL + IT 
Sbjct  635   ISLVKYPYEAALQNEFHDPTKCFVRGVQMFDTTPLAAVPLSLKLKMLKSISSTLGMNITG  694

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +TCV TG DIL  QG+T +SKWNCLW+T+AWGF FRILFYF+LLLGS+NKRR
Sbjct  695   NTCVVTGTDILRQQGITQISKWNCLWVTIAWGFFFRILFYFALLLGSKNKRR  746



>ref|XP_010492119.1| PREDICTED: ABC transporter G family member 6 [Camelina sativa]
Length=728

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/476 (71%), Positives = 402/476 (84%), Gaps = 7/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA +V+KVL+RIAQSGS+VI+++HQPS R++ LLDRL+ LSRG+TV+
Sbjct  255   LFLDEPTSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVF  314

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP+F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++ +   R +EP
Sbjct  315   SGSPAMLPRFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQ-RKAEP  373

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGAT-----NDANPVSSVPAYANSLWTEMAVLSKRSF  1090
              T    LSLKEAISAS+S+GKLVSGA      + +NPVS++P +AN  W E+AVL+KRS 
Sbjct  374   RTQT-GLSLKEAISASISKGKLVSGANTTTPGSGSNPVSTIPTFANPFWVELAVLAKRSM  432

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN RR PE+ G RLG V VTGFILATMFW++DNSPKG+QERLG FAFAMSTTFYTCAD L
Sbjct  433   TNSRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGCFAFAMSTTFYTCADAL  492

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QER+IF+RETA+NAYRRSSY LSH+LV+ P L+IL+L F+A TFW  GL GG  GF
Sbjct  493   PVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAAITFWGVGLDGGLMGF  552

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY+ +ILASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  553   LFYFLVILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPGYWI  612

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF DPTKCFVRG Q+FD+TPL AVP  +K +LL  M ++L +
Sbjct  613   WFHYISLVKYPYEAVLLNEFGDPTKCFVRGVQIFDNTPLVAVPRGMKVRLLATMSKSLGM  672

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             RITSSTC+TTG DIL  QGVTDL+KWNCLW+TVAWGF FRILFYFSLLLGS+NKRR
Sbjct  673   RITSSTCLTTGYDILQQQGVTDLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  728



>ref|XP_010528237.1| PREDICTED: ABC transporter G family member 20-like [Tarenaya 
hassleriana]
Length=750

 Score =   658 bits (1697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/483 (67%), Positives = 394/483 (82%), Gaps = 12/483 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA+SGSIVI+SIHQPS RI+GLLDRLI LSRG TVY
Sbjct  268   LFLDEPTSGLDSTSAFMVVKVLQRIAESGSIVIMSIHQPSYRILGLLDRLIFLSRGNTVY  327

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNS--  1261
             +GSP NLP+F S+FGH +PE +N+ EFALDLIRELE SPEGTK+LVEF ++W   + S  
Sbjct  328   SGSPANLPRFFSEFGHPIPENENKTEFALDLIRELEDSPEGTKTLVEFHKQWRMKQTSSL  387

Query  1260  ---------EPATAVHNLSLKEAISASVSQGKLVSGATND-ANPVSSVPAYANSLWTEMA  1111
                      +      N+SLK+AISAS+S+GKLVSG+T+D AN  SSV  +AN  W EM 
Sbjct  388   NINNNNASRQNQNRNTNVSLKDAISASISRGKLVSGSTSDSANLTSSVSTFANPYWIEMI  447

Query  1110  VLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTF  931
             V+ KR+  N RR PE+ G RLG V VTG ILAT+FW++D+SPKG+QERLGFFAFAMSTTF
Sbjct  448   VIGKRALLNSRRQPELFGIRLGAVLVTGIILATIFWKLDSSPKGVQERLGFFAFAMSTTF  507

Query  930   YTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaagl  751
             YTCA+ +PVF+QERYIF+RETA+NAYRRSSY L+ +++S P L++L++ F+ATTFWA GL
Sbjct  508   YTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAQSIISIPSLIVLSISFAATTFWAVGL  567

Query  750   gggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRA  571
              GG  GF +++  ILASFWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R 
Sbjct  568   AGGGNGFLYFFLTILASFWAGSSFVTFLSGVVSHVMLGFTVVVAILAYFLLFSGFFISRD  627

Query  570   RIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTA  391
             RIPLYWIWFHYISL+KYPYE VLQNEFEDPTKCF RG QMFD++PL   P A+K +LL++
Sbjct  628   RIPLYWIWFHYISLVKYPYEGVLQNEFEDPTKCFARGIQMFDNSPLGQAPEAVKMRLLSS  687

Query  390   MGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRN  211
             M   L + +T+ TCVTTG DIL  QG+ +L KW+CLWIT+AWGF FR+LFYF+LL+GS+N
Sbjct  688   MSGVLGINLTAETCVTTGIDILKQQGIGNLGKWDCLWITIAWGFFFRVLFYFTLLIGSKN  747

Query  210   KRR  202
             KRR
Sbjct  748   KRR  750



>ref|XP_007208058.1| hypothetical protein PRUPE_ppa002035mg [Prunus persica]
 gb|EMJ09257.1| hypothetical protein PRUPE_ppa002035mg [Prunus persica]
Length=725

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/481 (72%), Positives = 395/481 (82%), Gaps = 10/481 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++SIHQPS RI+ LLDRLI LS G+TVY
Sbjct  245   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSIHQPSYRILSLLDRLIFLSHGQTVY  304

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP NLP F  +FGH +PE +NR EFALDLIRELE +P GTKSLVEF+  W   +N + 
Sbjct  305   GGSPANLPVFFREFGHPIPETENRTEFALDLIRELEETPGGTKSLVEFNASWQLNKNQQR  364

Query  1254  ATAVHN----------LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVL  1105
               A  N          LSLK+AISAS+S+GKLVSGA ND +  SSVP +AN  W E+AV+
Sbjct  365   QEADPNNLINSITRPKLSLKDAISASISRGKLVSGAPNDPSLSSSVPTFANPCWIEIAVI  424

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             SKRSFTN RRMPE+ G RLG V VTG ILATMFW++DNSPKG+QERLGFFAFAMSTTFYT
Sbjct  425   SKRSFTNSRRMPELFGIRLGAVLVTGLILATMFWKLDNSPKGVQERLGFFAFAMSTTFYT  484

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             CA+ +P+F+QERYIF+RETA+NAYRRSSY L+H+L+S P L+ L+L F+ATTFWA GL G
Sbjct  485   CAEAIPIFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIFLSLAFAATTFWAVGLAG  544

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G  GF F++  I A+FWAG+SFVTFLS +V HVML Y +VVAILAYFLLFSGFF++R RI
Sbjct  545   GVHGFLFFFFTICAAFWAGSSFVTFLSGIVTHVMLGYTVVVAILAYFLLFSGFFISRDRI  604

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             PLYWIWFHYISL+KYPYE VLQNEF+DPTKCFVRGTQMFD TPL  VP A+K +LL +M 
Sbjct  605   PLYWIWFHYISLVKYPYEGVLQNEFDDPTKCFVRGTQMFDSTPLGTVPVAVKLELLKSMS  664

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              TL V IT STCVTTG DIL  QG+TDLSKW+CLWITVAWGF FR LFYF+LLLGS+NKR
Sbjct  665   TTLGVNITGSTCVTTGTDILKQQGITDLSKWSCLWITVAWGFFFRFLFYFTLLLGSKNKR  724

Query  204   R  202
             R
Sbjct  725   R  725



>ref|XP_002301347.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEE80620.2| ABC transporter family protein [Populus trichocarpa]
Length=740

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/471 (69%), Positives = 391/471 (83%), Gaps = 1/471 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQ GSIVI+S+HQPS RI+ LLDRLI LS G+TVY
Sbjct  269   LFLDEPTSGLDSTSAFMVVKVLQRIAQRGSIVIMSVHQPSYRILTLLDRLIFLSHGQTVY  328

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP+F S FGH +PE +NR EFALDLIRELE +PEGTK+LVEF++ W   +N + 
Sbjct  329   AGSPGSLPEFFSQFGHPIPENENRTEFALDLIRELEEAPEGTKTLVEFNKSWQVMKNPKN  388

Query  1254  AT-AVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                    LSLK+AISAS+S+GKLVSGA N+++  SSVP +AN LW EM V+SKRS  N +
Sbjct  389   KNFNASKLSLKDAISASISRGKLVSGAPNNSSLTSSVPTFANPLWIEMMVISKRSLLNAK  448

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             RMPE+ G RLG V VTG ILAT+F+ +DNSP+G QERLGFFAFAMSTT+YTCA+++P F+
Sbjct  449   RMPELFGIRLGAVLVTGIILATVFYHLDNSPRGAQERLGFFAFAMSTTYYTCAESIPAFL  508

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETA+NAYRRSSY L+H+L+S P LV+L++ F+ATTFWA  L GG +GF F++
Sbjct  509   QERYIFMRETAYNAYRRSSYVLAHSLISIPSLVVLSIAFAATTFWAVRLDGGFSGFCFFF  568

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
               IL++FWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R RIP +W+WFHY
Sbjct  569   FTILSAFWAGSSFVTFLSGVVSHVMLGFTIVVAILAYFLLFSGFFISRDRIPSFWLWFHY  628

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             ISL+KYPYEA LQNEF DPTKCFVRG QMFD TPL+AVP +LK  +L ++  TL + IT 
Sbjct  629   ISLVKYPYEAALQNEFHDPTKCFVRGVQMFDTTPLAAVPISLKLNMLKSISNTLGMNITG  688

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             +TCV TGADIL  QG+TD+SKWNCLWIT+AWGF FRILFYF+LL GS+NKR
Sbjct  689   NTCVVTGADILRQQGITDISKWNCLWITIAWGFFFRILFYFALLFGSKNKR  739



>ref|XP_009341777.1| PREDICTED: ABC transporter G family member 20-like [Pyrus x bretschneideri]
Length=729

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/481 (69%), Positives = 393/481 (82%), Gaps = 10/481 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIV++SIHQPS RI+ L+DRLI LS G+TVY
Sbjct  249   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVVMSIHQPSYRILSLMDRLIFLSHGQTVY  308

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP F  +FGH +PE +NR EFALDLIRELE +P GTK+LVEF++ W    + + 
Sbjct  309   SGSPANLPVFFGEFGHPIPETENRTEFALDLIRELEETPGGTKNLVEFNKSWQITMDEQK  368

Query  1254  ATAVHN----------LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVL  1105
                  N          LSLK+AISAS+S+GKLVSGA ND+N  SSVP +AN  W E+AV+
Sbjct  369   QRENQNNLINSNCKPRLSLKDAISASISRGKLVSGAPNDSNLSSSVPTFANPSWIEIAVI  428

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             SKRS TN RR+PE+ G RLG + VTG ILATMFW +D+SPKGIQERLGFFAFAMSTTFYT
Sbjct  429   SKRSLTNSRRLPELFGIRLGAILVTGIILATMFWHLDDSPKGIQERLGFFAFAMSTTFYT  488

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             CA+ +PVF+QERYIF+RETA+NAYRRSSY L+H+++S P L  L++VF+ATTFWA GL G
Sbjct  489   CAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSIISIPSLAFLSIVFAATTFWAVGLAG  548

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G  GF F++    A+FWAG+SFVTFLS VV HVML Y +VVA+LAYF+LFSGFF++R RI
Sbjct  549   GLHGFLFFFFTTFAAFWAGSSFVTFLSGVVTHVMLGYTVVVAVLAYFVLFSGFFISRDRI  608

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             P YW+WFHYISL+KYPYE VLQNE +DP KCFVRGTQMFD++P+ A P A+K KLL +M 
Sbjct  609   PPYWLWFHYISLVKYPYEGVLQNELDDPIKCFVRGTQMFDNSPIEAFPVAMKLKLLKSMS  668

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              TL V IT+STCVTTG DIL  QG+T+LSKWNCLWIT+AWGF FRILFYF+LLLGS+NKR
Sbjct  669   TTLGVNITASTCVTTGMDILKQQGITELSKWNCLWITIAWGFFFRILFYFALLLGSKNKR  728

Query  204   R  202
             R
Sbjct  729   R  729



>ref|XP_002871574.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47833.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=726

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/475 (72%), Positives = 402/475 (85%), Gaps = 6/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA +V+KVL+RIAQSGS+VI+++HQPS R++ LLDRL+ LSRG+TV+
Sbjct  254   LFLDEPTSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVF  313

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP+F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++ +   R +EP
Sbjct  314   SGSPAMLPRFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQ-RKAEP  372

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATN----DANPVSSVPAYANSLWTEMAVLSKRSFT  1087
              T    LSLKEAISAS+S+GKLVSGAT      ++PVS++P +AN  W E+AVL+KRS T
Sbjct  373   RTQT-GLSLKEAISASISKGKLVSGATTTTTPGSSPVSTIPTFANPFWVELAVLAKRSMT  431

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RR PE+ G RLG V VTGFILATMFW++DNSPKG+QERLG FAFAMSTTFYTCAD LP
Sbjct  432   NSRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGCFAFAMSTTFYTCADALP  491

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+QER+IF+RETA+NAYRRSSY LSH+LV+ P L+IL+L F+A TFW  GL GG  GF 
Sbjct  492   VFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAAITFWGVGLDGGLMGFL  551

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             FY+ +ILASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIW
Sbjct  552   FYFLVILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPGYWIW  611

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FHYISL+KYPYEAVL NEF DPTKCFVRG Q+FD+TPL AVP  +K KLL  M ++L +R
Sbjct  612   FHYISLVKYPYEAVLLNEFGDPTKCFVRGVQIFDNTPLVAVPQGMKVKLLATMSKSLGMR  671

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             ITSSTC+TTG DIL  QGVTDL+KWNCLW+TVAWGF FRILFYFSLLLGS+NKRR
Sbjct  672   ITSSTCLTTGYDILQQQGVTDLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  726



>gb|AIU41650.1| ABC transporter family protein [Hevea brasiliensis]
Length=715

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/474 (69%), Positives = 394/474 (83%), Gaps = 3/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA+SGSIVI+SIHQPS RI+ LLDRLI LS G+TVY
Sbjct  242   LFLDEPTSGLDSTSAFMVVKVLQRIARSGSIVIMSIHQPSYRILSLLDRLIFLSHGQTVY  301

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G P +LP+F ++FGH +PE +NR EFALDLIRELE  P+GT++LVEF+R W       P
Sbjct  302   AGPPGSLPEFFAEFGHPIPENENRTEFALDLIRELEEIPDGTRTLVEFNRSWQAQGKKNP  361

Query  1254  ATAVHN---LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
                + N   LSLK+AISAS+S+GKLVSGATND+N  SSVP +AN  W EM V++KRS TN
Sbjct  362   RNRISNSSNLSLKDAISASISKGKLVSGATNDSNLSSSVPTFANPFWIEMLVIAKRSLTN  421

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RRMPE+ G R G V +TG ILAT+FW +DNSP+G QERLGFFAFAMSTT+YTCA+++P 
Sbjct  422   SRRMPELFGIRFGAVFITGVILATIFWHLDNSPRGAQERLGFFAFAMSTTYYTCAESIPA  481

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERYIF+RETA+NAYRRSSY L+H+L+S P L+IL++ F+ATT+W  GL GG +GFFF
Sbjct  482   FLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIILSIAFAATTYWTVGLAGGASGFFF  541

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             ++  IL++FWAG+SFVTFLS +V HVML + +VVAILAYFLLFSGFF++R RIP YWIWF
Sbjct  542   FFFTILSAFWAGSSFVTFLSGIVSHVMLGFTIVVAILAYFLLFSGFFISRDRIPPYWIWF  601

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HY+SL+KYPYE  LQNEF+DPTKCFVRG QMFD+TPLSAVP ALK KLL ++  TL   +
Sbjct  602   HYLSLVKYPYEGALQNEFQDPTKCFVRGVQMFDNTPLSAVPVALKLKLLQSLSNTLGRNV  661

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             T STC+ TG DIL  QG+TD+SKW+CLWIT+AWGF FR+LFYF+LLLGS+NKRR
Sbjct  662   TGSTCIVTGPDILRGQGITDISKWSCLWITIAWGFFFRVLFYFTLLLGSKNKRR  715



>ref|XP_006411161.1| hypothetical protein EUTSA_v10016300mg [Eutrema salsugineum]
 gb|ESQ52614.1| hypothetical protein EUTSA_v10016300mg [Eutrema salsugineum]
Length=746

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/487 (68%), Positives = 392/487 (80%), Gaps = 16/487 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIAQSGSIVI+SIHQPS R++GLLDRLI LSRG TVY
Sbjct  260   LFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLDRLIFLSRGHTVY  319

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
             +GSP +LP+F ++FG+ +PE +NR EFALDLIRELEGS  GT+ LVEF+++W   +  + 
Sbjct  320   SGSPASLPRFFAEFGNPIPENENRTEFALDLIRELEGSAGGTRGLVEFNKKWQEMKKQKN  379

Query  1257  -------PATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--------SVPAYANSLW  1123
                    PA+   NL+LKEAISAS+S+GKLVSG  + A P          +VPA+AN +W
Sbjct  380   RQPPLTPPASPYPNLTLKEAISASISRGKLVSGGESAAIPHGGGNTTTTLAVPAFANPIW  439

Query  1122  TEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAM  943
              E+  LSKRS  N +R PE+ G RL  V +TGFILAT+FWR+DNSPKG+QERLGFFAFAM
Sbjct  440   IEIKTLSKRSMLNSQRQPELFGIRLASVVITGFILATVFWRLDNSPKGVQERLGFFAFAM  499

Query  942   STTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfw  763
             ST FYTCA+ LPVF+QERYIF+RETA+NAYRRSSY LSHA+VSFP L+ L++ F+ATTFW
Sbjct  500   STMFYTCAEALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSFPSLIFLSIAFAATTFW  559

Query  762   aaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF  583
             A GL GG  G  FY  IILASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF
Sbjct  560   AVGLDGGPMGLLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFF  619

Query  582   MNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEK  403
             +NR RIP YWIWFHY+SL+KYPYEAVLQNEF D TKCFVRG Q+FD+TPL  +P  +K +
Sbjct  620   INRNRIPDYWIWFHYLSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEGMKLR  679

Query  402   LLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLL  223
             LL  +  +L   I+SSTC+TTGADIL  QGVT LSKWNCL +TVA+GF FR+LFYF LLL
Sbjct  680   LLDTVSRSLGTTISSSTCLTTGADILTQQGVTQLSKWNCLLVTVAFGFFFRVLFYFCLLL  739

Query  222   GSRNKRR  202
             GS+NKRR
Sbjct  740   GSKNKRR  746



>ref|XP_011015324.1| PREDICTED: ABC transporter G family member 20-like [Populus euphratica]
Length=746

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/472 (69%), Positives = 391/472 (83%), Gaps = 1/472 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA+SGSIVI+S+HQPS RI+ +LD LI LS G+TVY
Sbjct  275   LFLDEPTSGLDSTSAFMVVKVLQRIARSGSIVIMSVHQPSYRILTVLDSLIFLSHGQTVY  334

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP  LP+F   FGH +PE +NR EFALDLIRELE +P+GTK+LVEF++ W   +N   
Sbjct  335   GGSPGGLPEFFGQFGHPIPENENRTEFALDLIRELEEAPDGTKTLVEFNKSWQTKKNPTN  394

Query  1254  ATAV-HNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
              T     LSLK+AISAS+S+GKLVSGA N++N  SSVP +AN LW EM V+SKRS  N +
Sbjct  395   RTCNGSKLSLKDAISASISRGKLVSGAPNNSNLTSSVPTFANPLWAEMMVISKRSLLNAK  454

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             RMPE+ G RLG V VTG ILAT+F+ +DNSP+G QERLGFFAFAMSTT+YTCA+++P F+
Sbjct  455   RMPELFGIRLGAVLVTGIILATVFYHLDNSPRGAQERLGFFAFAMSTTYYTCAESIPAFL  514

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETA+NAYRRSSY L+H+L+S P L+IL++ F+ATTFWA GL GG +GF FY+
Sbjct  515   QERYIFMRETAYNAYRRSSYVLAHSLISIPSLIILSIAFAATTFWAVGLDGGFSGFCFYF  574

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
               IL++FWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R R+P YW+WFHY
Sbjct  575   FAILSAFWAGSSFVTFLSGVVSHVMLGFTIVVAILAYFLLFSGFFISRDRVPSYWLWFHY  634

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             ISL+KYPYEA LQNEF DPTKCFVRG QMFD TPL+AVP +LK K+L ++  TL + IT 
Sbjct  635   ISLVKYPYEAALQNEFHDPTKCFVRGVQMFDTTPLAAVPLSLKLKMLKSISNTLGMNITG  694

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +TCV TG DIL  QG+T +SKWNCLW+T+AWGF FRILFYF+LLLGS+NKRR
Sbjct  695   NTCVVTGTDILRQQGITQISKWNCLWVTIAWGFFFRILFYFALLLGSKNKRR  746



>ref|XP_010419943.1| PREDICTED: ABC transporter G family member 6-like [Camelina sativa]
Length=728

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/476 (71%), Positives = 401/476 (84%), Gaps = 7/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA +V+KVL+RIAQSGS+VI+++HQPS R++ LLDRL+ LSRG+TV+
Sbjct  255   LFLDEPTSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVF  314

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP+F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++ +   R +EP
Sbjct  315   SGSPAMLPRFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKVFRQ-RKAEP  373

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGAT-----NDANPVSSVPAYANSLWTEMAVLSKRSF  1090
              T    LSLKEAISAS+S+GKLVSGA      + +NPVS++P +AN  W E+ VL+KRS 
Sbjct  374   RTQT-GLSLKEAISASISKGKLVSGANTTTPGSGSNPVSTIPTFANPFWVELVVLAKRSM  432

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN RR PE+ G RLG V VTGFILATMFW++D+SPKG+QERLG FAFAMSTTFYTCAD L
Sbjct  433   TNSRRQPELFGIRLGAVLVTGFILATMFWQLDSSPKGVQERLGCFAFAMSTTFYTCADAL  492

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QER+IF+RETA+NAYRRSSY LSH+LV+ P L+IL+L F+A TFW  GL GG  GF
Sbjct  493   PVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAAITFWGVGLDGGLMGF  552

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY+ +ILASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  553   LFYFLVILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPDYWI  612

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF DPTKCFVRG Q+FD+TPL AVP  +K +LL  M ++L +
Sbjct  613   WFHYISLVKYPYEAVLLNEFGDPTKCFVRGVQIFDNTPLVAVPRGMKVRLLATMSKSLGM  672

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             RITSSTC+TTG DIL  QGVTDL+KWNCLW+TVAWGF FRILFYFSLLLGS+NKRR
Sbjct  673   RITSSTCLTTGYDILQQQGVTDLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  728



>ref|XP_010937796.1| PREDICTED: ABC transporter G family member 6-like [Elaeis guineensis]
Length=737

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/472 (69%), Positives = 387/472 (82%), Gaps = 1/472 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VLQRIA  GSIVI+SIHQPS RI+GLL+ LI LSRG+TVY
Sbjct  266   LFLDEPTSGLDSTSAFKVVNVLQRIAHGGSIVIMSIHQPSYRILGLLNHLIFLSRGQTVY  325

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G P  LP F SDFGH +PE +N  EFALDLIRELE +P G +SLVEF++     + S  
Sbjct  326   SGPPDGLPSFFSDFGHPIPENENPSEFALDLIRELESTPAGARSLVEFNKSRPAAKPSMT  385

Query  1254  A-TAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
             A T   +LSLK+AISAS+S+GKLVSGATN A   SSVP +AN  W E+AVL+KRS TN R
Sbjct  386   ADTEKPSLSLKDAISASISRGKLVSGATNGAGLASSVPTFANPFWIELAVLTKRSATNTR  445

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             RMPE+ G RL  V VTGFILAT++WR+D+SP+G QERLGFFAF+MST FYTCAD LPVF+
Sbjct  446   RMPELFGMRLAAVMVTGFILATVYWRLDDSPRGAQERLGFFAFSMSTMFYTCADALPVFL  505

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETA+NAYRRSSY LS+A+V+FP LV LA+ F+ TTF+A GL GG  GF F++
Sbjct  506   QERYIFMRETAYNAYRRSSYVLSNAIVAFPPLVFLAIAFTLTTFFAVGLAGGATGFLFFF  565

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              IILAS+WAG+ FVTFLS V+ HV++ Y +VVAILAYFLLF GFF++R RIP YWIWFHY
Sbjct  566   LIILASYWAGSGFVTFLSSVISHVIVGYTVVVAILAYFLLFCGFFIDRNRIPDYWIWFHY  625

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             +SL+KYPYEAVLQNEF+D T+CF RG QMFDDTP+ ++P A K  +L AM +TL + +T 
Sbjct  626   LSLVKYPYEAVLQNEFDDSTRCFERGVQMFDDTPMESLPTAKKLDVLKAMSKTLGMNLTG  685

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              TC+TTG+DIL  +GVTDLSKWNC WITVAWGFLFR+LFYF+LL+GS+NKRR
Sbjct  686   DTCITTGSDILRQEGVTDLSKWNCFWITVAWGFLFRVLFYFALLVGSKNKRR  737



>ref|XP_008350411.1| PREDICTED: ABC transporter G family member 20-like [Malus domestica]
Length=729

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/481 (69%), Positives = 392/481 (81%), Gaps = 10/481 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIV++SIHQPS RI+ L+DRLI LS G+TVY
Sbjct  249   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVVMSIHQPSYRILSLMDRLIFLSHGQTVY  308

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP F  +FGH +PE +NR EFALDLIRELE +P GTK+LVEF++ W    + + 
Sbjct  309   SGSPANLPVFFGEFGHPIPETENRTEFALDLIRELEETPGGTKNLVEFNKSWQITLDQQK  368

Query  1254  ATAVHN----------LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVL  1105
                  N          LSLK+AISAS+S+GKLVSGA ND+N  SSVP +AN  W E+AV+
Sbjct  369   QRENQNNLINSNCKPKLSLKDAISASISRGKLVSGAPNDSNLSSSVPTFANPSWIEIAVI  428

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             SKRS TN RRMPE+ G RLG V VTG ILATMFW +DNSPKGIQERLGFFAFAMSTTFYT
Sbjct  429   SKRSLTNSRRMPELFGIRLGAVLVTGIILATMFWHLDNSPKGIQERLGFFAFAMSTTFYT  488

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             CA+ +PVF+QERYIF+RETA+NAYRRSSY L+H+L+S P L  L++ F+ATTFWA GL G
Sbjct  489   CAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLAFLSIAFAATTFWAVGLAG  548

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G  GF F++  I A+FWAG+SFVTFLS VV HVML Y +VVA+LAYFLLFSGFF++R RI
Sbjct  549   GLHGFLFFFFTIFAAFWAGSSFVTFLSGVVTHVMLGYTVVVAVLAYFLLFSGFFISRDRI  608

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             P YW+WFHYISL+KYPYE VLQNE +DP KCFVRGTQMFD++P+ A P A+K KLL +M 
Sbjct  609   PPYWLWFHYISLVKYPYEGVLQNELDDPIKCFVRGTQMFDNSPIEAFPVAMKLKLLKSMS  668

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              TL V IT+STCVTTG DIL  QG+TDLSKW+CLWIT+AWGF FRILFYF+L LGS+NKR
Sbjct  669   TTLGVNITASTCVTTGMDILKQQGITDLSKWSCLWITIAWGFFFRILFYFTLXLGSKNKR  728

Query  204   R  202
             R
Sbjct  729   R  729



>ref|XP_010453438.1| PREDICTED: ABC transporter G family member 6-like [Camelina sativa]
Length=728

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/476 (71%), Positives = 400/476 (84%), Gaps = 7/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA +V+KVL+RIAQSGS+VI+++HQPS R++ LLDRL+ LSRG+TV+
Sbjct  255   LFLDEPTSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVF  314

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++ +   R +EP
Sbjct  315   SGSPAMLPGFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQ-RKAEP  373

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGAT-----NDANPVSSVPAYANSLWTEMAVLSKRSF  1090
              T    LSLKEAISAS+S+GKLVSGA      + +NP S++P +AN  W E+AVL+KRS 
Sbjct  374   RTQT-GLSLKEAISASISKGKLVSGANTTNPDSGSNPGSTIPTFANPFWVELAVLAKRSM  432

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN RR PE+ G RLG V VTGFILATMFW++DNSPKG+QERLG FAFAMSTTFYTCAD L
Sbjct  433   TNSRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGCFAFAMSTTFYTCADAL  492

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QER+IF+RETA+NAYRRSSY LSH+LV+ P L+IL+L F+A TFW  GL GG  GF
Sbjct  493   PVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAAITFWGVGLDGGLIGF  552

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY+ +ILASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  553   LFYFLVILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPGYWI  612

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF DPTKCFVRG Q+FD+TPL AVP  +K +LL  M ++L +
Sbjct  613   WFHYISLVKYPYEAVLLNEFGDPTKCFVRGVQIFDNTPLVAVPRGMKVRLLATMSKSLGM  672

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             RITSSTC+TTG DIL  QGVTDL+KWNCLW+TVAWGF FRILFYFSLLLGS+NKRR
Sbjct  673   RITSSTCLTTGYDILQQQGVTDLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  728



>ref|NP_196862.1| ABC transporter G family member 6 [Arabidopsis thaliana]
 sp|Q9FNB5.1|AB6G_ARATH RecName: Full=ABC transporter G family member 6; Short=ABC transporter 
ABCG.6; Short=AtABCG6; AltName: Full=White-brown complex 
homolog protein 6; Short=AtWBC6 [Arabidopsis thaliana]
 dbj|BAB08684.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AAO41933.1| putative ABC transporter family protein [Arabidopsis thaliana]
 gb|AAO50489.1| putative ABC transporter family protein [Arabidopsis thaliana]
 gb|AED91914.1| ABC transporter G family member 6 [Arabidopsis thaliana]
Length=727

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/476 (71%), Positives = 401/476 (84%), Gaps = 7/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA +V+KVL+RIAQSGS+VI+++HQPS R++ LLDRL+ LSRG+TV+
Sbjct  254   LFLDEPTSGLDSTSALSVIKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVF  313

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP+F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++ +   R +EP
Sbjct  314   SGSPAMLPRFFAEFGHPIPEHENRTEFALDLIRELEGSAGGTRSLVEFNKGFRQ-RKAEP  372

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDAN-----PVSSVPAYANSLWTEMAVLSKRSF  1090
              +    LSLKEAISAS+S+GKLVSGAT   +     PVS++P +AN  W E+AVL+KRS 
Sbjct  373   RSQT-GLSLKEAISASISKGKLVSGATTTTHSSGSSPVSTIPTFANPFWVELAVLAKRSM  431

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN RR PE+ G RLG V VTGFILATMFW++DNSPKG+QERLG FAFAMSTTFYTCAD L
Sbjct  432   TNSRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGCFAFAMSTTFYTCADAL  491

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QER+IF+RETA+NAYRRSSY LSH+LV+ P L+IL+L F+A TFW  GL GG  GF
Sbjct  492   PVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAAITFWGVGLDGGLMGF  551

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY+ +ILASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  552   LFYFLVILASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPGYWI  611

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF DPTKCFVRG Q+FD+TPL AVP  +K +LL  M ++L +
Sbjct  612   WFHYISLVKYPYEAVLLNEFGDPTKCFVRGVQIFDNTPLVAVPQGMKVRLLATMSKSLGM  671

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             RITSSTC+TTG DIL  QGVTDL+KWNCLW+TVAWGF FRILFYFSLLLGS+NKRR
Sbjct  672   RITSSTCLTTGYDILQQQGVTDLTKWNCLWVTVAWGFFFRILFYFSLLLGSKNKRR  727



>ref|XP_010517003.1| PREDICTED: ABC transporter G family member 2 [Camelina sativa]
Length=750

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/472 (68%), Positives = 388/472 (82%), Gaps = 1/472 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ V+KVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LSRG TVY
Sbjct  279   LFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDKLIFLSRGNTVY  338

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LPQF S+F H +PE +N+ EFALDLIRELE S EGTK+LVEF ++W   +    
Sbjct  339   SGSPTHLPQFFSEFEHPIPENENKTEFALDLIRELENSAEGTKTLVEFHKQWRAKQAPSY  398

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATND-ANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                  N++LKEAI+AS+S+GKLVSGATN+ +N  +S   +AN  W EM V+ KR+  N R
Sbjct  399   NNRNTNVTLKEAITASISRGKLVSGATNNTSNLTTSFQTFANPFWIEMIVIGKRAILNSR  458

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE+L  RLG V VTG ILATMF  +DNSPKG+QERLGFFAFAMSTTFYTCA+ +PVF+
Sbjct  459   RQPELLAMRLGAVMVTGIILATMFTNLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFL  518

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETA+NAYRRSSY LS +++S P L+ L+  F+ATTFWA GL GG++GF F+Y
Sbjct  519   QERYIFMRETAYNAYRRSSYVLSQSIISIPALIFLSASFAATTFWAVGLAGGSSGFLFFY  578

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
               ILASFWAG+SFVTFLS VV +VML + +VVAILAYFLLFSGFF++R RIPLYWIWFHY
Sbjct  579   LTILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHY  638

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             +SL+KYPYE VLQNEFEDPTKCFVRG Q+FD++PL  V  A+K  LL +M   L + +T+
Sbjct  639   LSLVKYPYEGVLQNEFEDPTKCFVRGVQIFDNSPLGQVSEAMKLTLLKSMSGVLGINVTA  698

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              TCVTTG DIL  QG+TD+SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  699   ETCVTTGIDILKQQGITDISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  750



>ref|XP_010505317.1| PREDICTED: ABC transporter G family member 2-like [Camelina sativa]
Length=750

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/472 (68%), Positives = 388/472 (82%), Gaps = 1/472 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ V+KVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LSRG TVY
Sbjct  279   LFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDKLIFLSRGNTVY  338

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LPQF S+F H +PE +N+ EFALDLIRELE S EGTK+LVEF ++W   +    
Sbjct  339   SGSPTHLPQFFSEFEHPIPENENKTEFALDLIRELENSAEGTKTLVEFHKQWRAKQAPSY  398

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATND-ANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                  N++LKEAI+AS+S+GKLVSGATN+ +N  +S   +AN  W EM V+ KR+  N R
Sbjct  399   NNRNTNVTLKEAITASISRGKLVSGATNNTSNLTTSFQTFANPFWIEMIVIGKRAILNSR  458

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE+L  RLG V VTG ILATMF  +DNSPKG+QERLGFFAFAMSTTFYTCA+ +PVF+
Sbjct  459   RQPELLAMRLGAVMVTGIILATMFTNLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFL  518

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETA+NAYRRSSY LS +++S P L+ L+  F+ATTFWA GL GG++GF F+Y
Sbjct  519   QERYIFMRETAYNAYRRSSYVLSQSIISIPALIFLSASFAATTFWAVGLAGGSSGFLFFY  578

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
               ILASFWAG+SFVTFLS VV +VML + +VVAILAYFLLFSGFF++R RIPLYWIWFHY
Sbjct  579   LTILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHY  638

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             +SL+KYPYE VLQNEFED TKCFVRG Q+FD++PL  VP A+K  LL +M   L + +T+
Sbjct  639   LSLVKYPYEGVLQNEFEDRTKCFVRGVQIFDNSPLGQVPEAMKLTLLKSMSGVLGINVTA  698

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              TCVTTG DIL  QG+TD+SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  699   ETCVTTGIDILKQQGITDISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  750



>ref|XP_006295587.1| hypothetical protein CARUB_v10024695mg [Capsella rubella]
 gb|EOA28485.1| hypothetical protein CARUB_v10024695mg [Capsella rubella]
Length=753

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/475 (69%), Positives = 392/475 (83%), Gaps = 4/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ V+KVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG TVY
Sbjct  279   LFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDRLIFLSRGNTVY  338

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR---N  1264
             +GSP +LPQF S+F H +PE +N+ EFALDLIRELE S EGTKSLVEF ++W   +   N
Sbjct  339   SGSPAHLPQFFSEFEHPIPENENKTEFALDLIRELENSAEGTKSLVEFHKQWRAKQAPRN  398

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDA-NPVSSVPAYANSLWTEMAVLSKRSFT  1087
             +       N+SLKEAI+AS+S+GKLVSGATN++ N  +S   +AN  W EM V+ KR+  
Sbjct  399   NNGNNRNTNVSLKEAITASISRGKLVSGATNNSSNLTNSFQTFANPFWIEMIVIGKRAIL  458

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RR PE+LG RLG V VTG ILATMF  +DNSPKG+QERLGFFAFAMSTTFYTCA+ +P
Sbjct  459   NSRRQPELLGMRLGAVMVTGIILATMFTNLDNSPKGVQERLGFFAFAMSTTFYTCAEAIP  518

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+QERYIF+RETA+NAYRRSSY LS +++S P L+ L+  F+ATTFWA GL GG++GF 
Sbjct  519   VFLQERYIFMRETAYNAYRRSSYVLSQSIISIPALIFLSASFAATTFWAVGLAGGSSGFL  578

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             F++  ILASFWAG+SFVTFLS VV +VML + +VVAILAYFLLFSGFF++R RIPLYWIW
Sbjct  579   FFFLTILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIW  638

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FHY+SL+KYPYE VLQNEFEDPTKCFVRG Q+FD++PL  VP A+K  LL +M   L + 
Sbjct  639   FHYLSLVKYPYEGVLQNEFEDPTKCFVRGVQIFDNSPLGQVPEAMKLTLLKSMSGVLGIN  698

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +T+ TCVTTG DIL  QG+TD+SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  699   VTAETCVTTGIDILKQQGITDISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  753



>ref|XP_008811960.1| PREDICTED: ABC transporter G family member 20-like [Phoenix dactylifera]
Length=704

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/474 (70%), Positives = 391/474 (82%), Gaps = 3/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA SGSIVI+SIHQPS RI+GLLDRLI L+RG+TVY
Sbjct  231   LFLDEPTSGLDSTSAFMVVKVLQRIAHSGSIVIMSIHQPSYRILGLLDRLIFLARGQTVY  290

Query  1434  TGSPVNLPQFLSDFGHQVPE-GDNRVEFALDLIRELEGSPEGTKSLVEF--SRRWSGGRN  1264
             +G P  LP F SDFGH +PE G N  EFALDLIRELE +P G +SLVEF  SR+ +    
Sbjct  291   SGPPDGLPSFFSDFGHPIPENGQNATEFALDLIRELESTPAGARSLVEFNKSRQAANSSI  350

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
             +  A    +LSLK+AISAS+S+GKLVSGATN   P SSVP +AN  W EMAVL+KRS TN
Sbjct  351   AAAAAEKPSLSLKDAISASISRGKLVSGATNGTGPASSVPTFANPFWIEMAVLTKRSATN  410

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RRMPE+ G RLG V +TGFILAT+FWR+DNSPKG+QERLGFFA AMST FYTCAD LPV
Sbjct  411   TRRMPELFGIRLGAVMLTGFILATIFWRLDNSPKGVQERLGFFAIAMSTMFYTCADALPV  470

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERYIF+RETA+NAYRRSSY LS+A+V FP LV+L++ F+ TTF+A GL GG AGFFF
Sbjct  471   FLQERYIFMRETAYNAYRRSSYVLSNAIVGFPPLVVLSIAFALTTFFAVGLAGGAAGFFF  530

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             ++ IILASFWAG+ FVTFLS V+ HV++ YI+V+AILAYFL+FSGFF+NR RIP YWIWF
Sbjct  531   FFLIILASFWAGSGFVTFLSGVISHVIVGYIVVMAILAYFLIFSGFFINRDRIPDYWIWF  590

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HY+SL+ YPYEAVLQNEF+DPTKCFVRG Q+FD+TP  ++P A K  +L AM   L   +
Sbjct  591   HYLSLVMYPYEAVLQNEFDDPTKCFVRGVQIFDNTPAGSLPTATKLNVLKAMSNALGANL  650

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             T +TC+TTG DIL  QG+TD+SKWNCLW+TVAWGF FR LFYF+LL+GS+NKRR
Sbjct  651   TGNTCITTGPDILKQQGITDISKWNCLWVTVAWGFFFRALFYFTLLVGSKNKRR  704



>ref|NP_181467.1| ABC transporter G family member 1 [Arabidopsis thaliana]
 sp|O80946.1|AB1G_ARATH RecName: Full=ABC transporter G family member 1; Short=ABC transporter 
ABCG.1; Short=AtABCG1; AltName: Full=White-brown complex 
homolog protein 1; Short=AtWBC1 [Arabidopsis thaliana]
 gb|AAC28975.1| putative ABC transporter [Arabidopsis thaliana]
 dbj|BAC42008.1| putative ABC transporter [Arabidopsis thaliana]
 gb|AEC09664.1| ABC transporter G family member 1 [Arabidopsis thaliana]
Length=740

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/486 (67%), Positives = 394/486 (81%), Gaps = 15/486 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIAQSGSIVI+SIHQPS R++GLLDRLI LSRG TVY
Sbjct  255   LFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLDRLIFLSRGHTVY  314

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP+F ++FG  +PE +NR EFALDLIRELEGS  GT+ L+EF+++W   +    
Sbjct  315   SGSPASLPRFFTEFGSPIPENENRTEFALDLIRELEGSAGGTRGLIEFNKKWQEMKKQSN  374

Query  1263  -----SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSS-------VPAYANSLWT  1120
                  + P++   NL+LKEAI+AS+S+GKLVSG  + A+  ++       VPA+AN +W 
Sbjct  375   RQPPLTPPSSPYPNLTLKEAIAASISRGKLVSGGESVAHGGATTNTTTLAVPAFANPMWI  434

Query  1119  EMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMS  940
             E+  LSKRS  N RR PE+ G R+  V +TGFILAT+FWR+DNSPKG+QERLGFFAFAMS
Sbjct  435   EIKTLSKRSMLNSRRQPELFGIRIASVVITGFILATVFWRLDNSPKGVQERLGFFAFAMS  494

Query  939   TTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwa  760
             T FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+VSFP L+ L++ F+ATT+WA
Sbjct  495   TMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSFPSLIFLSVAFAATTYWA  554

Query  759   aglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFM  580
              GL GG  G  FY  IILASFW+G+SFVTFLS VVP VML Y +VVAILAYFLLFSGFF+
Sbjct  555   VGLDGGLTGLLFYCLIILASFWSGSSFVTFLSGVVPSVMLGYTIVVAILAYFLLFSGFFI  614

Query  579   NRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKL  400
             NR RIP YWIWFHY+SL+KYPYEAVLQNEF D TKCFVRG Q+FD+TPL  +P  +K KL
Sbjct  615   NRNRIPDYWIWFHYMSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLKL  674

Query  399   LTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLG  220
             L  + ++L V I+S+TC+TTG+DIL  QGV  LSKWNCL+ITVA+GF FRILFYF+LLLG
Sbjct  675   LGTVSKSLGVTISSTTCLTTGSDILRQQGVVQLSKWNCLFITVAFGFFFRILFYFTLLLG  734

Query  219   SRNKRR  202
             S+NKRR
Sbjct  735   SKNKRR  740



>ref|XP_011023380.1| PREDICTED: ABC transporter G family member 20-like [Populus euphratica]
Length=740

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/471 (68%), Positives = 391/471 (83%), Gaps = 1/471 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQ GSIVI+S+HQPS RI+ LLDRLI LS G+TVY
Sbjct  269   LFLDEPTSGLDSTSAFMVVKVLQRIAQRGSIVIMSVHQPSYRILTLLDRLIFLSHGQTVY  328

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP+F S FGH +PE +NR EFALDLIRELE +PEGTK+LVEF++ W   +N + 
Sbjct  329   AGSPGSLPEFFSQFGHPIPENENRTEFALDLIRELEEAPEGTKTLVEFNKSWQVMKNPKN  388

Query  1254  AT-AVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                    LSLK+AI AS+S+GKLVSGA N+++  SSVP +AN LW EM V+SKRS  N +
Sbjct  389   RNFNASKLSLKDAIGASISRGKLVSGAPNNSSLTSSVPTFANPLWIEMMVISKRSLLNAK  448

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             RMPE+ G RLG V VTG ILAT+F+ +D+SP+G QERLGFFAFAMSTT+YTCA+++P F+
Sbjct  449   RMPELFGIRLGAVLVTGIILATVFYHLDSSPRGAQERLGFFAFAMSTTYYTCAESIPAFL  508

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETA+NAYRRSSY ++H+L+S P LV+L++ F+ATTFWA  L GG +GF F++
Sbjct  509   QERYIFMRETAYNAYRRSSYVIAHSLISIPSLVVLSIAFAATTFWAVRLDGGFSGFCFFF  568

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
               IL++FWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R RIP +W+WFHY
Sbjct  569   FTILSAFWAGSSFVTFLSGVVSHVMLGFTIVVAILAYFLLFSGFFISRDRIPSFWLWFHY  628

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             ISL+KYPYEA LQNEF+D TKCFVRG QMFD TPL+AVP +LK  +L ++  TL + ITS
Sbjct  629   ISLVKYPYEAALQNEFQDSTKCFVRGVQMFDTTPLAAVPLSLKLNMLKSISNTLGMNITS  688

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             +TCV TGADIL  QG+TD+SKWNCLWIT+AWGF FRILFYF+LL GS+NKR
Sbjct  689   NTCVVTGADILRQQGITDISKWNCLWITIAWGFFFRILFYFALLFGSKNKR  739



>ref|XP_010509348.1| PREDICTED: ABC transporter G family member 2-like [Camelina sativa]
Length=749

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/473 (69%), Positives = 391/473 (83%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ V+KVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LSRG TVY
Sbjct  277   LFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDKLIFLSRGNTVY  336

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN-SE  1258
             +GSP +LPQF S+F H +PE +N+ EFALDLIRELE S EGTK+LVEF ++W   +  S 
Sbjct  337   SGSPTHLPQFFSEFEHPIPENENKTEFALDLIRELENSAEGTKTLVEFHKQWRAKQAPSY  396

Query  1257  PATAVHNLSLKEAISASVSQGKLVSGATND-ANPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
                  +N++LKEAI+AS+S+GKLVSGATN+ +N  +S   +AN  W EM V+ KR+  N 
Sbjct  397   NNNRNNNVTLKEAITASISRGKLVSGATNNTSNLTTSFQTFANPFWIEMIVIGKRAILNS  456

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             RR PE+L  RLG V VTG ILATMF  +DNSPKG+QERLGFFAFAMSTTFYTCA+ +PVF
Sbjct  457   RRQPELLAMRLGAVMVTGIILATMFTNLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVF  516

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QERYIF+RETA+NAYRRSSY LS +++S P L+ L+  F+ATTFWA GL GG++GF F+
Sbjct  517   LQERYIFMRETAYNAYRRSSYVLSQSIISIPALIFLSASFAATTFWAVGLAGGSSGFLFF  576

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
             Y  ILASFWAG+SFVTFLS VV +VML + +VVAILAYFLLFSGFF++R RIPLYWIWFH
Sbjct  577   YLTILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFH  636

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPYE VLQNEFEDPTKCFVRG Q+FD++PL  VP A+K  LL +M   L + +T
Sbjct  637   YLSLVKYPYEGVLQNEFEDPTKCFVRGVQIFDNSPLGQVPEAMKLTLLKSMSGVLGINVT  696

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             + TCVTTG DIL  QG+TD+SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  697   AETCVTTGIDILKQQGITDISKWNCLWITVAWGFFFRVLFYFALLIGSKNKRR  749



>emb|CDY09810.1| BnaC09g43510D [Brassica napus]
Length=752

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/477 (72%), Positives = 402/477 (84%), Gaps = 8/477 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA +VVKVL+RIAQSGS+VI+++HQPS R++ LLDRL+ LSRG+TV+
Sbjct  257   LFLDEPTSGLDSTSALSVVKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVF  316

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++ +   R +EP
Sbjct  317   SGSPAMLPSFFAEFGHPIPERENRTEFALDLIRELEGSAGGTRSLVEFNKEFRQ-RKAEP  375

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDAN------PVSSVPAYANSLWTEMAVLSKRS  1093
              T    LSLKEAISAS+S+GKLVSGAT          PVS++P +AN  W E+ VL+KRS
Sbjct  376   RTQT-GLSLKEAISASISKGKLVSGATTATTTGSGSSPVSTIPTFANPFWVELLVLAKRS  434

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
              TN RR PE+ G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD 
Sbjct  435   MTNYRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADA  494

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVF+QER+IF+RETA+NAYRRSSY LSH+LV+ P L+IL+L F+ATTFWA GL GG  G
Sbjct  495   LPVFLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAATTFWAVGLDGGLMG  554

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F FY+ I+LA+FWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP YW
Sbjct  555   FLFYFLIVLAAFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPAYW  614

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHYISL+KYPYEAVL NEF DPTKCF+RG Q+FD+TPL+AVP  +K KLL+ M ++L 
Sbjct  615   IWFHYISLVKYPYEAVLINEFSDPTKCFIRGVQIFDNTPLAAVPQGMKVKLLSTMSKSLG  674

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +RITSSTC+TTG DIL  QGVTDLSKWNCLWITVAWGF FRILFYFSLLLGS+NKRR
Sbjct  675   MRITSSTCLTTGYDILQQQGVTDLSKWNCLWITVAWGFFFRILFYFSLLLGSKNKRR  731



>ref|XP_006295608.1| hypothetical protein CARUB_v10024720mg [Capsella rubella]
 gb|EOA28506.1| hypothetical protein CARUB_v10024720mg [Capsella rubella]
Length=742

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/486 (68%), Positives = 393/486 (81%), Gaps = 15/486 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIAQSGSIVI+SIHQPS R++GLLDRLI LSRG TVY
Sbjct  257   LFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLDRLIFLSRGHTVY  316

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP+F S+FG  +PE +NR EFALDLIRELE S  GT+ LVEF+++W   +    
Sbjct  317   SGSPASLPRFFSEFGSPIPENENRTEFALDLIRELEVSAGGTRGLVEFNKKWQEMKKQSN  376

Query  1263  -----SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSS-------VPAYANSLWT  1120
                  + P++   NL+LKEAI+AS+S+GKLVSG  + AN  ++       VP +AN +W 
Sbjct  377   RQPPLTPPSSPYPNLTLKEAIAASISRGKLVSGGESVANGGTTATSTTLAVPEFANPMWM  436

Query  1119  EMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMS  940
             E+  LSKRS  N RR PE+ G R+  V +TGFILAT+FWR+DNSPKG+QERLGFFAFAMS
Sbjct  437   EIKTLSKRSMLNSRRQPELFGIRVASVVITGFILATVFWRLDNSPKGVQERLGFFAFAMS  496

Query  939   TTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwa  760
             T FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+VS P L+ L+L F+ATT+WA
Sbjct  497   TMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSIPSLIFLSLAFAATTYWA  556

Query  759   aglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFM  580
              GL GG  G  FY  IILA+FW+G+SFVTFLS VVP VML YI+VVAILAYFLLFSGFF+
Sbjct  557   VGLDGGPMGLLFYCLIILAAFWSGSSFVTFLSGVVPSVMLGYIIVVAILAYFLLFSGFFI  616

Query  579   NRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKL  400
             NR RIP YWIWFHY+SL+KYPYEAVLQNEF D TKCFVRG Q+FD+TPL  +P  +K KL
Sbjct  617   NRNRIPDYWIWFHYLSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLKL  676

Query  399   LTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLG  220
             L ++ ++L V I+SSTC+TTGADIL  QG+  LSKWNCL+ITVA+GF FRILFYF+LLLG
Sbjct  677   LGSVSKSLGVTISSSTCLTTGADILKNQGIVQLSKWNCLFITVAFGFFFRILFYFTLLLG  736

Query  219   SRNKRR  202
             S+NKRR
Sbjct  737   SKNKRR  742



>gb|KFK36622.1| hypothetical protein AALP_AA4G147700 [Arabis alpina]
Length=754

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/476 (68%), Positives = 390/476 (82%), Gaps = 5/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ V+KVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG TVY
Sbjct  279   LFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDRLIFLSRGNTVY  338

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
             +GSP +LP+F S+F H +PE +N+ EFALDLIRELE S EGTK LVEF ++W   +    
Sbjct  339   SGSPTHLPRFFSEFNHPIPENENKTEFALDLIRELENSAEGTKELVEFHKQWRTKQAPSY  398

Query  1257  --PATAVHNLSLKEAISASVSQGKLVSGATNDA--NPVSSVPAYANSLWTEMAVLSKRSF  1090
                 +  +N++LKEAI+AS+S+GKLVSGATN++  N  SS   +AN  W EM V+ KR+ 
Sbjct  399   NNNGSRNNNVTLKEAITASISKGKLVSGATNNSTTNLSSSFQTFANPFWIEMIVIGKRAI  458

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N RR PE+LG RLG V VTG ILATMF ++DNSPKG+QERLGFFAFAMSTTFYTCA+ +
Sbjct  459   LNSRRQPELLGMRLGAVMVTGIILATMFTKLDNSPKGVQERLGFFAFAMSTTFYTCAEAI  518

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QERYIF+RETA+NAYRRSSY LS +++S P L+ LA  F+ATTF+A GL GG  GF
Sbjct  519   PVFLQERYIFMRETAYNAYRRSSYVLSQSIISIPSLIFLAASFAATTFFAVGLAGGANGF  578

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              F++  ILASFWAG+SFVTFLS VV +VML + +VVAILAYFLLFSGFF++R RIPLYWI
Sbjct  579   LFFFLTILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWI  638

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPYE VLQNEFEDPTKCFVRG Q+FD++PL  VP A+K  LL +M   L +
Sbjct  639   WFHYLSLVKYPYEGVLQNEFEDPTKCFVRGIQIFDNSPLGQVPNAVKLSLLKSMSGVLGI  698

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              +T+ TCVTTG DIL  QG+TD+SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  699   NVTAETCVTTGVDILKQQGITDISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  754



>ref|XP_011035805.1| PREDICTED: ABC transporter G family member 20-like [Populus euphratica]
Length=746

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/472 (68%), Positives = 390/472 (83%), Gaps = 1/472 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA+SGSIVI+S+HQPS RI+ +LD LI LS G+TVY
Sbjct  275   LFLDEPTSGLDSTSAFMVVKVLQRIARSGSIVIMSVHQPSYRILTVLDSLIFLSHGQTVY  334

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP  LP+F   FGH +PE +NR EFALDLIRELE +P+GTK+LVEF++ W   +N   
Sbjct  335   GGSPGGLPEFFGQFGHPIPENENRTEFALDLIRELEEAPDGTKTLVEFNKSWQTKKNPTN  394

Query  1254  ATAV-HNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
              T     LSLK+AISAS+S+GKLVSGA N++N  SSVP +AN LW EM V+SKRS  N +
Sbjct  395   RTCNGSKLSLKDAISASISRGKLVSGAPNNSNLTSSVPTFANPLWAEMMVISKRSLLNAK  454

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             RMPE+ G RL  V VTG ILAT+F+ +D+SP+G QERLGFFAFAMSTT+YTCA+++P F+
Sbjct  455   RMPELFGIRLAAVLVTGIILATVFYHLDSSPRGAQERLGFFAFAMSTTYYTCAESIPAFL  514

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETA+NAYRRSSY L+H+L+S P L++L++ F+ATTFWA GL GG +GF FY+
Sbjct  515   QERYIFMRETAYNAYRRSSYVLAHSLISIPSLIVLSIAFAATTFWAVGLDGGFSGFCFYF  574

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
               IL++FWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R R+P YW+WFHY
Sbjct  575   FAILSAFWAGSSFVTFLSGVVSHVMLGFTIVVAILAYFLLFSGFFISRDRVPSYWLWFHY  634

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             ISL+KYPYEA LQNEF DPTKCFVRG QMFD TPL+AVP +LK K+L ++  TL + IT 
Sbjct  635   ISLVKYPYEAALQNEFHDPTKCFVRGVQMFDTTPLAAVPLSLKLKMLKSISNTLGMNITG  694

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +TCV TG DIL  QG+T +SKWNCLW+T+AWGF FRILFYF+LLLGS+NKRR
Sbjct  695   NTCVVTGTDILRQQGITQISKWNCLWVTIAWGFFFRILFYFALLLGSKNKRR  746



>emb|CDX74853.1| BnaA05g05990D [Brassica napus]
Length=617

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/485 (67%), Positives = 391/485 (81%), Gaps = 14/485 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVL+RIAQSGSIVI+SIHQPS R++GLL+RLI LSRG TV+
Sbjct  133   LFLDEPTSGLDSTSAYMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLNRLIFLSRGNTVF  192

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP+F ++FG  +PE +NR EFALDLIRELEGS  GT+ L+EF+++W   +    
Sbjct  193   SGSPGSLPRFFAEFGSPIPENENRTEFALDLIRELEGSAGGTRGLIEFNKKWQEMKKENN  252

Query  1263  -----SEPATAVHNLSLKEAISASVSQGKLVSGATNDA------NPVSSVPAYANSLWTE  1117
                  + PA+   NL+LKEAI+AS+S+GKLVSG  + A          +VPA+ANS+W E
Sbjct  253   RQPPLTPPASPYPNLTLKEAIAASISRGKLVSGGESAAISTSTAATTLTVPAFANSIWIE  312

Query  1116  MAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMST  937
             +  LSKRS  N RR PE+ G RL  V +TGFILAT+FWRIDNSPKG+QERLGFFAFAMST
Sbjct  313   IVTLSKRSMLNSRRQPELFGIRLASVVITGFILATVFWRIDNSPKGVQERLGFFAFAMST  372

Query  936   TFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaa  757
              FYTCA+ LPVF+QERYIF+RETA+NAYRRSSY LSHA+V+FP L+ L++ F+ATTFWA 
Sbjct  373   MFYTCAEALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVAFPSLIFLSVAFAATTFWAV  432

Query  756   glgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMN  577
             GL GG  GF FY  IILASFW+G+SFVTFLS +VPHVML Y +VVAILAYFLLFSGFF+N
Sbjct  433   GLDGGPMGFLFYCLIILASFWSGSSFVTFLSGIVPHVMLGYTIVVAILAYFLLFSGFFIN  492

Query  576   RARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLL  397
             R RIP YWIWFHY+SL+KYPYEAVLQNEF D TKCFVRG Q+FD+TPL  +P  +K +LL
Sbjct  493   RNRIPDYWIWFHYMSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGVLPEGMKLRLL  552

Query  396   TAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGS  217
              ++  +L   I+SSTC+TTGADIL  QGVT LSKWNCL ITV +GF FR LFYF LLLGS
Sbjct  553   DSVSRSLGTTISSSTCLTTGADILTQQGVTQLSKWNCLLITVGFGFFFRALFYFCLLLGS  612

Query  216   RNKRR  202
             +NKRR
Sbjct  613   KNKRR  617



>ref|XP_008442601.1| PREDICTED: ABC transporter G family member 20 [Cucumis melo]
Length=726

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/479 (67%), Positives = 394/479 (82%), Gaps = 8/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+ LLDRLI LS G+TVY
Sbjct  248   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDRLIFLSHGQTVY  307

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
             +GSP +LP FL++FGH +P  +NR EFALDL+R+LE +  GTKS+VE ++ W    N   
Sbjct  308   SGSPTDLPNFLAEFGHPIPGNENRTEFALDLVRDLEETVGGTKSMVEHNKSWQRKNNDHL  367

Query  1257  PATAVH-------NLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSK  1099
                 +H       +L LK+AISAS+S+GKLVSGA  D+N  SS   ++N LW E+ V++K
Sbjct  368   EDYEIHRDFSRRFHLCLKDAISASISRGKLVSGAPIDSNRSSSFSKFSNPLWIEILVIAK  427

Query  1098  RSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCA  919
             RS  N RRMPE+ G RLG V +TG ILATMFW +DNSPKGIQERLGFFAFAMSTTFYTCA
Sbjct  428   RSIMNSRRMPELFGIRLGAVLITGIILATMFWHLDNSPKGIQERLGFFAFAMSTTFYTCA  487

Query  918   DTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggt  739
             + +PVF+QERYIF+RETA+NAYRRSSY L+H+L+S P L+IL+L F+ TT++A GL GG 
Sbjct  488   EAIPVFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIILSLTFAGTTYFAVGLAGGF  547

Query  738   agffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPL  559
             +GF F++  +L++FWAG+SFVTFLS VV HVML Y +VVAILAYFLLFSGFF++R R+P 
Sbjct  548   SGFVFFFFAVLSAFWAGSSFVTFLSGVVSHVMLGYTVVVAILAYFLLFSGFFLSRDRMPP  607

Query  558   YWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET  379
             YWIWFHY+SL+KYPYEAVLQNEFE  + CF+RG QMFD+TPL+ VP+A+K +LL +MG+T
Sbjct  608   YWIWFHYMSLVKYPYEAVLQNEFEAKSGCFIRGVQMFDNTPLAVVPSAMKVELLKSMGKT  667

Query  378   LNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             L + IT STCVTTG+D+L  QG+TDLSKWNC+WI++AWGFLFRILFYF+LL GS+NKR+
Sbjct  668   LGLNITGSTCVTTGSDVLRQQGITDLSKWNCIWISMAWGFLFRILFYFALLFGSKNKRK  726



>ref|XP_009141649.1| PREDICTED: ABC transporter G family member 2 [Brassica rapa]
Length=742

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/471 (68%), Positives = 382/471 (81%), Gaps = 0/471 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ V+KVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG TV+
Sbjct  272   LFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDRLIFLSRGNTVF  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LPQF S+F H +PE +N+ EFALDLIRELE SPEGTK LVE+ + W   + +  
Sbjct  332   SGSPTYLPQFFSEFDHPIPENENKTEFALDLIRELENSPEGTKKLVEYHKEWRAKQQAAA  391

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
                 + ++LKEAI+AS+S+GKLVSGA    N  SS   YAN  W EM V+ KRS  N  R
Sbjct  392   RYYNNGITLKEAITASISKGKLVSGAATTTNSPSSFQTYANPFWIEMIVIGKRSVLNSMR  451

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE++G R+G V VTG ILATMF ++DNSPKG+QERLGFFAFAMSTTFYTCA+ +PVF+Q
Sbjct  452   QPELIGMRIGAVMVTGIILATMFTKLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQ  511

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY LS +++S P L+ LA  F+ATTF+A GL GG +GF F++ 
Sbjct  512   ERYIFMRETAYNAYRRSSYVLSQSIISIPSLIFLAACFAATTFFAVGLAGGASGFLFFFL  571

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              ILASFWAG+SFVTFLS VV +VML + +VVAILAYFLLFSGFF++R RIPLYWIWFHY+
Sbjct  572   TILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYL  631

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYE VLQNEFED TKCFVRG Q+FD++PL   P A+K  LL +M   L + +T+ 
Sbjct  632   SLVKYPYEGVLQNEFEDTTKCFVRGIQIFDNSPLGQFPNAVKLSLLKSMSGVLGINVTAE  691

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCVTTG DIL  QGVT++SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  692   TCVTTGIDILKQQGVTEISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  742



>ref|XP_010253396.1| PREDICTED: ABC transporter G family member 6-like [Nelumbo nucifera]
Length=754

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/474 (67%), Positives = 390/474 (82%), Gaps = 4/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL+RIA SGSIVI+SIHQPS RI+GLLDRL+ LSRG+TV+
Sbjct  282   LFLDEPTSGLDSTSAFMVVNVLKRIAASGSIVIMSIHQPSFRIIGLLDRLLFLSRGQTVF  341

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G+P ++P F S+FG  +P+ +N+ EFALD I+ELEG P GTKSLVEF + W    N  P
Sbjct  342   SGTPDDMPNFFSEFGRPIPQNENKTEFALDYIQELEGLPGGTKSLVEFHKSWQQKMN-HP  400

Query  1254  ATAVHN---LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
             +T  ++   L+LK+AI+AS+S+GKLVSGATNDA+  SSVP +AN  WTE+AVLS RS TN
Sbjct  401   STCGYDRQGLTLKDAIAASISRGKLVSGATNDASGTSSVPTFANPFWTEVAVLSNRSMTN  460

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              +RMPE++G RLG V VTG ILAT+FW +DNSPKGIQERLGFFAFAMSTTFYTCA+ +PV
Sbjct  461   AKRMPELVGVRLGAVLVTGIILATIFWHVDNSPKGIQERLGFFAFAMSTTFYTCAEAMPV  520

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+ ERYIF+RETA+NAYRRSSY LS +LVS P L++L+L F+A TFW  GL GG +GF F
Sbjct  521   FLHERYIFMRETAYNAYRRSSYVLSQSLVSIPSLILLSLAFAAVTFWTVGLAGGWSGFLF  580

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y+ II+ASFWAGNSFVTFLS V+   M+ Y +V+++LAYF+LFSGFF+ R RIP YWIW+
Sbjct  581   YFLIIVASFWAGNSFVTFLSGVITQEMMGYTVVLSMLAYFVLFSGFFITRDRIPAYWIWY  640

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HYISL+KYP++ VLQNEF+DP KCFV+G Q+FD+TPL  VP A+K  LL  M  +L + I
Sbjct  641   HYISLVKYPFQGVLQNEFDDPAKCFVKGVQIFDNTPLGMVPEAMKVGLLKKMSSSLGMNI  700

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +S+TCVTTG DIL +QG TDLSKWNCLW TVAWGF FR LFYF+LLLGS+NKR+
Sbjct  701   SSNTCVTTGVDILRMQGTTDLSKWNCLWATVAWGFFFRTLFYFTLLLGSKNKRK  754



>gb|EYU33174.1| hypothetical protein MIMGU_mgv1a026904mg [Erythranthe guttata]
Length=752

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/484 (68%), Positives = 385/484 (80%), Gaps = 16/484 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA+SGS+VI+SIHQPS RI+GLLD++I LSRG+TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIARSGSVVIMSIHQPSYRILGLLDQMIFLSRGKTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G P NLP F SDFGH +P+ DNR EFALDLIR+LEGSP G KS+ EF++ W   +    
Sbjct  332   SGPPSNLPVFFSDFGHPIPDTDNRTEFALDLIRQLEGSPGGIKSMAEFNKSWQSLKKGNL  391

Query  1254  ATAV----------HNLSLKEAISASVSQGKLVSGAT---NDANPVSSVPAYANSLWTEM  1114
             +  +           NLSLKEAISAS+S+GKLVSG T   N+++P + VP+YAN  W E+
Sbjct  392   SNTLCASETNTSTTTNLSLKEAISASISRGKLVSGTTATKNNSSPTAMVPSYANPPWVEL  451

Query  1113  AVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTT  934
             AVLS+RSFTN  RMPE+ G R+  V VTGFILAT+FWR+D+SPKGIQERLGFFAFAMSTT
Sbjct  452   AVLSRRSFTNSWRMPELFGVRVAAVMVTGFILATIFWRLDDSPKGIQERLGFFAFAMSTT  511

Query  933   FYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaag  754
             FYTCAD LPVF+QERYIF+RETA+NAYRRSSY L+HAL     L  L L+  A       
Sbjct  512   FYTCADALPVFLQERYIFMRETAYNAYRRSSYLLAHALT---SLPTLLLLSLAFAAATFW  568

Query  753   lgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNR  574
               G    F FY+ II ASFWAG+SFVTFLS VVPHVML YI+VVAI+AYFLLFSGFF+NR
Sbjct  569   AVGLDGSFLFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYIIVVAIIAYFLLFSGFFINR  628

Query  573   ARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLT  394
              RIP YWIWFHYISL+KYPYEAVLQNEFE+  KCFVRG Q+FD TPL+AVP A+K  LL 
Sbjct  629   DRIPAYWIWFHYISLVKYPYEAVLQNEFENGAKCFVRGVQIFDGTPLAAVPEAMKVNLLA  688

Query  393   AMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSR  214
             +M  TL V ITSS+CVTTGADIL  QGVTDLSKWNCLW+TVAWGF FR LFY ++++GS+
Sbjct  689   SMSGTLGVDITSSSCVTTGADILRQQGVTDLSKWNCLWVTVAWGFFFRFLFYLAVVIGSK  748

Query  213   NKRR  202
             NKRR
Sbjct  749   NKRR  752



>ref|XP_002881649.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57908.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=740

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/486 (68%), Positives = 392/486 (81%), Gaps = 15/486 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIAQSGSIVI+SIHQPS R++GLLDRLI LSRG TVY
Sbjct  255   LFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLDRLIFLSRGHTVY  314

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
             +GSP +LP+F ++FG  +PE +NR EFALDLIRELEGS  GT+ LVEF+++W   +    
Sbjct  315   SGSPASLPRFFTEFGSPIPENENRTEFALDLIRELEGSAGGTRGLVEFNKKWQEMKKQNN  374

Query  1257  -------PATAVHNLSLKEAISASVSQGKLVSGATNDANPVS-------SVPAYANSLWT  1120
                    P +   NL+LKEAI+AS+S+GKLVSG  + A+  +       +VPA+AN +W 
Sbjct  375   RQPPLTPPPSPYPNLTLKEAIAASISRGKLVSGGESVAHGGTTTNTTTLAVPAFANPMWI  434

Query  1119  EMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMS  940
             E+  LSKRS  N RR PEI G R+  V +TGFILAT+FWR+DNSPKG+QERLGFFAFAMS
Sbjct  435   EIKTLSKRSMLNSRRQPEIFGIRIASVVITGFILATVFWRLDNSPKGVQERLGFFAFAMS  494

Query  939   TTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwa  760
             T FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+VSFP L+ L++ F+ATT+WA
Sbjct  495   TMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSFPSLIFLSVAFAATTYWA  554

Query  759   aglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFM  580
              GL GG  G  FY  IILASFW+G+SFVTFLS VVP VML Y +VVAILAYFLLFSGFF+
Sbjct  555   VGLDGGPMGLLFYCLIILASFWSGSSFVTFLSGVVPSVMLGYTIVVAILAYFLLFSGFFI  614

Query  579   NRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKL  400
             NR RIP YWIWFHY+SL+KYPYEAVLQNEF D TKCFVRG Q+FD+TPL  +P  +K +L
Sbjct  615   NRNRIPDYWIWFHYMSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLRL  674

Query  399   LTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLG  220
             L  + ++L V I+SSTC+TTG+DIL  QGV  LSKWNCL+ITVA+GF FRILFYF+LLLG
Sbjct  675   LGTVSKSLGVTISSSTCLTTGSDILTKQGVVQLSKWNCLFITVAFGFFFRILFYFTLLLG  734

Query  219   SRNKRR  202
             S+NKRR
Sbjct  735   SKNKRR  740



>ref|XP_009121752.1| PREDICTED: ABC transporter G family member 6 [Brassica rapa]
Length=726

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/473 (72%), Positives = 403/473 (85%), Gaps = 4/473 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA +VVKVL+RIAQSGS+VI+++HQPS R++ LLDRL+ LSRG+TV+
Sbjct  256   LFLDEPTSGLDSTSALSVVKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVF  315

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++ +   R +EP
Sbjct  316   SGSPAMLPSFFAEFGHPIPERENRTEFALDLIRELEGSAGGTRSLVEFNKEFRQ-RKAEP  374

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDAN--PVSSVPAYANSLWTEMAVLSKRSFTNL  1081
              T    LSLKEAISAS+S+GKLVSGAT+ +   PVS++P +AN  W E+ VL+KRS TN 
Sbjct  375   RTQT-GLSLKEAISASISKGKLVSGATSGSGSSPVSTIPTFANPFWVELLVLAKRSMTNY  433

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             RR PE+ G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD LPVF
Sbjct  434   RRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPVF  493

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QER+IF+RETA+NAYRRSSY LSH+LV+ P L+IL+L F+ATTFWA GL GG  GF FY
Sbjct  494   LQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAATTFWAVGLDGGLMGFLFY  553

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
             + I+LA+FWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP YWIWFH
Sbjct  554   FLIVLAAFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPAYWIWFH  613

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             YISL+KYPYEAVL NEF DPTKCF+RG Q+FD+TPL+AVP  +K KLL+ M ++L +RIT
Sbjct  614   YISLVKYPYEAVLINEFGDPTKCFIRGVQIFDNTPLAAVPQGMKVKLLSTMSKSLGMRIT  673

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             SSTC+TTG DIL  QGVTDLSKWNCLWITVA GF FRILFYFSLLLGS+NKRR
Sbjct  674   SSTCLTTGYDILQQQGVTDLSKWNCLWITVACGFFFRILFYFSLLLGSKNKRR  726



>emb|CDY18451.1| BnaA04g21360D [Brassica napus]
Length=742

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/471 (68%), Positives = 381/471 (81%), Gaps = 0/471 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ V+KVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG TV+
Sbjct  272   LFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDRLIFLSRGNTVF  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LPQF S+F H +PE +N+ EFALDLIRELE SPEGTK LVE+ + W   + +  
Sbjct  332   SGSPTYLPQFFSEFDHPIPENENKTEFALDLIRELENSPEGTKKLVEYHKEWRAKQQAAA  391

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
                 + ++LKEAI+AS+S+GKLVSGA       SS   YAN  W EM V+ KRS  N  R
Sbjct  392   RYYNNGITLKEAITASISKGKLVSGAATTTTSPSSFQTYANPFWIEMIVIGKRSILNSMR  451

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE++G R+G V VTG ILATMF ++DNSPKG+QERLGFFAFAMSTTFYTCA+ +PVF+Q
Sbjct  452   QPELIGMRIGAVMVTGIILATMFTKLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQ  511

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY LS +++S P L+ LA  F+ATTF+A GL GG +GF F++ 
Sbjct  512   ERYIFMRETAYNAYRRSSYVLSQSIISIPSLIFLAACFAATTFFAVGLAGGASGFLFFFL  571

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              ILASFWAG+SFVTFLS VV +VML + +VVAILAYFLLFSGFF++R RIPLYWIWFHY+
Sbjct  572   TILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYL  631

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYE VLQNEFED TKCFVRG Q+FD++PL   P A+K  LL +M   L + +T+ 
Sbjct  632   SLVKYPYEGVLQNEFEDTTKCFVRGIQIFDNSPLGQFPNAVKLSLLKSMSGVLGINVTAE  691

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCVTTG DIL  QGVT++SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  692   TCVTTGIDILKQQGVTEISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  742



>ref|XP_010517272.1| PREDICTED: ABC transporter G family member 1-like [Camelina sativa]
Length=741

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/487 (68%), Positives = 390/487 (80%), Gaps = 16/487 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIAQSGSIVI+SIHQPS R++ LLDRLI LSRG TVY
Sbjct  255   LFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLSLLDRLIFLSRGHTVY  314

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
             +GSP +LP+F S+FG  +PE +NR EFALDLIRELEGS  GT+ LVEF+++W   +    
Sbjct  315   SGSPASLPRFFSEFGSPIPENENRTEFALDLIRELEGSAGGTRGLVEFNKKWQEMKKQNN  374

Query  1257  -------PATAVHNLSLKEAISASVSQGKLVSGATNDAN--------PVSSVPAYANSLW  1123
                    P++   NL+LKEAI+AS+S+GKLVSG  + AN           +VP +AN +W
Sbjct  375   RQPPLTPPSSPYPNLTLKEAIAASISRGKLVSGGESVANGGTTATSTTTLAVPEFANPMW  434

Query  1122  TEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAM  943
              E+  LSKRS  N RR PE+ G R+  V +TGFILAT+FWR+DNSPKG+QERLGFFAFAM
Sbjct  435   IEIKTLSKRSMLNSRRQPELFGIRVASVVITGFILATVFWRLDNSPKGVQERLGFFAFAM  494

Query  942   STTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfw  763
             ST FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+VS P L+ L+L F+ATT+W
Sbjct  495   STMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSIPSLIFLSLAFAATTYW  554

Query  762   aaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF  583
             A GLGGG  G  FY  IILASFW+G+SFVTFLS VVP VML YI+VVAILAYFLLFSGFF
Sbjct  555   AVGLGGGPMGLLFYCLIILASFWSGSSFVTFLSGVVPSVMLGYIIVVAILAYFLLFSGFF  614

Query  582   MNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEK  403
             +NR RIP YWIWFHY+SL+KYPYEAVLQNEF D TKCFVRG Q+FD+TPL  +P  +K  
Sbjct  615   INRNRIPDYWIWFHYLSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLN  674

Query  402   LLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLL  223
             LL ++ ++L V I+S+TC+TTGADIL  QGV  LSKWNCL +TVA+GF FRILFYF+LLL
Sbjct  675   LLGSVSKSLGVTISSTTCLTTGADILKNQGVVQLSKWNCLLVTVAFGFFFRILFYFTLLL  734

Query  222   GSRNKRR  202
             GS+NKRR
Sbjct  735   GSKNKRR  741



>ref|XP_010516065.1| PREDICTED: ABC transporter G family member 16 [Camelina sativa]
Length=738

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/484 (67%), Positives = 391/484 (81%), Gaps = 13/484 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIVI+SIHQPS R++ LLDRLI LSRG TV+
Sbjct  255   LFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVIMSIHQPSHRVLSLLDRLIFLSRGHTVF  314

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP F + FG+ +PE +N+ EF LDLIRELEGS  GT++LVEF+++W   +    
Sbjct  315   SGSPASLPSFFAGFGNPIPENENQTEFTLDLIRELEGSAGGTRALVEFNKKWQEMKKQSN  374

Query  1263  ----SEPATAVHNLSLKEAISASVSQGKLVSG------ATNDANPVSSVPAYANSLWTEM  1114
                 + PA+   NL+LKEAISAS+S+GKLVSG      A N      +VPA+AN  W E+
Sbjct  375   PQTLTPPASPNPNLTLKEAISASISRGKLVSGGGAGSSAVNHGGGTLAVPAFANPFWIEI  434

Query  1113  AVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTT  934
               L++RS  N RR PE++G RL  V+VTGFILAT+FWR+DNSPKG+QERLGFFAFAMST 
Sbjct  435   KTLTQRSILNSRRQPELIGMRLATVTVTGFILATVFWRLDNSPKGVQERLGFFAFAMSTM  494

Query  933   FYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaag  754
             FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+V+FP L+ L++ F+ATTFWA G
Sbjct  495   FYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSVAFAATTFWAVG  554

Query  753   lgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNR  574
             L GG  GF FY  IILASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR
Sbjct  555   LEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINR  614

Query  573   ARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLT  394
              RIP YWIWFHY+SL+KYPYEAVLQNEF DPT+CFVRG Q+FD+TPL  +   +K KLL 
Sbjct  615   DRIPQYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQIFDNTPLGELAYGMKLKLLD  674

Query  393   AMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSR  214
             ++  ++ +RI+ STC+TTGADIL  QGVT LSKWNCL ITV +GFLFR+LFY  LLLGS+
Sbjct  675   SVSTSIGMRISRSTCLTTGADILKQQGVTQLSKWNCLLITVGFGFLFRVLFYLCLLLGSK  734

Query  213   NKRR  202
             NKRR
Sbjct  735   NKRR  738



>ref|XP_008810525.1| PREDICTED: ABC transporter G family member 6-like [Phoenix dactylifera]
Length=748

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/473 (71%), Positives = 393/473 (83%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA  GSIVI+SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  276   LFLDEPTSGLDSTSAFMVVKVLQRIAHGGSIVIMSIHQPSYRILGLLDRLLFLSRGQTVY  335

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEF--SRRWSGGRNS  1261
             +G+P  LP F SDFGH +PE  N  EFALDLIRELE +P G +SLVEF  SRR +    +
Sbjct  336   SGAPDGLPSFFSDFGHPIPENGNATEFALDLIRELESTPTGARSLVEFNKSRRAAKPSMT  395

Query  1260  EPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
               AT   +LSLK+AISAS+S+GKLVSGAT+   P SSVP +AN  W E+AVL+KRS TN 
Sbjct  396   AAATEKPSLSLKDAISASISRGKLVSGATDGTGPASSVPTFANPFWIEIAVLTKRSATNT  455

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             RRMPE+ G RLG V +TGFILAT+FWR+DNSPKG+QERLGFFA AMST FYTCAD LPVF
Sbjct  456   RRMPELFGIRLGAVMMTGFILATIFWRLDNSPKGVQERLGFFAIAMSTMFYTCADALPVF  515

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QERYIF+RETA+NAYRRSSY LS+A+VSFP LV+L++ F+ TTF+A GL GG  GFFF+
Sbjct  516   LQERYIFMRETAYNAYRRSSYVLSNAIVSFPPLVVLSIAFALTTFFAVGLSGGATGFFFF  575

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
             + IILASFWAG+ FVTFLS V+ HVM+ Y +VVAILAYFLLFSGFF+NR RIP YWIWFH
Sbjct  576   FLIILASFWAGSGFVTFLSGVISHVMVGYTVVVAILAYFLLFSGFFINRDRIPDYWIWFH  635

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+ YPYEAVLQNEF+DPTKCFVRG Q+FD+TP +++P A K  +L AM   L   +T
Sbjct  636   YLSLVMYPYEAVLQNEFDDPTKCFVRGVQIFDNTPAASLPTATKLNVLKAMSSALGTNLT  695

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             S+TC+TTG DIL  QGVTD+SKWNCLW+TVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  696   SNTCITTGPDILKQQGVTDISKWNCLWVTVAWGFFFRVLFYFTLLVGSKNKRR  748



>ref|XP_010086759.1| ABC transporter G family member 2 [Morus notabilis]
 gb|EXB23438.1| ABC transporter G family member 2 [Morus notabilis]
Length=767

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/482 (69%), Positives = 394/482 (82%), Gaps = 11/482 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSI+I+SIHQPSSRI+ LLDRLI LS G+TVY
Sbjct  286   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIIIMSIHQPSSRILSLLDRLIFLSHGQTVY  345

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LP F S+FGH +PE +NR EFALDLIRELE +P GT++LVEF++      ++  
Sbjct  346   SGSPTSLPIFFSEFGHPIPEKENRTEFALDLIRELEETPGGTRTLVEFNKSCQKINSNRR  405

Query  1254  ATAVHN--LSLKEAISASVSQGKLVSGATNDANPVSSV---------PAYANSLWTEMAV  1108
                  N  +SLK+AISASVS+GKLVSGA    +  SS            +AN  W EM V
Sbjct  406   DYCNSNCTVSLKDAISASVSRGKLVSGAPQKDSTFSSSSSSSSSSSFQTFANPFWMEMVV  465

Query  1107  LSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFY  928
             +S+RS TN RRMPE+ G RLG V VTG ILATMFW++DNSPKG+QERLGFFAFAMSTTFY
Sbjct  466   ISRRSITNSRRMPELFGIRLGAVLVTGVILATMFWKLDNSPKGVQERLGFFAFAMSTTFY  525

Query  927   TCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglg  748
             TCA+ +PVF+QERYIF+RETA+NAYRRSSY L+H+L+S P LV L+L F+ATTFWA GL 
Sbjct  526   TCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLVFLSLTFAATTFWAVGLA  585

Query  747   ggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRAR  568
             GG +GFFF++  ILA+FWAG+SFVTFLS VV HVML Y +VVAILAYFLLFSGFF++R R
Sbjct  586   GGLSGFFFFFFTILAAFWAGSSFVTFLSGVVTHVMLGYTVVVAILAYFLLFSGFFISRDR  645

Query  567   IPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAM  388
             IP+YW+WFHYISL+KYPYE VLQNEF+DP KCF+RG Q+FD+TPL  VP +LK +LL +M
Sbjct  646   IPVYWLWFHYISLVKYPYEGVLQNEFDDPVKCFIRGVQIFDNTPLGLVPESLKAQLLKSM  705

Query  387   GETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNK  208
              +TL + IT+STCVTTG DIL  QG+TD+SKWNCLWITVAWGF FR+LFYF+LL GS+NK
Sbjct  706   SKTLGMNITASTCVTTGTDILRQQGITDISKWNCLWITVAWGFFFRVLFYFTLLFGSKNK  765

Query  207   RR  202
             RR
Sbjct  766   RR  767



>ref|XP_009143325.1| PREDICTED: ABC transporter G family member 1 [Brassica rapa]
Length=744

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/482 (68%), Positives = 390/482 (81%), Gaps = 11/482 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVL+RIAQSGSIVI+SIHQPS R++GLL+RLI LSRG TV+
Sbjct  263   LFLDEPTSGLDSTSAYMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLNRLIFLSRGNTVF  322

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
             +GSP +LP+F ++FG  +PE +NR EFALDLIRELEGS  GT+ L+EF+++W   +    
Sbjct  323   SGSPGSLPRFFAEFGSPIPENENRTEFALDLIRELEGSAGGTRGLIEFNKKWQEMKKENN  382

Query  1257  -------PATAVHNLSLKEAISASVSQGKLVSGATNDANPVS---SVPAYANSLWTEMAV  1108
                    PA+   NL+LKEAI+AS+S+GKLVSG  +     +   +VPA+ANS+W E+  
Sbjct  383   RQPPLTPPASPYPNLTLKEAIAASISRGKLVSGGESATATAATTLTVPAFANSIWIEIVT  442

Query  1107  LSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFY  928
             LSKRS  N RR PE+ G RL  V +TGFILAT+FWRIDNSPKG+QERLGFFAFAMST FY
Sbjct  443   LSKRSMLNSRRQPELFGIRLASVVITGFILATVFWRIDNSPKGVQERLGFFAFAMSTMFY  502

Query  927   TCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglg  748
             TCA+ LPVF+QERYIF+RETA+NAYRRSSY LSHA+V+FP L+ L++ F+ATTFWA GL 
Sbjct  503   TCAEALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVAFPSLIFLSVAFAATTFWAVGLD  562

Query  747   ggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRAR  568
             GG  GF FY  IILASFW+G+SFVTFLS +VPHVML Y +VVAILAYFLLFSGFF+NR R
Sbjct  563   GGPMGFLFYCLIILASFWSGSSFVTFLSGIVPHVMLGYTIVVAILAYFLLFSGFFINRNR  622

Query  567   IPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAM  388
             IP YWIWFHY+SL+KYPYEAVLQNEF D TKCFVRG Q+FD+TPL  +P  +K +LL ++
Sbjct  623   IPDYWIWFHYMSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGVLPEGMKLRLLDSV  682

Query  387   GETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNK  208
               +L   I+SSTC+TTGADIL  QGVT LSKWNCL ITV +GF FR LFYF LLLGS+NK
Sbjct  683   SRSLGTTISSSTCLTTGADILTQQGVTQLSKWNCLLITVGFGFFFRALFYFCLLLGSKNK  742

Query  207   RR  202
             RR
Sbjct  743   RR  744



>ref|XP_002878016.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54275.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=736

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/484 (67%), Positives = 389/484 (80%), Gaps = 13/484 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIVI+SIHQPS R++ LLDRLI LSRG TV+
Sbjct  253   LFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVIMSIHQPSHRVLSLLDRLIFLSRGHTVF  312

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP F + FG+ +PE +N+ EFALDLIRELEGS  GT+ LVEF+++W   +    
Sbjct  313   SGSPASLPTFFAGFGNPIPENENQTEFALDLIRELEGSAGGTRVLVEFNKKWQEMKKQSN  372

Query  1263  ----SEPATAVHNLSLKEAISASVSQGKLVSGA------TNDANPVSSVPAYANSLWTEM  1114
                 + PA+   NL+LKEAISAS+S+GKLVSG        N      +VPA+AN  W E+
Sbjct  373   PQTLTPPASPNPNLTLKEAISASISRGKLVSGGGAGSSVINHGGGTLAVPAFANPFWMEI  432

Query  1113  AVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTT  934
               L++RS  N RR PE+LG RL  V VTGFILAT+FWR+DNSPKG+QERLGFFAFAMST 
Sbjct  433   KTLTQRSILNSRRQPELLGMRLATVIVTGFILATVFWRLDNSPKGVQERLGFFAFAMSTM  492

Query  933   FYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaag  754
             FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+V+FP L+ L+L F+ TTFWA G
Sbjct  493   FYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSLAFAVTTFWAVG  552

Query  753   lgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNR  574
             L GG  GF FY  IILASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR
Sbjct  553   LEGGPMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINR  612

Query  573   ARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLT  394
              RIP YWIWFHY+SL+KYPYEAVLQNEF DPT+CFVRG Q+FD++PL  +   +K +LL 
Sbjct  613   DRIPKYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQLFDNSPLGELTYGMKLRLLD  672

Query  393   AMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSR  214
             ++  ++ +RI+SSTC+TTGADIL  QGVT LSKWNCL ITV +GFLFR+LFY  LLLGS+
Sbjct  673   SVSRSIGMRISSSTCLTTGADILKQQGVTQLSKWNCLLITVGFGFLFRVLFYLCLLLGSK  732

Query  213   NKRR  202
             NKRR
Sbjct  733   NKRR  736



>ref|XP_010427003.1| PREDICTED: ABC transporter G family member 20 [Camelina sativa]
Length=740

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/471 (69%), Positives = 391/471 (83%), Gaps = 3/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LSRG TVY
Sbjct  273   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDKLIFLSRGNTVY  332

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LP+F S+FGH +PE +N+ EFALDLIRELE SPEGTK+LVEF ++W   + S  
Sbjct  333   SGSPTHLPRFFSEFGHPIPENENKPEFALDLIRELEDSPEGTKTLVEFHKQWRAKQTSSQ  392

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
             +    N+SL++AI++S+S+GKLVSGATN     SS   +AN  WTEM V+ KRS  N  R
Sbjct  393   SRRNTNVSLRDAITSSISRGKLVSGATNLK---SSFQTFANPFWTEMLVIGKRSILNSSR  449

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE+ G RLG V VTG ILAT+FW++DNSP+GIQERLGFFAFAMSTTFYTCA+ +PVF+Q
Sbjct  450   QPELFGIRLGAVLVTGIILATIFWKLDNSPRGIQERLGFFAFAMSTTFYTCAEAIPVFLQ  509

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY L+H ++S P L+IL+  F+ATTFWA GL GG+ GFFF++ 
Sbjct  510   ERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSAAFAATTFWAVGLAGGSEGFFFFFF  569

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              IL +FWAG+SFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIP YWIWFHY+
Sbjct  570   TILTAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIPPYWIWFHYL  629

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYE VLQNEFEDPTKCFVRG QMFD++PL  VPAA+K  LL +M   L   +T+ 
Sbjct  630   SLVKYPYEGVLQNEFEDPTKCFVRGIQMFDNSPLGQVPAAVKISLLKSMSGVLGKNVTAE  689

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCVTTG DIL  QG+T++SKW+CLWITVA GF+FR+LFYF+LL+GS+NKRR
Sbjct  690   TCVTTGIDILKQQGITEISKWSCLWITVALGFVFRVLFYFTLLIGSKNKRR  740



>emb|CDX93388.1| BnaC04g45080D [Brassica napus]
Length=741

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/471 (68%), Positives = 383/471 (81%), Gaps = 1/471 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ V+KVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG TV+
Sbjct  272   LFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDRLIFLSRGNTVF  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LPQF  +F H +PE +N+ EFALDLIRELE SPEGTK LVE+ + W   + +  
Sbjct  332   SGSPTYLPQFFFEFDHPIPENENKTEFALDLIRELENSPEGTKKLVEYHKEWRVKQQAAS  391

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
                 + ++LKEAI+AS+S+GKLVSGAT   +P SS   YAN  W EM V+ KRS  N  R
Sbjct  392   RYYNNGITLKEAITASISKGKLVSGATTTNSP-SSFQTYANPFWIEMIVIGKRSILNSMR  450

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE++G R+G V VTG ILATMF ++DNSPKG+QERLGFFAFAMSTTFYTCA+ +PVF+Q
Sbjct  451   QPELIGMRIGAVMVTGIILATMFTKLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFLQ  510

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY LS +++S P L+ LA  F+ATTF+A GL GG +GF F++ 
Sbjct  511   ERYIFMRETAYNAYRRSSYVLSQSIISIPSLIFLAACFAATTFFAVGLAGGASGFLFFFL  570

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              ILASFWAG+SFVTFLS VV +VML + +VVAILAYFLLFSGFF++R RIPLYWIWFHY+
Sbjct  571   TILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYL  630

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYE VLQNEFED TKCFVRG Q+FD++PL   P A+K  LL +M   L + +T+ 
Sbjct  631   SLVKYPYEGVLQNEFEDTTKCFVRGIQIFDNSPLGQFPNAVKLSLLKSMSGVLGINVTAE  690

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCVTTG DIL  QGVT++SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  691   TCVTTGIDILKQQGVTEISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  741



>ref|XP_009144100.1| PREDICTED: ABC transporter G family member 1-like [Brassica rapa]
Length=755

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/482 (68%), Positives = 390/482 (81%), Gaps = 11/482 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVL+RIAQSGSIVI+SIHQPS R++GLL+RLI LSRG TV+
Sbjct  274   LFLDEPTSGLDSTSAYMVVKVLKRIAQSGSIVIMSIHQPSHRVLGLLNRLIFLSRGNTVF  333

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
             +GSP +LP+F ++FG  +PE +NR EFALDLIRELEGS  GT+ L+EF+++W   +    
Sbjct  334   SGSPGSLPRFFAEFGSPIPENENRTEFALDLIRELEGSAGGTRGLIEFNKKWQEMKKENN  393

Query  1257  -------PATAVHNLSLKEAISASVSQGKLVSGATNDANPVS---SVPAYANSLWTEMAV  1108
                    PA+   NL+LKEAI+AS+S+GKLVSG  +     +   +VPA+ANS+W E+  
Sbjct  394   RQPPLTPPASPYPNLTLKEAIAASISRGKLVSGGESATATAATTLTVPAFANSIWIEIVT  453

Query  1107  LSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFY  928
             LSKRS  N RR PE+ G RL  V +TGFILAT+FWRIDNSPKG+QERLGFFAFAMST FY
Sbjct  454   LSKRSMLNSRRQPELFGIRLASVVITGFILATVFWRIDNSPKGVQERLGFFAFAMSTMFY  513

Query  927   TCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglg  748
             TCA+ LPVF+QERYIF+RETA+NAYRRSSY LSHA+V+FP L+ L++ F+ATTFWA GL 
Sbjct  514   TCAEALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVAFPSLIFLSVAFAATTFWAVGLD  573

Query  747   ggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRAR  568
             GG  GF FY  IILASFW+G+SFVTFLS +VPHVML Y +VVAILAYFLLFSGFF+NR R
Sbjct  574   GGPMGFLFYCLIILASFWSGSSFVTFLSGIVPHVMLGYTIVVAILAYFLLFSGFFINRNR  633

Query  567   IPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAM  388
             IP YWIWFHY+SL+KYPYEAVLQNEF D TKCFVRG Q+FD+TPL  +P  +K +LL ++
Sbjct  634   IPDYWIWFHYMSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGVLPEGMKLRLLDSV  693

Query  387   GETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNK  208
               +L   I+SSTC+TTGADIL  QGVT LSKWNCL ITV +GF FR LFYF LLLGS+NK
Sbjct  694   SRSLGTTISSSTCLTTGADILTQQGVTQLSKWNCLLITVGFGFFFRALFYFCLLLGSKNK  753

Query  207   RR  202
             RR
Sbjct  754   RR  755



>ref|XP_010427257.1| PREDICTED: ABC transporter G family member 16-like [Camelina 
sativa]
Length=738

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/484 (67%), Positives = 394/484 (81%), Gaps = 13/484 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIVI+SIHQPS R++ LLDRLI LSRG TV+
Sbjct  255   LFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVIMSIHQPSHRVLSLLDRLIFLSRGHTVF  314

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR---N  1264
             +GSP +LP F + FG+ +PE +N+ EF LDLIRELEGS  GT++LVEF+++W   +   N
Sbjct  315   SGSPASLPSFFAGFGNPIPENENQTEFTLDLIRELEGSAGGTRALVEFNKKWQEMKKQSN  374

Query  1263  SE----PATAVHNLSLKEAISASVSQGKLVSG------ATNDANPVSSVPAYANSLWTEM  1114
             S+    PA+   NL+LKEAISAS+S+GKLVSG      A N      +VP++AN  W E+
Sbjct  375   SQTLTSPASPNPNLTLKEAISASISRGKLVSGSGAGTSAVNHGGGTLAVPSFANPFWIEI  434

Query  1113  AVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTT  934
               L++RS  N RR PE++G RL  V+VTGFILAT+FWR+DNSPKG+QERLGFFAFAMST 
Sbjct  435   KTLTQRSILNSRRQPELIGMRLATVTVTGFILATVFWRLDNSPKGVQERLGFFAFAMSTM  494

Query  933   FYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaag  754
             FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+V+FP L+ L++ F+ATTFWA G
Sbjct  495   FYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSVAFAATTFWAVG  554

Query  753   lgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNR  574
             L GG  GF FY  IILASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR
Sbjct  555   LEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINR  614

Query  573   ARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLT  394
              RIP YWIWF+Y+SL+KYPYEAVLQNEF DPT+CFVRG Q+FD+TPL  +   +K +LL 
Sbjct  615   DRIPQYWIWFNYLSLVKYPYEAVLQNEFSDPTECFVRGVQIFDNTPLGELAYGMKLRLLD  674

Query  393   AMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSR  214
             ++  ++ +RI+SSTC+TTGADIL  QGVT LSKWNCL ITV +GFLFR+LFY  LLLGS+
Sbjct  675   SVSRSIGMRISSSTCLTTGADILKQQGVTQLSKWNCLLITVGFGFLFRVLFYLCLLLGSK  734

Query  213   NKRR  202
             NKRR
Sbjct  735   NKRR  738



>ref|XP_010505600.1| PREDICTED: ABC transporter G family member 1-like [Camelina sativa]
Length=741

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/487 (67%), Positives = 389/487 (80%), Gaps = 16/487 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIAQSGSIVI+SIHQPS R++ LLDRLI LSRG TVY
Sbjct  255   LFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLSLLDRLIFLSRGHTVY  314

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
             +GSP +LP+F S+FG  +PE +NR EFALDLI ELEGS  GT+ LVEF+++W   +    
Sbjct  315   SGSPASLPRFFSEFGSPIPENENRTEFALDLICELEGSAGGTRGLVEFNKKWQEMKKQNN  374

Query  1257  -------PATAVHNLSLKEAISASVSQGKLVSGATNDAN--------PVSSVPAYANSLW  1123
                    P++   NL+LKEAI+AS+S+GKLVSG  + AN           +VP +AN +W
Sbjct  375   RQPPLTPPSSPYPNLTLKEAIAASISRGKLVSGGESVANGGTTATSTTTLAVPEFANPMW  434

Query  1122  TEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAM  943
              E+  LSKRS  N RR PE+ G R+  V +TGFILAT+FWR+DNSPKG+QERLGFFAFAM
Sbjct  435   IEIKTLSKRSMLNSRRQPELFGIRVASVVITGFILATVFWRLDNSPKGVQERLGFFAFAM  494

Query  942   STTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfw  763
             ST FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+VS P L+ L+L F+ATT+W
Sbjct  495   STMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSIPSLIFLSLAFAATTYW  554

Query  762   aaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF  583
             A GLGGG  G  FY  IILASFW+G+SFVTFLS VVP VML YI+VVAILAYFLLFSGFF
Sbjct  555   AVGLGGGPMGLLFYCLIILASFWSGSSFVTFLSGVVPSVMLGYIIVVAILAYFLLFSGFF  614

Query  582   MNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEK  403
             +NR RIP YWIWFHY+SL+KYPYEAVLQNEF D TKCFVRG Q+FD+TPL  +P  +K  
Sbjct  615   INRNRIPDYWIWFHYLSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLN  674

Query  402   LLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLL  223
             LL ++ ++L V I+S+TC+TTGADIL  QGV  LSKWNCL +TVA+GF FRILFYF+LLL
Sbjct  675   LLGSVSKSLGVTISSTTCLTTGADILKNQGVVQLSKWNCLLVTVAFGFFFRILFYFTLLL  734

Query  222   GSRNKRR  202
             GS+NKRR
Sbjct  735   GSKNKRR  741



>ref|XP_010504353.1| PREDICTED: ABC transporter G family member 16-like [Camelina 
sativa]
Length=738

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/484 (67%), Positives = 390/484 (81%), Gaps = 13/484 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIVI+SIHQPS R++ LLDRLI LSRG TV+
Sbjct  255   LFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVIMSIHQPSHRVLSLLDRLIFLSRGHTVF  314

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +L  F + FG+ +PE +N+ EF LDLIRELEGS  GT++LVEF+++W   +    
Sbjct  315   SGSPASLRSFFAGFGNPIPENENQTEFTLDLIRELEGSAGGTRALVEFNKKWQEMKRQSN  374

Query  1263  ----SEPATAVHNLSLKEAISASVSQGKLVSG------ATNDANPVSSVPAYANSLWTEM  1114
                 + PA+   NL+LKEAISAS+S+GKLVSG      A N      +VPA+AN  W E+
Sbjct  375   PQTLTSPASPNPNLTLKEAISASISRGKLVSGGGAGSSAVNHGGGTLAVPAFANPFWIEI  434

Query  1113  AVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTT  934
               L++RS  N RR PE++G RL  V+VTGFILAT+FWR+DNSPKG+QERLGFFAFAMST 
Sbjct  435   KTLTQRSILNSRRQPELIGMRLATVTVTGFILATVFWRLDNSPKGVQERLGFFAFAMSTM  494

Query  933   FYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaag  754
             FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+V+FP L+ L++ F+ATTFWA G
Sbjct  495   FYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSVAFAATTFWAVG  554

Query  753   lgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNR  574
             L GG  GF FY  IILASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR
Sbjct  555   LEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINR  614

Query  573   ARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLT  394
              RIP YWIWFHY+SL+KYPYEAVLQNEF DPT+CFVRG Q+FD+TPL  +    K KLL 
Sbjct  615   DRIPQYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQIFDNTPLGELAYGKKLKLLD  674

Query  393   AMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSR  214
             ++  ++ +RI+SSTC+TTGADIL  QGVT LSKWNCL ITV +GFLFR+LFY  LLLGS+
Sbjct  675   SVSRSIGMRISSSTCLTTGADILKQQGVTQLSKWNCLLITVGFGFLFRVLFYLCLLLGSK  734

Query  213   NKRR  202
             NKRR
Sbjct  735   NKRR  738



>ref|XP_006290640.1| hypothetical protein CARUB_v10016733mg [Capsella rubella]
 gb|EOA23538.1| hypothetical protein CARUB_v10016733mg [Capsella rubella]
Length=740

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/471 (68%), Positives = 389/471 (83%), Gaps = 3/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LSRG TVY
Sbjct  273   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDKLIFLSRGNTVY  332

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LP+F S+FGH +PE +N+ EFALDLIRELE SPEGTK+LVE+ ++W   + S  
Sbjct  333   SGSPTHLPRFFSEFGHPIPENENKPEFALDLIRELEDSPEGTKTLVEYHKQWRAKQTSSQ  392

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
             +    N+ L++AI+AS+S+GKLVSGATN     SS   +AN  WTEM V+ KRS  N  R
Sbjct  393   SRRNTNVPLRDAITASISRGKLVSGATNLK---SSFQTFANPFWTEMLVIGKRSILNSSR  449

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE+ G RLG V VTG ILAT+FW++DNSP+GIQERLGFFAFAMSTTFYTCA+ +PVF+Q
Sbjct  450   QPELFGIRLGAVLVTGIILATIFWKLDNSPRGIQERLGFFAFAMSTTFYTCAEAIPVFLQ  509

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY L+H ++S P L+IL+  F+ATTFWA GL GG+ GFFF++ 
Sbjct  510   ERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSAAFAATTFWAVGLAGGSEGFFFFFF  569

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              IL SFWAG+SFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIP YWIWFHY+
Sbjct  570   TILTSFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIPPYWIWFHYL  629

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYE VLQNEF+DPTKCFVRG QMFD++PL  VP A+K  LL +M   L + +T+ 
Sbjct  630   SLVKYPYEGVLQNEFDDPTKCFVRGIQMFDNSPLGKVPTAVKIGLLKSMSGVLGINVTAE  689

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCVTTG DIL  QG+T++SKW+CLWITVA GF FR+LFYF+LL+GS+NKRR
Sbjct  690   TCVTTGIDILKQQGITEISKWSCLWITVALGFFFRVLFYFTLLIGSKNKRR  740



>emb|CDX69629.1| BnaA10g19780D [Brassica napus]
Length=728

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/474 (72%), Positives = 401/474 (85%), Gaps = 5/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA +VVKVL+RIAQSGS+VI+++HQPS R++ LLDRL+ LSRG+TV+
Sbjct  252   LFLDEPTSGLDSTSALSVVKVLKRIAQSGSMVIMTLHQPSYRLLRLLDRLLFLSRGQTVF  311

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP  LP F ++FGH +PE +NR EFALDLIRELEGS  GT+SLVEF++ +   R +EP
Sbjct  312   SGSPAMLPSFFAEFGHPIPERENRTEFALDLIRELEGSAGGTRSLVEFNKEFRQ-RKAEP  370

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSS---VPAYANSLWTEMAVLSKRSFTN  1084
              T    LSLKEAISAS+S+GKLVSGAT+  +  S    +P +AN  W E+ VL+KRS TN
Sbjct  371   RTQT-GLSLKEAISASISKGKLVSGATSGGSGSSPVSTIPTFANPFWVELLVLAKRSMTN  429

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RR PE+ G RLG V VTGFILATMFW++DNSPKG+QERLGFFAFAMSTTFYTCAD LPV
Sbjct  430   YRRQPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFAMSTTFYTCADALPV  489

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QER+IF+RETA+NAYRRSSY LSH+LV+ P L+IL+L F+ATTFWA GL GG  GF F
Sbjct  490   FLQERFIFMRETAYNAYRRSSYVLSHSLVALPSLIILSLAFAATTFWAVGLDGGLMGFLF  549

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y+ I+LA+FWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP YWIWF
Sbjct  550   YFLIVLAAFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITRDRIPAYWIWF  609

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HYISL+KYPYEAVL NEF DPTKCF+RG Q+FD+TPL+AVP  +K KLL+ M ++L +RI
Sbjct  610   HYISLVKYPYEAVLINEFSDPTKCFIRGVQIFDNTPLAAVPQGMKVKLLSTMSKSLGMRI  669

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TSSTC+TTG DIL  QGVTDLSKWNCLWITVAWGF FRILFYFSLLLGS+NKRR
Sbjct  670   TSSTCLTTGYDILQQQGVTDLSKWNCLWITVAWGFFFRILFYFSLLLGSKNKRR  723



>ref|XP_006410918.1| hypothetical protein EUTSA_v10016295mg [Eutrema salsugineum]
 gb|ESQ52371.1| hypothetical protein EUTSA_v10016295mg [Eutrema salsugineum]
Length=752

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/474 (69%), Positives = 391/474 (82%), Gaps = 3/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ V+KVLQRIAQSGSIVI+SIHQPS RI+GLLDRLI LSRG TVY
Sbjct  279   LFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDRLIFLSRGNTVY  338

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNS--  1261
             +GSP +LPQF S+F H +PE +N+ EFALDLIRELE S  GTK+LVEF ++W   + S  
Sbjct  339   SGSPTHLPQFFSEFEHPIPENENKTEFALDLIRELENSAGGTKTLVEFHKQWRAKQASSY  398

Query  1260  EPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSV-PAYANSLWTEMAVLSKRSFTN  1084
             +      N+SLKEAI+AS+S+GKLVSGATN ++ ++S    +AN  W E+ V+ KRS  N
Sbjct  399   DNNNRNPNVSLKEAITASISRGKLVSGATNSSSNLTSSFQTFANPFWIEVIVIGKRSILN  458

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RR PE+LG RLG V VTG ILATMF ++DNSPKG+QERLGFFAFAMSTTFYTCA+ +PV
Sbjct  459   SRRQPELLGMRLGAVMVTGIILATMFTKLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPV  518

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERYIF+RETA+NAYRRSSY LS +++S P L+ LA  F+ATTFWA GL GG +GF F
Sbjct  519   FLQERYIFMRETAYNAYRRSSYVLSQSIISIPSLIFLAASFAATTFWAVGLAGGASGFLF  578

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             ++  ILASFWAG+SFVTFLS VV +VML + +VVAILAYFLLFSGFF++R RIPLYWIWF
Sbjct  579   FFLTILASFWAGSSFVTFLSGVVSNVMLGFTVVVAILAYFLLFSGFFISRDRIPLYWIWF  638

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HY+SL+KYPYE VLQNEFEDPTKCFVRG Q+FD++PL  VP A+K  LL +M   L + +
Sbjct  639   HYLSLVKYPYEGVLQNEFEDPTKCFVRGIQIFDNSPLGQVPNAVKLSLLKSMSGVLGINV  698

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             T+ TCVTTG DIL  QG+TD+SKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  699   TAETCVTTGIDILKQQGITDISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  752



>ref|XP_002881504.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57763.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=744

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/477 (68%), Positives = 385/477 (81%), Gaps = 6/477 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ V+KVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LSRG TVY
Sbjct  268   LFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDQLIFLSRGNTVY  327

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LPQF S+F H +PE +N+ EFALDLIRELE S EGTK LVEF ++W   +   P
Sbjct  328   SGSPTHLPQFFSEFEHPIPENENKTEFALDLIRELENSAEGTKPLVEFHKKWRAKQAQSP  387

Query  1254  A-----TAVHNLSLKEAISASVSQGKLVSGATNDA-NPVSSVPAYANSLWTEMAVLSKRS  1093
             +        +N SLKEAI+AS+S+GKLVSGATN++ N   S   +AN  W EM V+ KR+
Sbjct  388   SYSNGNKKNNNASLKEAITASISRGKLVSGATNNSSNLTPSFQTFANPFWIEMIVIGKRA  447

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
               N  R PE+LG RLG V VTG ILATMF  +DNSPKG QERLGFFAFAMSTTFYTCA+ 
Sbjct  448   ILNSMRQPELLGMRLGAVMVTGIILATMFTNLDNSPKGAQERLGFFAFAMSTTFYTCAEA  507

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             +PVF++ERYIF+RETA+NAYRRSSY LS +++S P L+ L+  F+ATTFWA GL GGT+G
Sbjct  508   IPVFLEERYIFMRETAYNAYRRSSYVLSQSIISIPALIFLSASFAATTFWAVGLSGGTSG  567

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F F++  ILASFWAG+SFVTFLS VV +VML + +VVAILAYFLLFSGFF++R RIP+YW
Sbjct  568   FLFFFLTILASFWAGSSFVTFLSGVVANVMLGFTIVVAILAYFLLFSGFFISRDRIPVYW  627

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             +WFHYISL+KYPYE VLQNEFEDPTKCFVRG Q+FD++PL   P  +K  LL +M   L 
Sbjct  628   LWFHYISLVKYPYEGVLQNEFEDPTKCFVRGVQIFDNSPLGEFPNDVKLNLLKSMSGVLG  687

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
               +T+ TCVTTG DIL  QG+TDLSKWNCLWITVAWGF FR+LFYF+LL+GS+NKRR
Sbjct  688   TNVTAETCVTTGIDILKQQGITDLSKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRR  744



>ref|XP_010509030.1| PREDICTED: ABC transporter G family member 1 [Camelina sativa]
Length=741

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/487 (67%), Positives = 389/487 (80%), Gaps = 16/487 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIAQSGSIVI+SIHQPS R++ LLDRLI LSRG TVY
Sbjct  255   LFLDEPTSGLDSTSAFMVVKVLKRIAQSGSIVIMSIHQPSHRVLSLLDRLIFLSRGHTVY  314

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
             +GSP +L +F S+FG  +PE +NR EFALDLIRELE S  GT+ LVEF+++W   +    
Sbjct  315   SGSPASLARFFSEFGSPIPENENRTEFALDLIRELEVSAGGTRGLVEFNKKWQEMKKQNN  374

Query  1257  -------PATAVHNLSLKEAISASVSQGKLVSGATNDAN--------PVSSVPAYANSLW  1123
                    P++   NL+LKEAI+AS+S+GKLVSG  + AN           +VP +AN +W
Sbjct  375   RQPPLTPPSSPYPNLTLKEAIAASISRGKLVSGGESVANGGATATSTTTLAVPEFANPMW  434

Query  1122  TEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAM  943
              E+  LSKRS  N RR PE+ G R+  V +TGFILAT+FWR+DNSPKG+QERLGFFAFAM
Sbjct  435   IEIKTLSKRSMLNSRRQPELFGIRVASVVITGFILATVFWRLDNSPKGVQERLGFFAFAM  494

Query  942   STTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfw  763
             ST FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+VS P L+ L+L F+ATT+W
Sbjct  495   STMFYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVSIPSLIFLSLAFAATTYW  554

Query  762   aaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF  583
             A GLGGG  G  FY  IILASFW+G+SFVTFLS VVP VML YI+VVAILAYFLLFSGFF
Sbjct  555   AVGLGGGPMGLLFYCLIILASFWSGSSFVTFLSGVVPSVMLGYIIVVAILAYFLLFSGFF  614

Query  582   MNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEK  403
             +NR RIP YWIWFHY+SL+KYPYEAVLQNEF D TKCFVRG Q+FD+TPL  +P  +K  
Sbjct  615   INRNRIPDYWIWFHYLSLVKYPYEAVLQNEFSDATKCFVRGVQIFDNTPLGELPEVMKLN  674

Query  402   LLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLL  223
             LL ++ ++L V I+S+TC+TTGADIL  QGV  LSKWNCL++TVA+GF FRILFYF+LLL
Sbjct  675   LLGSVSKSLGVTISSTTCLTTGADILKNQGVVQLSKWNCLFVTVAFGFFFRILFYFTLLL  734

Query  222   GSRNKRR  202
             GS+NKRR
Sbjct  735   GSKNKRR  741



>gb|KCW88884.1| hypothetical protein EUGRSUZ_A01212 [Eucalyptus grandis]
Length=683

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/478 (68%), Positives = 389/478 (81%), Gaps = 7/478 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++SIHQPS RI+ LLDRLI LSRG TV+
Sbjct  206   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSIHQPSYRIMSLLDRLIFLSRGNTVF  265

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS------G  1273
              GSP +LP+F ++FGH +PE +NR EF LDLIRELE +P GTKS+VEF++ W       G
Sbjct  266   NGSPADLPKFFAEFGHPIPEHENRTEFVLDLIRELEETPGGTKSIVEFNKSWEAKQQSLG  325

Query  1272  GRNSEPATAVHNLSLKEAISASVSQGKLVSGAT-NDANPVSSVPAYANSLWTEMAVLSKR  1096
              RN +        SLK+AISASVS+GKLVSG +  D+N V  VP +AN  W EM V+SKR
Sbjct  326   LRNGDITWTGPKPSLKDAISASVSRGKLVSGGSAGDSNQVVLVPTFANPFWMEMLVISKR  385

Query  1095  SFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCAD  916
             S TN RRMPE+ G R G V VTG ILATMF  +DNSPKG+QERLGFFAFAMSTTFYTCA+
Sbjct  386   SMTNSRRMPELFGIRFGAVMVTGIILATMFRHLDNSPKGVQERLGFFAFAMSTTFYTCAE  445

Query  915   TLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggta  736
              +PVF+Q+RYIF+RETA+NAYRR SY L+HA++S P LVIL+L F+ATTFW  GL GG +
Sbjct  446   AIPVFLQDRYIFMRETAYNAYRRYSYVLAHAIISVPSLVILSLAFAATTFWPVGLAGGFS  505

Query  735   gffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLY  556
             GF F++  + A+FWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R RIP Y
Sbjct  506   GFMFFFYAVFAAFWAGSSFVTFLSGVVSHVMLGFTIVVAILAYFLLFSGFFISRNRIPPY  565

Query  555   WIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETL  376
             WIWFHY+SL+KYPYE+VLQNEF+DP KCFVRG QMFD+TPL+ VP ALK ++L  MG TL
Sbjct  566   WIWFHYLSLVKYPYESVLQNEFDDPAKCFVRGVQMFDNTPLAVVPEALKLRMLKNMGSTL  625

Query  375   NVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              + +T STCVTTG DIL  QG+TD+SKW+CLWIT+AWGF FR+LFYF+LL GS+NKR+
Sbjct  626   GMNLTGSTCVTTGVDILRTQGITDISKWDCLWITIAWGFFFRVLFYFTLLYGSKNKRK  683



>ref|XP_004168142.1| PREDICTED: ABC transporter G family member 2-like [Cucumis sativus]
Length=726

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/479 (67%), Positives = 393/479 (82%), Gaps = 8/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+ LLDRLI LS G+TVY
Sbjct  248   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDRLIFLSHGQTVY  307

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
             +GSP +LP FL++FGH +P  +NR EFALDL+R+LE +  GTKS+VE ++ W    N   
Sbjct  308   SGSPTDLPNFLAEFGHPIPGNENRTEFALDLVRDLEETVGGTKSMVEHNKSWQRKNNVHL  367

Query  1257  PATAVH-------NLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSK  1099
                 +H       +L LK+AISAS+S+GKLVSGA  D++  SS   ++N LW E+ V++K
Sbjct  368   EDYEIHRDFSRRFHLCLKDAISASISRGKLVSGAPIDSSRSSSFSKFSNPLWVEILVIAK  427

Query  1098  RSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCA  919
             RS  N RRMPE+ G RLG V +TG ILATMFW +DNSPKGIQERLGFFAFAMSTTFYTCA
Sbjct  428   RSIMNSRRMPELFGIRLGAVLITGIILATMFWHLDNSPKGIQERLGFFAFAMSTTFYTCA  487

Query  918   DTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggt  739
             + +PVF+QERYIF+RETA+NAYRRSSY L+H+L+S P L+IL++ F+ TT++A  L GG 
Sbjct  488   EAIPVFLQERYIFMRETAYNAYRRSSYVLAHSLLSIPSLIILSITFAGTTYFAVNLAGGF  547

Query  738   agffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPL  559
             +GF F++  IL++FWAG+SFVTFLS VV HVML Y +VVAILAYFLLFSGFF++R R+P 
Sbjct  548   SGFVFFFFAILSAFWAGSSFVTFLSGVVSHVMLGYTVVVAILAYFLLFSGFFLSRDRMPP  607

Query  558   YWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET  379
             YWIWFHY+SL+KYPYEAVLQNEFE  + CF+RG QMFD+TPL+ VP+A+K +LL +MG+T
Sbjct  608   YWIWFHYMSLVKYPYEAVLQNEFEAKSGCFIRGVQMFDNTPLAVVPSAMKMELLKSMGKT  667

Query  378   LNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             L + IT STCVTTG+D+L  QG+TDLSKWNC+WI+VAWGFLFRILFYF+LL GS+NKR+
Sbjct  668   LGLNITGSTCVTTGSDVLRQQGITDLSKWNCIWISVAWGFLFRILFYFALLFGSKNKRK  726



>ref|XP_004493913.1| PREDICTED: ABC transporter G family member 20-like [Cicer arietinum]
Length=746

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/480 (68%), Positives = 388/480 (81%), Gaps = 11/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLI LS G+TVY
Sbjct  269   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSHGQTVY  328

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP F S+F H +PE +NR EFALDLIRELEG+P GTKSLVEF++ W     ++P
Sbjct  329   SGSPANLPLFFSEFDHPIPENENRTEFALDLIRELEGTPGGTKSLVEFNKSWQ--LKNKP  386

Query  1254  ATAVHN---LSLKEAISASVSQGKLVSGATNDANPV-----SSVPAYANSLWTEMAVLSK  1099
                ++N   LSLKEAISAS+S+GKLVSG              S+  +AN  W EMAV+ K
Sbjct  387   VPPLNNGAKLSLKEAISASISRGKLVSGTNGANGNGNGNATDSIATFANPFWIEMAVIGK  446

Query  1098  RSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCA  919
             RS TN RRMPE+ G RLG V VTG ILAT+F+R+DNSPKG+QERLGFFAFAMSTTFYTCA
Sbjct  447   RSLTNSRRMPELFGIRLGAVLVTGGILATIFYRLDNSPKGVQERLGFFAFAMSTTFYTCA  506

Query  918   DTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggt  739
             + +PVF+QERYIF+RETA+NAYRRSSY LSH+++S P L+ L+  F+ TTFW+ GL GGT
Sbjct  507   EAIPVFLQERYIFMRETAYNAYRRSSYVLSHSIISLPSLIFLSFAFAITTFWSVGLAGGT  566

Query  738   agffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPL  559
             +GF FY+  ILASFWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R RIP 
Sbjct  567   SGFLFYFFTILASFWAGSSFVTFLSGVVSHVMLGFTVVVAILAYFLLFSGFFISRNRIPP  626

Query  558   YWIWFHYISLIKYPYEAVLQNEFE-DPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
             YWIWFHY+SL+KYPYE VLQNEF+  P +CFVRG QMFD+TPL  VP +LK +LL ++  
Sbjct  627   YWIWFHYLSLVKYPYEGVLQNEFDIQPPRCFVRGIQMFDNTPLGDVPGSLKVELLKSLSS  686

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TL + ITSSTCV TGADIL  QG+T LSKWNCL+IT+AWGF FR LFY +LL GS+NKR+
Sbjct  687   TLGINITSSTCVVTGADILKQQGITQLSKWNCLFITIAWGFFFRFLFYLALLFGSKNKRK  746



>emb|CAB82704.1| ABC transporter-like protein [Arabidopsis thaliana]
Length=720

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/484 (67%), Positives = 389/484 (80%), Gaps = 13/484 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSI+I+SIHQPS R++ LLDRLI LSRG TV+
Sbjct  237   LFLDEPTSGLDSTSAFMVVKVLKRIAESGSIIIMSIHQPSHRVLSLLDRLIFLSRGHTVF  296

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP F + FG+ +PE +N+ EFALDLIRELEGS  GT+ LVEF+++W   +    
Sbjct  297   SGSPASLPSFFAGFGNPIPENENQTEFALDLIRELEGSAGGTRGLVEFNKKWQEMKKQSN  356

Query  1263  ----SEPATAVHNLSLKEAISASVSQGKLVSGAT------NDANPVSSVPAYANSLWTEM  1114
                 + PA+   NL+LKEAISAS+S+GKLVSG        N      +VPA+AN  W E+
Sbjct  357   PQTLTPPASPNPNLTLKEAISASISRGKLVSGGGGGSSVINHGGGTLAVPAFANPFWIEI  416

Query  1113  AVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTT  934
               L++RS  N RR PE+LG RL  V VTGFILAT+FWR+DNSPKG+QERLGFFAFAMST 
Sbjct  417   KTLTRRSILNSRRQPELLGMRLATVIVTGFILATVFWRLDNSPKGVQERLGFFAFAMSTM  476

Query  933   FYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaag  754
             FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+V+FP L+ L+L F+ TTFWA G
Sbjct  477   FYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSLAFAVTTFWAVG  536

Query  753   lgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNR  574
             L GG  GF FY  IILASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR
Sbjct  537   LEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINR  596

Query  573   ARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLT  394
              RIP YWIWFHY+SL+KYPYEAVLQNEF DPT+CFVRG Q+FD++PL  +   +K +LL 
Sbjct  597   DRIPQYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQLFDNSPLGELTYGMKLRLLD  656

Query  393   AMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSR  214
             ++  ++ +RI+SSTC+TTGAD+L  QGVT LSKWNCL ITV +GFLFRILFY  LLLGS+
Sbjct  657   SVSRSIGMRISSSTCLTTGADVLKQQGVTQLSKWNCLLITVGFGFLFRILFYLCLLLGSK  716

Query  213   NKRR  202
             NKRR
Sbjct  717   NKRR  720



>ref|XP_006428975.1| hypothetical protein CICLE_v10011147mg [Citrus clementina]
 gb|ESR42215.1| hypothetical protein CICLE_v10011147mg [Citrus clementina]
Length=741

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/477 (69%), Positives = 390/477 (82%), Gaps = 8/477 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+ LLDRLILLS G TV+
Sbjct  267   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLILLSHGNTVF  326

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP NLP F S FGH +PE +NR EFALDLIRELE +PEGTK+LVEF++ W   R   P
Sbjct  327   GGSPANLPDFFSQFGHPIPENENRTEFALDLIRELEETPEGTKNLVEFNKSWQ--RTKSP  384

Query  1254  ATAVH----NLSLKEAISASVSQGKLVSGATNDANP--VSSVPAYANSLWTEMAVLSKRS  1093
                 H    ++SL +AI  SVS+GKLVSGAT D  P   SSVP +AN +W EM V++KRS
Sbjct  385   KNNNHESKSSISLTDAIRQSVSRGKLVSGATTDPGPDLTSSVPTFANPMWFEMIVIAKRS  444

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
              TN RRMPE+ G R G V VTG ILAT++W++DNSPKG+QER+ F AFAM TTFYTCA+ 
Sbjct  445   MTNSRRMPELFGIRFGAVLVTGIILATIYWKLDNSPKGVQERIAFLAFAMVTTFYTCAEA  504

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             +PVF+QERYIF+RETA+NAYRRSSY L+H+++S P LV+L+L F+A TF+A GL GG +G
Sbjct  505   IPVFLQERYIFMRETAYNAYRRSSYVLAHSIISIPALVVLSLTFAAVTFFAVGLAGGFSG  564

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F F++ IILASFWAG+SFVTFLS +V HVML + +VVAILAYFLLFSGFF++R RIP YW
Sbjct  565   FIFFFFIILASFWAGSSFVTFLSGIVSHVMLGFTVVVAILAYFLLFSGFFISRDRIPAYW  624

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHYISL+KYP+E VLQNEF+DP KCFVRG QMFD+TPL ++P ++K KLL +M   L 
Sbjct  625   IWFHYISLVKYPFEGVLQNEFDDPNKCFVRGVQMFDNTPLGSLPMSMKLKLLKSMSNALG  684

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             + ITSSTCVTT +DIL  QG+TD+SKWNCLWI VAWGF FRILFYF+LL+GS+NKRR
Sbjct  685   INITSSTCVTTASDILKQQGITDISKWNCLWILVAWGFFFRILFYFTLLVGSKNKRR  741



>ref|XP_004137951.1| PREDICTED: ABC transporter G family member 2-like [Cucumis sativus]
 gb|KGN58908.1| hypothetical protein Csa_3G736560 [Cucumis sativus]
Length=726

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/479 (67%), Positives = 393/479 (82%), Gaps = 8/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+ LLDRLI LS G+TVY
Sbjct  248   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDRLIFLSHGQTVY  307

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
             +GSP +LP FL++FGH +P  +NR EFALDL+R+LE +  GTKS+VE ++ W    N   
Sbjct  308   SGSPTDLPNFLAEFGHPIPGNENRTEFALDLVRDLEETVGGTKSMVEHNKSWQRKNNVHL  367

Query  1257  PATAVH-------NLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSK  1099
                 +H       +L LK+AISAS+S+GKLVSGA  D++  SS   ++N LW E+ V++K
Sbjct  368   EDYEIHRDFSRRFHLCLKDAISASISRGKLVSGAPIDSSRSSSFSKFSNPLWVEILVIAK  427

Query  1098  RSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCA  919
             RS  N RRMPE+ G RLG V +TG ILATMFW +DNSPKGIQERLGFFAFAMSTTFYTCA
Sbjct  428   RSIMNSRRMPELFGIRLGAVLITGIILATMFWHLDNSPKGIQERLGFFAFAMSTTFYTCA  487

Query  918   DTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggt  739
             + +PVF+QERYIF+RETA+NAYRRSSY L+H+L+S P L+IL++ F+ TT++A  L GG 
Sbjct  488   EAIPVFLQERYIFMRETAYNAYRRSSYVLAHSLLSIPSLIILSITFAGTTYFAVNLAGGF  547

Query  738   agffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPL  559
             +GF F++  IL++FWAG+SFVTFLS VV HVML Y +VVAILAYFLLFSGFF++R R+P 
Sbjct  548   SGFVFFFFAILSAFWAGSSFVTFLSGVVSHVMLGYTVVVAILAYFLLFSGFFLSRDRMPP  607

Query  558   YWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET  379
             YWIWFHY+SL+KYPYEAVLQNEFE  + CF+RG QMFD+TPL+ VP+A+K +LL +MG+T
Sbjct  608   YWIWFHYMSLVKYPYEAVLQNEFEAKSGCFIRGVQMFDNTPLAVVPSAMKVELLKSMGKT  667

Query  378   LNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             L + IT STCVTTG+D+L  QG+TDLSKWNC+WI+VAWGFLFRILFYF+LL GS+NKR+
Sbjct  668   LGLNITGSTCVTTGSDVLRQQGITDLSKWNCIWISVAWGFLFRILFYFALLFGSKNKRK  726



>ref|XP_006480710.1| PREDICTED: ABC transporter G family member 20-like [Citrus sinensis]
Length=741

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/477 (69%), Positives = 390/477 (82%), Gaps = 8/477 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+ LLDRLILLS G TV+
Sbjct  267   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILNLLDRLILLSHGNTVF  326

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP NLP F S FGH +PE +NR EFALDLIRELE +PEGTK+LVEF++ W   R   P
Sbjct  327   GGSPANLPDFFSQFGHPIPENENRTEFALDLIRELEETPEGTKNLVEFNKSWQ--RTKSP  384

Query  1254  ATAVH----NLSLKEAISASVSQGKLVSGATNDANP--VSSVPAYANSLWTEMAVLSKRS  1093
                 H    ++SL +AI  SVS+GKLVSGAT D  P   SSVP +AN +W EM V++KRS
Sbjct  385   KNNNHESKSSISLTDAIRQSVSRGKLVSGATTDPGPDLTSSVPTFANPMWFEMIVIAKRS  444

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
              TN RRMPE+ G R G V VTG ILAT++W++DNSPKG+QER+ F AFAM TTFYTCA+ 
Sbjct  445   MTNSRRMPELFGIRFGAVLVTGIILATIYWKLDNSPKGVQERIAFLAFAMVTTFYTCAEA  504

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             +PVF+QERYIF+RETA+NAYRRSSY L+H+++S P LV+L+L F+A TF+A GL GG +G
Sbjct  505   IPVFLQERYIFMRETAYNAYRRSSYVLAHSIISIPALVVLSLTFAAVTFFAVGLAGGFSG  564

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F F++ IILASFWAG+SFVTFLS +V HVML + +VVAILAYFLLFSGFF++R RIP YW
Sbjct  565   FIFFFFIILASFWAGSSFVTFLSGIVSHVMLGFTVVVAILAYFLLFSGFFISRDRIPAYW  624

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHYISL+KYP+E VLQNEF+DP KCFVRG QMFD+TPL ++P ++K KLL +M   L 
Sbjct  625   IWFHYISLVKYPFEGVLQNEFDDPNKCFVRGVQMFDNTPLGSLPMSMKLKLLKSMSNALG  684

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             + ITSSTCVTT +DIL  QG+TD+SKWNCLWI VAWGF FRILFYF+LL+GS+NKRR
Sbjct  685   INITSSTCVTTASDILTQQGITDISKWNCLWILVAWGFFFRILFYFTLLVGSKNKRR  741



>ref|NP_191069.2| ABC transporter G family member 16 [Arabidopsis thaliana]
 sp|Q9M2V7.2|AB16G_ARATH RecName: Full=ABC transporter G family member 16; Short=ABC transporter 
ABCG.16; Short=AtABCG16; AltName: Full=Probable white-brown 
complex homolog protein 16; Short=AtWBC16 [Arabidopsis 
thaliana]
 gb|AEE79339.1| ABC transporter G family member 16 [Arabidopsis thaliana]
Length=736

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/484 (67%), Positives = 389/484 (80%), Gaps = 13/484 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSI+I+SIHQPS R++ LLDRLI LSRG TV+
Sbjct  253   LFLDEPTSGLDSTSAFMVVKVLKRIAESGSIIIMSIHQPSHRVLSLLDRLIFLSRGHTVF  312

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP F + FG+ +PE +N+ EFALDLIRELEGS  GT+ LVEF+++W   +    
Sbjct  313   SGSPASLPSFFAGFGNPIPENENQTEFALDLIRELEGSAGGTRGLVEFNKKWQEMKKQSN  372

Query  1263  ----SEPATAVHNLSLKEAISASVSQGKLVSGAT------NDANPVSSVPAYANSLWTEM  1114
                 + PA+   NL+LKEAISAS+S+GKLVSG        N      +VPA+AN  W E+
Sbjct  373   PQTLTPPASPNPNLTLKEAISASISRGKLVSGGGGGSSVINHGGGTLAVPAFANPFWIEI  432

Query  1113  AVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTT  934
               L++RS  N RR PE+LG RL  V VTGFILAT+FWR+DNSPKG+QERLGFFAFAMST 
Sbjct  433   KTLTRRSILNSRRQPELLGMRLATVIVTGFILATVFWRLDNSPKGVQERLGFFAFAMSTM  492

Query  933   FYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaag  754
             FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+V+FP L+ L+L F+ TTFWA G
Sbjct  493   FYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSLAFAVTTFWAVG  552

Query  753   lgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNR  574
             L GG  GF FY  IILASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR
Sbjct  553   LEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINR  612

Query  573   ARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLT  394
              RIP YWIWFHY+SL+KYPYEAVLQNEF DPT+CFVRG Q+FD++PL  +   +K +LL 
Sbjct  613   DRIPQYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQLFDNSPLGELTYGMKLRLLD  672

Query  393   AMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSR  214
             ++  ++ +RI+SSTC+TTGAD+L  QGVT LSKWNCL ITV +GFLFRILFY  LLLGS+
Sbjct  673   SVSRSIGMRISSSTCLTTGADVLKQQGVTQLSKWNCLLITVGFGFLFRILFYLCLLLGSK  732

Query  213   NKRR  202
             NKRR
Sbjct  733   NKRR  736



>ref|XP_008369824.1| PREDICTED: ABC transporter G family member 20-like [Malus domestica]
Length=728

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/482 (68%), Positives = 389/482 (81%), Gaps = 11/482 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQ IAQSGSIV++SIHQPS RI+ LLDRLI LS G+TVY
Sbjct  247   LFLDEPTSGLDSTSAYMVVKVLQLIAQSGSIVVMSIHQPSYRILSLLDRLIFLSHGQTVY  306

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             + S  NLP F  +FGH +PE +NR EFALDLIRELE +P GTKSLVEF++ W   +N + 
Sbjct  307   SDSRANLPVFFGEFGHPIPETENRTEFALDLIRELEETPGGTKSLVEFNKSWQITKNQQK  366

Query  1254  ATAVHN-----------LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAV  1108
               A  N           LSLK+AISAS+S+GKLVSGA ND+N  SSVP +AN  W EMAV
Sbjct  367   QRANQNNLMINSCCKPKLSLKDAISASISRGKLVSGAPNDSNLSSSVPTFANPSWIEMAV  426

Query  1107  LSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFY  928
             +SKRS TN RRMPE+ G RLG V +TG ILATMFW +D+SPKGI+ERLGFFAF MSTTFY
Sbjct  427   ISKRSLTNSRRMPELFGIRLGAVLITGIILATMFWHLDSSPKGIKERLGFFAFTMSTTFY  486

Query  927   TCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglg  748
             TCA+ +P F+QERYIF+RETA+NAYRRSSY L+H+L+S P L  L+L F+ATTFWA GL 
Sbjct  487   TCAEAIPSFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLAFLSLTFAATTFWAVGLA  546

Query  747   ggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRAR  568
             GG  GF F++  I A+FWAG+SFVTFLS +V HVML Y +VVAILAYFLLFSGFF++R +
Sbjct  547   GGLHGFLFFFFTIFAAFWAGSSFVTFLSGIVTHVMLGYTVVVAILAYFLLFSGFFISRDK  606

Query  567   IPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAM  388
             IP YW+WFHY+SL+KYPYE  LQNEF+DP KCFVRGT+MFD++PL A P A+K KLL +M
Sbjct  607   IPPYWLWFHYMSLVKYPYEGALQNEFDDPIKCFVRGTEMFDNSPLGAFPVAMKLKLLKSM  666

Query  387   GETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNK  208
               TL V IT+STCVTTGADIL  QG+TDL+KW+CLWIT+A GF FRILFY +LLLGS+NK
Sbjct  667   STTLGVNITASTCVTTGADILKQQGITDLNKWSCLWITIALGFFFRILFYLTLLLGSKNK  726

Query  207   RR  202
             RR
Sbjct  727   RR  728



>ref|XP_010047167.1| PREDICTED: ABC transporter G family member 20-like [Eucalyptus 
grandis]
Length=756

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/478 (68%), Positives = 389/478 (81%), Gaps = 7/478 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++SIHQPS RI+ LLDRLI LSRG TV+
Sbjct  279   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSIHQPSYRIMSLLDRLIFLSRGNTVF  338

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS------G  1273
              GSP +LP+F ++FGH +PE +NR EF LDLIRELE +P GTKS+VEF++ W       G
Sbjct  339   NGSPADLPKFFAEFGHPIPEHENRTEFVLDLIRELEETPGGTKSIVEFNKSWEAKQQSLG  398

Query  1272  GRNSEPATAVHNLSLKEAISASVSQGKLVSGAT-NDANPVSSVPAYANSLWTEMAVLSKR  1096
              RN +        SLK+AISASVS+GKLVSG +  D+N V  VP +AN  W EM V+SKR
Sbjct  399   LRNGDITWTGPKPSLKDAISASVSRGKLVSGGSAGDSNQVVLVPTFANPFWMEMLVISKR  458

Query  1095  SFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCAD  916
             S TN RRMPE+ G R G V VTG ILATMF  +DNSPKG+QERLGFFAFAMSTTFYTCA+
Sbjct  459   SMTNSRRMPELFGIRFGAVMVTGIILATMFRHLDNSPKGVQERLGFFAFAMSTTFYTCAE  518

Query  915   TLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggta  736
              +PVF+Q+RYIF+RETA+NAYRR SY L+HA++S P LVIL+L F+ATTFW  GL GG +
Sbjct  519   AIPVFLQDRYIFMRETAYNAYRRYSYVLAHAIISVPSLVILSLAFAATTFWPVGLAGGFS  578

Query  735   gffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLY  556
             GF F++  + A+FWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R RIP Y
Sbjct  579   GFMFFFYAVFAAFWAGSSFVTFLSGVVSHVMLGFTIVVAILAYFLLFSGFFISRNRIPPY  638

Query  555   WIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETL  376
             WIWFHY+SL+KYPYE+VLQNEF+DP KCFVRG QMFD+TPL+ VP ALK ++L  MG TL
Sbjct  639   WIWFHYLSLVKYPYESVLQNEFDDPAKCFVRGVQMFDNTPLAVVPEALKLRMLKNMGSTL  698

Query  375   NVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              + +T STCVTTG DIL  QG+TD+SKW+CLWIT+AWGF FR+LFYF+LL GS+NKR+
Sbjct  699   GMNLTGSTCVTTGVDILRTQGITDISKWDCLWITIAWGFFFRVLFYFTLLYGSKNKRK  756



>ref|XP_009340895.1| PREDICTED: ABC transporter G family member 20-like [Pyrus x bretschneideri]
Length=727

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/482 (68%), Positives = 387/482 (80%), Gaps = 11/482 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIV++SIHQPS RI+ LLDRLI LS G+TVY
Sbjct  246   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVVMSIHQPSYRILSLLDRLIFLSHGQTVY  305

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             + S  NLP F  +FGH +PE +NR EFALDLIRELE +P GTKSLVEF++ W   +N + 
Sbjct  306   SDSRANLPVFFGEFGHPIPETENRTEFALDLIRELEETPGGTKSLVEFNKSWQITKNQQK  365

Query  1254  ATAVHN-----------LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAV  1108
               A  N           LSLK+AISAS+S+GKLVSGA ND+N  SSVP +AN  W EMAV
Sbjct  366   QRANQNNLMINSKCKPKLSLKDAISASISRGKLVSGAPNDSNLSSSVPTFANPSWIEMAV  425

Query  1107  LSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFY  928
             +SKRS TN RRMPE+ G RLG V VTG ILATMFW +D+SPKGI+ERLGFFAF MSTTFY
Sbjct  426   ISKRSLTNSRRMPELFGIRLGAVLVTGIILATMFWHLDSSPKGIKERLGFFAFTMSTTFY  485

Query  927   TCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglg  748
             TCA+ +P F+QERYIF+RETA+NAYRRSSY L+H+L+S P L  L+L F+ATTFWA GL 
Sbjct  486   TCAEAIPSFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLAFLSLTFAATTFWAVGLA  545

Query  747   ggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRAR  568
             GG  GF F++  I A+FWAG+SFVTFLS VV  VML Y +VVAILAYFLLFSGFF++R +
Sbjct  546   GGLHGFLFFFFTIFAAFWAGSSFVTFLSGVVTQVMLGYTVVVAILAYFLLFSGFFISRDK  605

Query  567   IPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAM  388
             IP YW+WFHY+SL+KYPYE  LQNEF+DP KCFV GTQMFD++PL A P  +K KLL +M
Sbjct  606   IPPYWLWFHYMSLVKYPYEGALQNEFDDPIKCFVTGTQMFDNSPLGAFPVEMKLKLLKSM  665

Query  387   GETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNK  208
               TL V IT+STCVTTGADIL  QG+TDL+KW+CLWIT+A GF FRILFY +LLLGS+NK
Sbjct  666   SRTLGVNITASTCVTTGADILKQQGITDLNKWSCLWITIALGFFFRILFYLTLLLGSKNK  725

Query  207   RR  202
             RR
Sbjct  726   RR  727



>gb|EYU33173.1| hypothetical protein MIMGU_mgv1a018654mg [Erythranthe guttata]
Length=718

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/482 (67%), Positives = 374/482 (78%), Gaps = 14/482 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA+SGS+VI+SIHQPS RI+GLLD++I LSRG+TVY
Sbjct  240   LFLDEPTSGLDSTSAFMVVKVLQRIARSGSVVIMSIHQPSYRILGLLDQMIFLSRGKTVY  299

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +G P NLP F SDFGH +P+ DNR EFALDLIR+LEGSP G KS+ EF++ W   +    
Sbjct  300   SGPPSNLPVFFSDFGHPIPDTDNRTEFALDLIRQLEGSPGGIKSMAEFNKSWQSLKKGNL  359

Query  1263  ------SEPATAVHNLSLKEAISASVSQGKLVSGATNDAN--PVSSVPAYANSLWTEMAV  1108
                   SE  T   NLSLKEAISAS+S+GKLV GAT  +N  P + VP+YAN  W E+AV
Sbjct  360   SNTLCASENNTTTTNLSLKEAISASISRGKLVFGATATSNSSPTAVVPSYANPPWVELAV  419

Query  1107  LSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFY  928
             LS+RSFTN  RMPE+   R+  V VTGFILAT+FWR+D+SPKGIQERLGFFAFAMSTTFY
Sbjct  420   LSRRSFTNSWRMPELFVVRMAAVMVTGFILATIFWRLDDSPKGIQERLGFFAFAMSTTFY  479

Query  927   TCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglg  748
              CAD LPVF+QERYIF+RETA+N YRRSSY L+HAL     L  L L+  A         
Sbjct  480   ACADALPVFLQERYIFMRETAYNTYRRSSYLLAHALT---SLPALLLLSLAFAVATFWAV  536

Query  747   ggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRAR  568
             G    F FY+ II ASFW G+SFV FLS VVP+VML YI+V AI+AYFLLFSGFF+NR R
Sbjct  537   GLDGSFLFYFLIIFASFWVGSSFVAFLSGVVPYVMLGYIIVAAIIAYFLLFSGFFINRDR  596

Query  567   IPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAM  388
             IP YWIWFHYISL+KYPYEAVLQNEFE+  KCFVRG Q+FD TPL+AVP A+K  LL +M
Sbjct  597   IPAYWIWFHYISLVKYPYEAVLQNEFENGAKCFVRGVQIFDGTPLAAVPEAMKVNLLASM  656

Query  387   GETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNK  208
               TL V I SS+CV TG DIL  QGVTDLSKWNCLW+TV WGF FR LFY ++L+GS+NK
Sbjct  657   SGTLGVDINSSSCVMTGVDILRQQGVTDLSKWNCLWVTVGWGFFFRFLFYLAILIGSKNK  716

Query  207   RR  202
             RR
Sbjct  717   RR  718



>ref|XP_006292248.1| hypothetical protein CARUB_v10018456mg [Capsella rubella]
 gb|EOA25146.1| hypothetical protein CARUB_v10018456mg [Capsella rubella]
Length=733

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/484 (67%), Positives = 389/484 (80%), Gaps = 13/484 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIVI+SIHQPS R++ LLDRLI LSRG TV+
Sbjct  250   LFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVIMSIHQPSHRVLSLLDRLIFLSRGHTVF  309

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP F + FG+ +PE +N+ EF LDLIRELEGS  GT+ LVEF+++W   +    
Sbjct  310   SGSPASLPSFFAGFGNPIPENENQTEFTLDLIRELEGSAGGTRGLVEFNKQWQEMKKQSN  369

Query  1263  ----SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVS------SVPAYANSLWTEM  1114
                 + PA+   NL+LKEAISAS+S+GKLVSG    ++ ++      +VPA+AN  W E+
Sbjct  370   LQTLTPPASPNPNLTLKEAISASISRGKLVSGGGASSSAITHGGGTLAVPAFANPFWIEI  429

Query  1113  AVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTT  934
               L+KRS  N RR PE+LG RL  V VTGFILAT+FW +DNSPKG+QERLGFFAFAMST 
Sbjct  430   KTLTKRSILNSRRQPELLGMRLATVVVTGFILATVFWGLDNSPKGVQERLGFFAFAMSTM  489

Query  933   FYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaag  754
             FYTCAD LPVF+QERYIF+RETA+NAYRRSSY LSHA+V+FP L+ L+L F+ TTFWA G
Sbjct  490   FYTCADALPVFLQERYIFMRETAYNAYRRSSYVLSHAIVTFPSLIFLSLAFAVTTFWAVG  549

Query  753   lgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNR  574
             L GG  GF FY  IILASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R
Sbjct  550   LEGGLMGFLFYCLIILASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFITR  609

Query  573   ARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLT  394
              RIP YWIWFHY+SL+KYPYEAVLQNEF DPT+CFVRG Q+FD+TPL  +   +K +LL 
Sbjct  610   DRIPQYWIWFHYLSLVKYPYEAVLQNEFSDPTECFVRGVQIFDNTPLGELAYGMKLRLLD  669

Query  393   AMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSR  214
             ++ +++ + I+SSTC+TTGADIL  QGVT LSKW+CL ITV +GFLFRILFY  LLLGS+
Sbjct  670   SVSQSIGMSISSSTCLTTGADILKKQGVTQLSKWHCLLITVGFGFLFRILFYLCLLLGSK  729

Query  213   NKRR  202
             NKRR
Sbjct  730   NKRR  733



>ref|XP_004246729.1| PREDICTED: ABC transporter G family member 20 [Solanum lycopersicum]
Length=738

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/478 (65%), Positives = 391/478 (82%), Gaps = 7/478 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+ LLDRLI+LSRG TV 
Sbjct  261   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDRLIILSRGHTVL  320

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             T  P  L QF +DFG+ +PE +NR+EFALD IRELEG+P GTK+L+EF++ W  G+NS  
Sbjct  321   TSPPSCLQQFFADFGNPIPENENRIEFALDFIRELEGTPNGTKTLMEFNKIWQRGKNSTT  380

Query  1254  ATAVH----NLSLKEAISASVSQGKLVSGATNDANP---VSSVPAYANSLWTEMAVLSKR  1096
             +T+        SLK+AISASVS+GKLVSGATN+ +P    S+VP +AN  W +M V++KR
Sbjct  381   STSSFYNGPKPSLKDAISASVSRGKLVSGATNNIDPNLSSSNVPKFANPFWVDMVVIAKR  440

Query  1095  SFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCAD  916
             S  N  RMPE+ G R G V VTG ILAT+FW++DNSPKG+QERLGFFAFAMSTTFYTCA+
Sbjct  441   SMLNSMRMPELFGMRFGAVVVTGIILATIFWKLDNSPKGVQERLGFFAFAMSTTFYTCAE  500

Query  915   TLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggta  736
              +PVF+QERYIF+RETA+NAYRRSSY +SHA++S P +++L++ F+ TT+W+ GL GG +
Sbjct  501   AIPVFLQERYIFMRETAYNAYRRSSYVVSHAIISLPSILVLSIAFAVTTYWSVGLAGGVS  560

Query  735   gffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLY  556
             GF ++   ++ASFWAG+SFVTFLS V+ ++M+AY +VVA+LAYF LFSGFF++R RIP Y
Sbjct  561   GFLYFLLFLVASFWAGSSFVTFLSGVIYNIMMAYTVVVAVLAYFFLFSGFFISRDRIPPY  620

Query  555   WIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETL  376
             WIWFHY+SL+KYPY+ VLQNEF DP KCFV+G Q+FD +PL AVP ALK KLL  M +TL
Sbjct  621   WIWFHYMSLVKYPYQGVLQNEFSDPNKCFVKGVQLFDASPLRAVPEALKIKLLQNMSKTL  680

Query  375   NVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              + IT++TC+TTG+DIL   GVTDL+KW C WIT+A GF FRILFYF+LL+GS+NKRR
Sbjct  681   GMNITNTTCLTTGSDILKQSGVTDLNKWTCFWITIALGFFFRILFYFALLVGSKNKRR  738



>gb|KFK34602.1| hypothetical protein AALP_AA5G167000 [Arabis alpina]
Length=728

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/471 (68%), Positives = 387/471 (82%), Gaps = 6/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LSRG TVY
Sbjct  264   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDKLIFLSRGHTVY  323

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LP+F ++FGH +PE +N+ EFALDLIRELE SPEGTK+LVE+ ++W   + S  
Sbjct  324   SGSPTHLPRFFTEFGHPIPENENKTEFALDLIRELEDSPEGTKTLVEYHKQWRAKQTSSQ  383

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
             +    N+SLK+AI+AS+S+GKLVSGATN     SS   +AN +WTEM V+ KRS  N RR
Sbjct  384   SRRNSNVSLKDAITASISRGKLVSGATNLK---SSFQTFANPVWTEMVVIGKRSILNSRR  440

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE+ G RLG V VTG ILAT+FW++DNSP+GIQERLGFFAFAMSTTFYTCA+ +PVF+Q
Sbjct  441   QPELFGIRLGAVLVTGTILATIFWKLDNSPRGIQERLGFFAFAMSTTFYTCAEAIPVFLQ  500

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY L+H ++S P L+IL+  F+ATTFWA GL      FF    
Sbjct  501   ERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSATFAATTFWAVGLSQSFFFFFL---  557

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              ILA+FWAG+SFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIPLYWIWFHY+
Sbjct  558   TILAAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIPLYWIWFHYL  617

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYE VLQNEFEDPTKCF+RG QMFD++PL  VPAA+K  LL +M   L + +T+ 
Sbjct  618   SLVKYPYEGVLQNEFEDPTKCFIRGIQMFDNSPLGQVPAAVKIGLLKSMSGVLGINVTAE  677

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCVTTG DIL  QG+T++SKWNCLWITVA GF FR+ FYF+LL+GS+NKRR
Sbjct  678   TCVTTGIDILKQQGITEISKWNCLWITVALGFFFRVFFYFTLLIGSKNKRR  728



>ref|XP_010504115.1| PREDICTED: ABC transporter G family member 20-like [Camelina 
sativa]
Length=740

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/471 (68%), Positives = 388/471 (82%), Gaps = 3/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LSRG TVY
Sbjct  273   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDKLIFLSRGNTVY  332

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LP+F S+FGH +PE +N+ EFALDLIRELE SPEGTK+LVEF ++W   + S  
Sbjct  333   SGSPTHLPRFFSEFGHPIPENENKPEFALDLIRELEDSPEGTKTLVEFHKQWRAKQTSSQ  392

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
             +    N+SL++AI++S+S+GKLVSGATN     SS   +AN  WTEM V+ KRS  N  R
Sbjct  393   SRRNTNVSLRDAITSSISRGKLVSGATNLK---SSFQTFANPFWTEMLVIGKRSILNSSR  449

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE+ G RLG V VTG ILAT+FW++DNSP+GIQERLGFFAFAMSTTFYTCA+ +PVF+Q
Sbjct  450   QPELFGIRLGAVLVTGIILATIFWKLDNSPRGIQERLGFFAFAMSTTFYTCAEAIPVFLQ  509

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY L+H ++S P L+IL+  F+ATTFWA GL GG+ GFFF++ 
Sbjct  510   ERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSAAFAATTFWAVGLAGGSEGFFFFFF  569

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              IL +FWAG+SFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIP YWIWFHY+
Sbjct  570   TILTAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIPPYWIWFHYL  629

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYE VLQNEFEDPT CFVRG QMFD++PL   PAA K  LL +M   L + +T+ 
Sbjct  630   SLVKYPYEGVLQNEFEDPTTCFVRGIQMFDNSPLGKFPAAAKITLLKSMSGVLGINVTAE  689

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCVT G DIL  +G+T++SKW+CLWITVA GF+FR+LFYF+LL+GS+NKRR
Sbjct  690   TCVTRGIDILKQKGITEISKWSCLWITVALGFVFRVLFYFTLLIGSKNKRR  740



>gb|KHN02392.1| ABC transporter G family member 2 [Glycine soja]
Length=561

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/479 (68%), Positives = 387/479 (81%), Gaps = 8/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+ LLD LI LS G TV+
Sbjct  83    LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDHLIFLSHGNTVF  142

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS-GGRNSE  1258
             +GSP NLP F S+FGH +PE +NR EFALDLIRELE    GTKSLV+F++ W    +N  
Sbjct  143   SGSPANLPAFFSEFGHPIPENENRTEFALDLIRELEQEATGTKSLVDFNKSWQLKNKNQA  202

Query  1257  PATAVHN--LSLKEAISASVSQGKLVSGAT----NDANPVSSVPAYANSLWTEMAVLSKR  1096
              A   ++  LSLK+AISAS+S+GKLVSG      N++  + SVPA+ANS W EM V+ KR
Sbjct  203   QAQNEYDSKLSLKDAISASISRGKLVSGTNGNGRNNSTALVSVPAFANSFWMEMLVIGKR  262

Query  1095  SFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCAD  916
             S TN RRMPE+ G RLG V VTG ILAT+FW +D+SPKG+QER+GFFAFAMSTTFYTCA+
Sbjct  263   SLTNSRRMPELFGIRLGAVLVTGAILATIFWHLDDSPKGVQERVGFFAFAMSTTFYTCAE  322

Query  915   TLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggta  736
              +PVF+QERYIF+RETAHNAYRRSSY L+HA++S P L+ L+L F+ATTFWA G+ GGT+
Sbjct  323   AMPVFLQERYIFMRETAHNAYRRSSYALAHAIISLPSLLFLSLAFAATTFWAVGMTGGTS  382

Query  735   gffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLY  556
             GF FY+  ILASFWAGNSFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIP Y
Sbjct  383   GFLFYFITILASFWAGNSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIPPY  442

Query  555   WIWFHYISLIKYPYEAVLQNEFE-DPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET  379
             WIWFHY+SL+KYPYE VLQNEF+    +CFVRG QMF++TPL  VP ALK +LL +M +T
Sbjct  443   WIWFHYLSLVKYPYEGVLQNEFDVRSPRCFVRGIQMFENTPLGMVPEALKVELLKSMSQT  502

Query  378   LNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             L + IT STCV TG D+L  QG+T L+KWNCLWIT+AWGF FR LFY +LL GSRNKRR
Sbjct  503   LGMNITRSTCVVTGEDVLKQQGITQLTKWNCLWITLAWGFFFRFLFYLALLFGSRNKRR  561



>gb|KFK36827.1| hypothetical protein AALP_AA4G176600 [Arabis alpina]
Length=736

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/486 (66%), Positives = 388/486 (80%), Gaps = 15/486 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL+RIAQSGSIV++SIHQPS R++GLLDRLI LSRG TVY
Sbjct  251   LFLDEPTSGLDSTSAFMVVNVLKRIAQSGSIVVMSIHQPSHRVLGLLDRLIFLSRGHTVY  310

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP+F S+FG  +PE +NR EFALDLIRELEGSP GT++LVEF+++W   +    
Sbjct  311   SGSPASLPRFFSEFGSPIPENENRTEFALDLIRELEGSPGGTRALVEFNKKWQEMKKQSN  370

Query  1263  -----SEPATAVHNLSLKEAISASVSQGKLVSGATNDA---NPVSS----VPAYANSLWT  1120
                  + PA+   NL+LKEAI+AS+S+GKLVSG  + A   N  ++    VP++AN +W 
Sbjct  371   RQPPLTPPASPYPNLTLKEAIAASISRGKLVSGGESSAVQQNATATTTLAVPSFANPMWI  430

Query  1119  EMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMS  940
             E+  LS+RS  N RR PE+ G +L  V VTGFILAT+FWR+DNSPKGI+ERLGFFAFAMS
Sbjct  431   EIKTLSQRSMLNARRQPELFGIKLASVMVTGFILATVFWRLDNSPKGIRERLGFFAFAMS  490

Query  939   TTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwa  760
             T +YTC + LP F+QERYIF+RETA+NAYRRSSY LSHA+VSFP L++L + F+  TFWA
Sbjct  491   TMYYTCVEALPDFLQERYIFMRETAYNAYRRSSYVLSHAIVSFPSLIVLTVAFAVPTFWA  550

Query  759   aglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFM  580
              GL GG  G  FY  IILASFW+G+SFVTFLS +VP+VML Y + VAILAYFLLFSGFF+
Sbjct  551   VGLDGGLMGLLFYCLIILASFWSGSSFVTFLSGLVPNVMLGYTISVAILAYFLLFSGFFI  610

Query  579   NRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKL  400
             NR RIP YW+WFHY+SL+KY YEAVLQNEF D TKCFVRG Q FD+TPL  +P  +K +L
Sbjct  611   NRNRIPDYWVWFHYMSLVKYSYEAVLQNEFSDATKCFVRGVQTFDNTPLGELPEVMKLRL  670

Query  399   LTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLG  220
             L  + ++L   I+SSTC+TTGADIL  QGVT LSKW+CL +TVA+GF FR+LFYFSLLLG
Sbjct  671   LDTISKSLGTTISSSTCMTTGADILTNQGVTQLSKWHCLLVTVAFGFFFRVLFYFSLLLG  730

Query  219   SRNKRR  202
             S+NKRR
Sbjct  731   SKNKRR  736



>ref|XP_011094785.1| PREDICTED: ABC transporter G family member 20-like [Sesamum indicum]
Length=737

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/472 (67%), Positives = 388/472 (82%), Gaps = 1/472 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVILSIHQPS RI+ LLDRLI+LS G+TV+
Sbjct  266   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVILSIHQPSYRILSLLDRLIILSHGQTVF  325

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G+P  LPQF ++FG  +P  +++ EFALD IRELE +P GTK+LV+F++ W        
Sbjct  326   SGAPGVLPQFFAEFGKPIPVNEDKTEFALDYIRELESTPGGTKNLVDFNKTWQKRNPLSR  385

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATN-DANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
             ++    LSLK+AISAS+S GKLVSGATN D N  SSVP YAN  W EM V++ R+ TN R
Sbjct  386   SSTGPKLSLKDAISASISMGKLVSGATNMDPNLSSSVPKYANPFWKEMVVIADRAITNSR  445

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE+ G R G V VTG ILAT+FWR+DNSPKG+QERLGFFAFAMSTTFYTCA+ +PVF+
Sbjct  446   RAPELFGARFGAVLVTGIILATIFWRLDNSPKGVQERLGFFAFAMSTTFYTCAEAIPVFL  505

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
              ERYIF+RETA+NAYRRSSY LS +++S P L+IL+L F+ TT+WA GL GGT+GF FY+
Sbjct  506   LERYIFMRETAYNAYRRSSYVLSQSIISIPSLLILSLAFAVTTYWAVGLAGGTSGFLFYF  565

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
               ILASFWAG+SFVTFLS ++ ++M+AY +VVAILAYFLLFSGFF+ R RIP YWIWFHY
Sbjct  566   IFILASFWAGSSFVTFLSGIIFNLMMAYTVVVAILAYFLLFSGFFITRDRIPSYWIWFHY  625

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
              SL+KYPY+ V+QNEF+DP+KCFVRG Q+FD +PL AVP +LK KLL +M +TL + ITS
Sbjct  626   ASLVKYPYQGVMQNEFDDPSKCFVRGIQVFDGSPLRAVPDSLKLKLLKSMSKTLGMNITS  685

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             STC+TTG+DIL   GVTD+ KW+CLWIT+A GF FR+LFYF+LL+GS+NKRR
Sbjct  686   STCLTTGSDILKQSGVTDIDKWSCLWITIALGFFFRVLFYFALLIGSKNKRR  737



>ref|XP_006403493.1| hypothetical protein EUTSA_v10010146mg [Eutrema salsugineum]
 gb|ESQ44946.1| hypothetical protein EUTSA_v10010146mg [Eutrema salsugineum]
Length=740

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/487 (66%), Positives = 390/487 (80%), Gaps = 16/487 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIV++SIHQPS R++GLLDRLI LSRG TVY
Sbjct  254   LFLDEPTSGLDSTSAFMVVKVLKRIAESGSIVMMSIHQPSHRVLGLLDRLIFLSRGHTVY  313

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP F + FG+ +PE +N+ EFALDLIRELEGS  GT+ LVEF++RW   +    
Sbjct  314   SGSPASLPSFFAGFGNPIPENENQTEFALDLIRELEGSAGGTRGLVEFNKRWQEMKKQSN  373

Query  1263  -----SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--------SVPAYANSLW  1123
                  + PA+   NL+LKEAISAS+S+GKLVSG    ++ V+        +VPA+AN  W
Sbjct  374   PQQTLTPPASPYPNLTLKEAISASISRGKLVSGGGAGSSAVNHGTGTTTLAVPAFANPFW  433

Query  1122  TEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAM  943
              E+  LSKRS  N RR PE+ G RL  V VTGFILAT+FWR+DNSPKG+QERLGFFA+AM
Sbjct  434   IEIKTLSKRSILNSRRQPELFGIRLASVIVTGFILATVFWRLDNSPKGVQERLGFFAYAM  493

Query  942   STTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfw  763
             ST FYTCA+ LPVF+QERYIF+RETA+NAYRRSSY +SH++VS P L+ L++ F+ATTFW
Sbjct  494   STMFYTCAEALPVFLQERYIFMRETAYNAYRRSSYVISHSIVSLPSLIFLSVAFAATTFW  553

Query  762   aaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF  583
             A GL GG  GF FY  IILASFW+G+SFVTF+S VVPHVML Y +VVAILAYFLLFSGFF
Sbjct  554   AVGLEGGPMGFLFYCLIILASFWSGSSFVTFISGVVPHVMLGYTVVVAILAYFLLFSGFF  613

Query  582   MNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEK  403
             +NR RIP YWIWFHY+SL+KYPYEAVL NEF DP +CFVRG Q+FD+TPL  +   +K K
Sbjct  614   INRDRIPHYWIWFHYLSLVKYPYEAVLLNEFSDPMECFVRGVQIFDNTPLGELTYGMKLK  673

Query  402   LLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLL  223
             LL ++  ++ +RITSSTC+TTGADIL  QGVT+LSKW+CL +TV +GFLFR LFY  LLL
Sbjct  674   LLDSVSRSIGMRITSSTCLTTGADILKKQGVTELSKWDCLLVTVGFGFLFRALFYLCLLL  733

Query  222   GSRNKRR  202
             GS+NKRR
Sbjct  734   GSKNKRR  740



>gb|KDP29036.1| hypothetical protein JCGZ_16425 [Jatropha curcas]
Length=745

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/477 (68%), Positives = 388/477 (81%), Gaps = 7/477 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+ LLDRLI LS G+TVY
Sbjct  270   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDRLIFLSHGQTVY  329

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG-----G  1270
              G P  +PQF ++FGH +PE +NR EFALDLIRELE  P GT +LVEF+R W        
Sbjct  330   AGPPAGVPQFFAEFGHPIPENENRTEFALDLIRELEEIPGGTTTLVEFNRSWQAQATKIS  389

Query  1269  RNSEPATAVHNLSLKEAISASVSQGKLVSGATNDA-NPVSSVPAYANSLWTEMAVLSKRS  1093
             RN   + +   +SLK+AISASVS+GKLVSGATND+ N  SSVP +AN  W EM V++KRS
Sbjct  390   RNQNLSNS-SKVSLKDAISASVSKGKLVSGATNDSTNLSSSVPTFANPFWIEMLVIAKRS  448

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
               N RRMPE+ G R G V VT  ILAT+FW +DNSP+G QERLGFFAFAMSTT+YTCA++
Sbjct  449   IINSRRMPELFGIRFGAVFVTALILATIFWHLDNSPRGAQERLGFFAFAMSTTYYTCAES  508

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             +P F+QERYIF+RETA+NAYRRSSY L+H+++S P L++L+  F+ATT+W  GL GG +G
Sbjct  509   IPAFLQERYIFMRETAYNAYRRSSYVLAHSIISIPSLIVLSFAFAATTYWTVGLAGGVSG  568

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F F++  +L++FWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R RIP YW
Sbjct  569   FLFFFFTVLSAFWAGSSFVTFLSGVVSHVMLGFTIVVAILAYFLLFSGFFISRDRIPPYW  628

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHY+SL+KYPYE  LQNEF+DPTKCFVRG QMFD+TPL+AVP  LK KLL ++  TL 
Sbjct  629   IWFHYLSLVKYPYEGALQNEFQDPTKCFVRGVQMFDNTPLNAVPLPLKLKLLKSLSSTLG  688

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
               ITSSTC+ TG DIL  QG+TDLSKW+CLWITVAWGF FR+LFYF+LL+GS+N+RR
Sbjct  689   RNITSSTCIVTGPDILRAQGITDLSKWSCLWITVAWGFFFRVLFYFTLLVGSKNRRR  745



>ref|XP_010534453.1| PREDICTED: ABC transporter G family member 16-like [Tarenaya 
hassleriana]
Length=752

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/477 (69%), Positives = 388/477 (81%), Gaps = 7/477 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VV VL+RIA+SGSIV++SIHQPS R++GLLDRLI LSRG+TV+
Sbjct  277   LFLDEPTSGLDSTSAYMVVNVLKRIAESGSIVVMSIHQPSYRVLGLLDRLIFLSRGQTVF  336

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN---  1264
             +GSP +LP F S+FGH +PE +N+ EFALDLIRELEGS  GT+ LVEF+++W   +    
Sbjct  337   SGSPSSLPLFFSEFGHPIPENENKTEFALDLIRELEGSAGGTRGLVEFNKKWQEMKQIRR  396

Query  1263  ---SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRS  1093
                + PAT    ++LKEAISAS+S+GKL SG          VP++AN  W E+  LSKRS
Sbjct  397   QTLTPPATP-SGITLKEAISASISRGKLFSGGAGGNGGSVMVPSFANPFWVELMALSKRS  455

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
               N RR PE+ GTR+  V +TGFILAT+FWR+DNSPKG+QERLGFFAFAMST FYTCA+ 
Sbjct  456   MLNSRRQPELFGTRVAAVVITGFILATVFWRLDNSPKGVQERLGFFAFAMSTMFYTCAEA  515

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVF+QERYIF+RETAHNAYRRSSY LSHALVS P LV+L+L F+ TTFWA GL GG  G
Sbjct  516   LPVFLQERYIFMRETAHNAYRRSSYVLSHALVSLPSLVLLSLAFAVTTFWAVGLDGGGIG  575

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F FY  IILASFW+GNSFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YW
Sbjct  576   FLFYCLIILASFWSGNSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPPYW  635

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHY+SL+KYP+EAVLQNEF DPT+CFVRG Q+FD+TPL  +P A+K  LL  + ++L 
Sbjct  636   IWFHYMSLVKYPFEAVLQNEFSDPTECFVRGVQVFDNTPLGELPEAVKVSLLGTVSQSLG  695

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             + ITS TC+TTGADIL  QG+T LSKWNCLW+TVAWGF FR+LFYF LLLGS+NKRR
Sbjct  696   MTITSDTCLTTGADILKQQGITQLSKWNCLWVTVAWGFFFRVLFYFCLLLGSKNKRR  752



>ref|XP_009765003.1| PREDICTED: ABC transporter G family member 20-like [Nicotiana 
sylvestris]
Length=740

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/476 (66%), Positives = 392/476 (82%), Gaps = 5/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSG IVI+SIHQPS RI+ LLD LI+LSRG TV+
Sbjct  265   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGGIVIMSIHQPSYRILSLLDHLIILSRGNTVF  324

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             T SP +L QF ++FG+ +PE +NR+EFALD IRELEG+P GTK+LVEF++ W   + S  
Sbjct  325   TSSPSSLQQFFAEFGNPIPENENRIEFALDFIRELEGTPNGTKNLVEFNKTWQRKKTSNS  384

Query  1254  ATAVHN---LSLKEAISASVSQGKLVSGATNDANPVSS--VPAYANSLWTEMAVLSKRSF  1090
             ++  +N    SLK+AISASVS+GKLVSGATN  + +SS  +P +AN  W +M V++KRS 
Sbjct  385   SSLFYNGTKPSLKDAISASVSRGKLVSGATNIDSSLSSSNIPKFANPFWVDMVVIAKRSM  444

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  RMPE+ G R G V VTG ILAT+FW++DNSPKG+QER+GFFAFAMSTTFYTCA+ +
Sbjct  445   LNSMRMPELFGMRFGAVVVTGIILATIFWKLDNSPKGVQERVGFFAFAMSTTFYTCAEAI  504

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QERYIF+RETA+NAYRRSSY LSHA++S P +++L++ F+ TT+W+ GL GG +GF
Sbjct  505   PVFLQERYIFMRETAYNAYRRSSYVLSHAIISLPSILVLSIAFAVTTYWSVGLAGGVSGF  564

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              F+   ++ASFWAG+SFVTFLS V+ +VM+AY +VVAILAYF+LFSG+F++R RIP YWI
Sbjct  565   LFFLLFMVASFWAGSSFVTFLSGVIYNVMMAYTVVVAILAYFVLFSGYFISRDRIPPYWI  624

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPY+ VLQNEF+DP KCFV+G Q+FD +PL AVP  LK KLL  M +TL +
Sbjct  625   WFHYMSLVKYPYQGVLQNEFDDPLKCFVKGIQIFDGSPLRAVPEQLKIKLLHNMSKTLGM  684

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              ITSSTC+TTGADIL   GV DL+KW+CLWIT+A GF FRILFYF+L++GS+NKRR
Sbjct  685   NITSSTCLTTGADILKQTGVNDLNKWSCLWITIALGFFFRILFYFALVIGSKNKRR  740



>ref|XP_007162694.1| hypothetical protein PHAVU_001G172400g [Phaseolus vulgaris]
 gb|ESW34688.1| hypothetical protein PHAVU_001G172400g [Phaseolus vulgaris]
Length=743

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/480 (68%), Positives = 385/480 (80%), Gaps = 13/480 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+GLLD +I LS G TVY
Sbjct  266   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDHMIFLSHGNTVY  325

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW------SG  1273
             +GSP NLP F S+FGH +PE +NR EFALDLIRELE  P GTKSLV+F++ W      S 
Sbjct  326   SGSPTNLPAFFSEFGHPIPENENRTEFALDLIRELEEEPGGTKSLVDFNKSWQLKEKNSA  385

Query  1272  GRNSEPATAVHNLSLKEAISASVSQGKLVSGAT---NDANPVSSVPAYANSLWTEMAVLS  1102
                +EP    +  SLK+AISAS+S+GKLVSGA    N++  V SVPA+AN  W EMAV+ 
Sbjct  386   QAQNEPK---NKPSLKDAISASISRGKLVSGANGNGNNSTAVVSVPAFANPFWMEMAVIG  442

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
             KRS  N  RMPE+ G RLG V VTG ILAT+FW +D+SPKG+QER+GFFAFAMSTTFYTC
Sbjct  443   KRSLKNSWRMPELFGVRLGAVLVTGTILATIFWHLDDSPKGVQERVGFFAFAMSTTFYTC  502

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
             A+ +PVF+QERYIF+RETA+NAYRRSSY LSHA++S P LV L+  F+ATTFWA GL GG
Sbjct  503   AEAIPVFLQERYIFMRETAYNAYRRSSYVLSHAIISLPSLVFLSFAFAATTFWAVGLAGG  562

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
             ++GF FY+ +I+ASFWAG+SFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIP
Sbjct  563   SSGFVFYFLVIVASFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIP  622

Query  561   LYWIWFHYISLIKYPYEAVLQNEFE-DPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
              YW+WFHY+SL+KYPYE VLQNEF+ +  +CFVRG QMFD+TPL  V   LK +LL +M 
Sbjct  623   PYWLWFHYLSLVKYPYEGVLQNEFDVNSPRCFVRGIQMFDNTPLGMVADTLKVELLKSMS  682

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              TL + I+ STCV TGAD+L  QG+T LSKW+CLWITVAWGF FR LFY +LL GS+NKR
Sbjct  683   NTLGMNISRSTCVITGADVLKQQGITQLSKWSCLWITVAWGFFFRFLFYLTLLFGSKNKR  742



>ref|XP_008777932.1| PREDICTED: ABC transporter G family member 6 [Phoenix dactylifera]
Length=730

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/477 (68%), Positives = 388/477 (81%), Gaps = 10/477 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VLQRIA+SGS+V++S+HQPS RI+GLLDRLI LSRG TVY
Sbjct  258   LFLDEPTSGLDSTSAFMVVQVLQRIARSGSVVVMSVHQPSYRILGLLDRLIFLSRGRTVY  317

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPE-GTKSLVEFSRRWS-----G  1273
             +G P  LP F ++FGH +PE +NR EFALDLIRELE S + G+K LV+F+R W       
Sbjct  318   SGPPDGLPVFFAEFGHPIPENENRTEFALDLIRELETSGQTGSKPLVDFNRSWQLMKLPP  377

Query  1272  GRNSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRS  1093
             GR+   A    +LSLK+AISAS+S+GKLV GAT+     SSVP +AN  W EM VL+KRS
Sbjct  378   GRHFPGA----HLSLKDAISASISRGKLVYGATDGPGSASSVPTFANPFWIEMGVLTKRS  433

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
             FTN RRMPE+   RLG V VTGFILAT+FWR+D+SP+G+QERLGFFAF+MST +YTCAD 
Sbjct  434   FTNTRRMPELFLIRLGAVLVTGFILATIFWRLDSSPRGVQERLGFFAFSMSTMYYTCADA  493

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVF+QERYIF+RETA+NAYRRSSY LS+A+V FP LV+L+  F+ATTF+A GL GG +G
Sbjct  494   LPVFLQERYIFMRETAYNAYRRSSYVLSNAVVGFPSLVLLSAAFAATTFFAVGLAGGFSG  553

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F F++ IILASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YW
Sbjct  554   FAFFFLIILASFWAGSGFVTFLSGVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPGYW  613

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHY+SL+KYPYEAVL+NEF    +CFVRG Q+FD+TP   +P  +K+++L A+   L 
Sbjct  614   IWFHYLSLVKYPYEAVLRNEFGMAAECFVRGEQIFDNTPFGNMPGEMKQRVLGAISGALG  673

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              RITS TCVTTG DIL  QG+T L KW+CLW+TVAWGF FR+LFYFSLL+GS+NKRR
Sbjct  674   TRITSGTCVTTGEDILRQQGITQLGKWDCLWVTVAWGFFFRVLFYFSLLIGSKNKRR  730



>ref|XP_010515843.1| PREDICTED: ABC transporter G family member 20-like [Camelina 
sativa]
Length=740

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/471 (68%), Positives = 386/471 (82%), Gaps = 3/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LSRG TVY
Sbjct  273   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDKLIFLSRGNTVY  332

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LP+F S+FGH +PE +N+ EFALDLIRELE SPEGTK+LVEF ++W   + S  
Sbjct  333   SGSPTHLPRFFSEFGHPIPENENKPEFALDLIRELEDSPEGTKTLVEFHKQWRAKQTSSQ  392

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
             +    N+SL++AI++S+S+GKLVSGATN     SS   +AN  WTEM V+ KRS  N  R
Sbjct  393   SRRNTNVSLRDAITSSISRGKLVSGATNLK---SSFQTFANPFWTEMLVIGKRSILNSSR  449

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
              PE+ G RLG V VTG ILAT+FW++DNSP+GIQERLGFFAFAMSTTFYTCA+ +PVF+Q
Sbjct  450   QPELFGIRLGAVLVTGIILATIFWKLDNSPRGIQERLGFFAFAMSTTFYTCAEAIPVFLQ  509

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY L+H ++S P L+IL+  F+ATTFWA GL GG+ GFFF++ 
Sbjct  510   ERYIFMRETAYNAYRRSSYVLAHTIISIPALIILSAAFAATTFWAVGLAGGSEGFFFFFF  569

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              IL +FWAG+SFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIP  WIWFHY+
Sbjct  570   TILTAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIPPCWIWFHYL  629

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+ YPYE VLQNEFEDPT CFVRG QMFD++PL   PAA K  LL +M   L + +T+ 
Sbjct  630   SLVTYPYEGVLQNEFEDPTTCFVRGIQMFDNSPLGQFPAAAKITLLKSMSGVLGINVTAE  689

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCVT G DIL  QG+T++SKW+CLWITVA GF+FR+LFYF+LL+GS+NKRR
Sbjct  690   TCVTAGIDILKQQGITEISKWSCLWITVALGFVFRVLFYFTLLIGSKNKRR  740



>ref|XP_006345684.1| PREDICTED: ABC transporter G family member 20-like [Solanum tuberosum]
Length=741

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/477 (66%), Positives = 388/477 (81%), Gaps = 6/477 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+ LLDRLI+LSRG TV 
Sbjct  265   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDRLIILSRGHTVL  324

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             T  P +L QF +DFG+ +PE +NR+EFALD IRELEG+P GTK+L+EF++ W   RNS  
Sbjct  325   TSPPSSLQQFFADFGNPIPENENRIEFALDFIRELEGTPNGTKTLMEFNKTWQRERNSTT  384

Query  1254  ATAVH----NLSLKEAISASVSQGKLVSGATN-DANPVSS-VPAYANSLWTEMAVLSKRS  1093
             +T+        SLK+AISASVS+GKLVSGATN D N  SS VP +AN  W +M V++KRS
Sbjct  385   STSSFYNGPKPSLKDAISASVSRGKLVSGATNIDPNVSSSNVPKFANPFWVDMVVIAKRS  444

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
               N  RMPE+ G R G V VTG ILAT+FW++DNSPKG+QERLGFFAFAMSTTFYTCA+ 
Sbjct  445   MLNSMRMPELFGMRFGAVVVTGIILATIFWKLDNSPKGVQERLGFFAFAMSTTFYTCAEA  504

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             +PVF+QERYIF+RETAHNAYRRSSY +SHA++S P +++L++ F+ TT+W+ GL GG +G
Sbjct  505   IPVFLQERYIFMRETAHNAYRRSSYVVSHAIISLPSILVLSIAFAVTTYWSVGLAGGVSG  564

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F ++   +LASFWAG+SFVTFLS V+ ++M+AY +VVA+LAYF LFSGFF++R RIP YW
Sbjct  565   FLYFLLFLLASFWAGSSFVTFLSGVIYNIMMAYTVVVAVLAYFFLFSGFFISRDRIPPYW  624

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHY+SL+KYPY+ VLQNEF DP KCFV+G Q+FD +PL AVP ALK KLL  M +TL 
Sbjct  625   IWFHYMSLVKYPYQGVLQNEFSDPNKCFVKGVQLFDTSPLRAVPEALKIKLLQNMSKTLG  684

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             + IT++TC+TTG+DIL   G TDL+KW C WIT+  GF FRILFYF+LL+GS+NKRR
Sbjct  685   MNITNTTCLTTGSDILKQSGGTDLNKWTCFWITIGLGFFFRILFYFALLIGSKNKRR  741



>ref|NP_181272.1| ABC transporter G family member 2 [Arabidopsis thaliana]
 sp|Q9ZUT0.1|AB2G_ARATH RecName: Full=ABC transporter G family member 2; Short=ABC transporter 
ABCG.2; Short=AtABCG2; AltName: Full=White-brown complex 
homolog protein 2; Short=AtWBC2 [Arabidopsis thaliana]
 gb|AAC98055.1| putative ABC transporter [Arabidopsis thaliana]
 gb|AEC09388.1| ABC transporter G family member 2 [Arabidopsis thaliana]
Length=755

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/477 (66%), Positives = 382/477 (80%), Gaps = 6/477 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ V+KVLQRIAQSGSIVI+SIHQPS RI+GLLD+LI LS+G TVY
Sbjct  279   LFLDEPTSGLDSTSAYMVIKVLQRIAQSGSIVIMSIHQPSYRIMGLLDQLIFLSKGNTVY  338

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LPQF S+F H +PE +N+ EFALDLIRELE S EGTK LVEF ++W   +    
Sbjct  339   SGSPTHLPQFFSEFKHPIPENENKTEFALDLIRELEYSTEGTKPLVEFHKQWRAKQAPSY  398

Query  1254  ATAVHNL----SLKEAISASVSQGKLVSGATND--ANPVSSVPAYANSLWTEMAVLSKRS  1093
                        SLKEAI+AS+S+GKLVSGATN+  +N   S   +AN  W EM V+ KR+
Sbjct  399   NNNNKRNTNVSSLKEAITASISRGKLVSGATNNNSSNLTPSFQTFANPFWIEMIVIGKRA  458

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
               N RR PE+LG RLG V VTG ILATMF  +DNSPKG QERLGFFAFAMSTTFYTCA+ 
Sbjct  459   ILNSRRQPELLGMRLGAVMVTGIILATMFTNLDNSPKGAQERLGFFAFAMSTTFYTCAEA  518

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             +PVF+QERYIF+RETA+NAYRRSSY LS +++S P L++L+  F+ATTFWA GL GG  G
Sbjct  519   IPVFLQERYIFMRETAYNAYRRSSYVLSQSIISIPALIVLSASFAATTFWAVGLDGGANG  578

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             FFF+Y  ILASFWAG+SFVTFLS V+P+VML + +VVAILAYFLLFSGFF++R RIP+YW
Sbjct  579   FFFFYFTILASFWAGSSFVTFLSGVIPNVMLGFTVVVAILAYFLLFSGFFISRDRIPVYW  638

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             +WFHYISL+KYPYE VLQNEF++PT+CF RG Q+FD++PL   P  +K  LL +M   L 
Sbjct  639   LWFHYISLVKYPYEGVLQNEFQNPTRCFARGVQLFDNSPLGEFPNDVKVNLLKSMSGVLG  698

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
               +T+ TCVTTG DIL  QG+TD+SKWNCLWITVAWGF FR+LFYF+LL+GS+NKR+
Sbjct  699   TNVTAETCVTTGIDILKQQGITDISKWNCLWITVAWGFFFRVLFYFTLLIGSKNKRK  755



>ref|XP_004302811.1| PREDICTED: ABC transporter G family member 2-like [Fragaria vesca 
subsp. vesca]
Length=736

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/482 (70%), Positives = 398/482 (83%), Gaps = 13/482 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+GLLDRL+LLS G+TVY
Sbjct  257   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSVHQPSYRILGLLDRLVLLSHGQTVY  316

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW--------  1279
             +GSP NLP F  +FGH +PE +NR EFALDLIRELE +P GTKSLVEF+++W        
Sbjct  317   SGSPANLPVFFREFGHPIPETENRTEFALDLIRELEETPGGTKSLVEFNKKWQITKRQKF  376

Query  1278  ---SGGRNSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAV  1108
                +G  NS  A+++  LSLK+AISAS+S+GKLVSGA +D N  SSVP +AN +WTEM V
Sbjct  377   KQANGSDNS--ASSMPKLSLKDAISASISRGKLVSGAPSDTNLASSVPTFANPIWTEMLV  434

Query  1107  LSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFY  928
             +SKRS  N  RMPE+ G RLG V VTG ILATMFW +D+SPKG++ERLGFFAFAMSTTFY
Sbjct  435   ISKRSIKNSTRMPELFGIRLGAVLVTGIILATMFWHLDDSPKGVEERLGFFAFAMSTTFY  494

Query  927   TCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglg  748
             TCA+ +PVF+QERYIF+RETA+NAYRRSSY L+H+L+S P L+IL+L F+ATTFWA GL 
Sbjct  495   TCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHSLLSIPSLLILSLAFAATTFWAVGLA  554

Query  747   ggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRAR  568
             GG  GF F+   I ++FWAG+SFVTFLS VV HVML Y +VVAILAYFLLFSGFF++R R
Sbjct  555   GGLQGFLFFLLTICSAFWAGSSFVTFLSGVVTHVMLGYTVVVAILAYFLLFSGFFISRDR  614

Query  567   IPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAM  388
             IP+YWIWFHYISL+KYPYEAVLQNEF+D  KC V G QMFD+TPL  VP ALK KLL  M
Sbjct  615   IPVYWIWFHYISLVKYPYEAVLQNEFDDHMKCLVTGIQMFDNTPLGDVPVALKLKLLENM  674

Query  387   GETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNK  208
               TL + +T+S+CVTTG DIL  QG+TD+SKWNCLW+T+AWGF FR+LFYF+LLLGS+NK
Sbjct  675   SNTLGMNVTASSCVTTGLDILKRQGITDISKWNCLWVTIAWGFFFRVLFYFTLLLGSKNK  734

Query  207   RR  202
             RR
Sbjct  735   RR  736



>ref|XP_003553533.1| PREDICTED: ABC transporter G family member 20-like [Glycine max]
Length=736

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/479 (68%), Positives = 387/479 (81%), Gaps = 8/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+ LLD LI LS G TV+
Sbjct  258   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDHLIFLSHGNTVF  317

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS-GGRNSE  1258
             +GSP NLP F S+FGH +PE +NR EFALDLIRELE    GTKSLV+F++ W    +N  
Sbjct  318   SGSPANLPAFFSEFGHPIPENENRTEFALDLIRELEQEATGTKSLVDFNKSWQLKNKNQA  377

Query  1257  PATAVHN--LSLKEAISASVSQGKLVSGAT----NDANPVSSVPAYANSLWTEMAVLSKR  1096
              A   ++  LSLK+AISAS+S+GKLVSG      N++  + SVPA+ANS W EM V+ KR
Sbjct  378   QAQNEYDSKLSLKDAISASISRGKLVSGTNGNGRNNSTALVSVPAFANSFWMEMLVIGKR  437

Query  1095  SFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCAD  916
             S TN RRMPE+ G RLG V VTG ILAT+FW +D+SPKG+QER+GFFAFAMSTTFYTCA+
Sbjct  438   SLTNSRRMPELFGIRLGAVLVTGAILATIFWHLDDSPKGVQERVGFFAFAMSTTFYTCAE  497

Query  915   TLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggta  736
              +PVF+QERYIF+RETAHNAYRRSSY L+HA++S P L+ L+L F+ATTFWA G+ GGT+
Sbjct  498   AMPVFLQERYIFMRETAHNAYRRSSYVLAHAIISLPSLLFLSLAFAATTFWAVGMTGGTS  557

Query  735   gffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLY  556
             GF FY+  ILASFWAGNSFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIP Y
Sbjct  558   GFLFYFITILASFWAGNSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIPPY  617

Query  555   WIWFHYISLIKYPYEAVLQNEFE-DPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET  379
             WIWFHY+SL+KYPYE VLQNEF+    +CFVRG QMF++TPL  VP ALK +LL +M +T
Sbjct  618   WIWFHYLSLVKYPYEGVLQNEFDVRSPRCFVRGIQMFENTPLGMVPEALKVELLKSMSQT  677

Query  378   LNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             L + IT STCV TG D+L  QG+T L+KWNCLWIT+AWGF FR LFY +LL GSRNKRR
Sbjct  678   LGMNITRSTCVVTGEDVLKQQGITQLTKWNCLWITLAWGFFFRFLFYLALLFGSRNKRR  736



>ref|XP_006843658.1| hypothetical protein AMTR_s00007p00181450 [Amborella trichopoda]
 gb|ERN05333.1| hypothetical protein AMTR_s00007p00181450 [Amborella trichopoda]
Length=743

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/476 (68%), Positives = 389/476 (82%), Gaps = 5/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLI LSRG+TVY
Sbjct  268   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVY  327

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G P+ LP F S+FGH +PE +NR EFALDLIRELEG+P G K+LVEF+++W      + 
Sbjct  328   SGPPLKLPDFFSEFGHAMPESENRTEFALDLIRELEGTPGGIKALVEFNKQWQKAYPPQA  387

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATND-----ANPVSSVPAYANSLWTEMAVLSKRSF  1090
             +     LSLK+AISAS+S+GKLVSG         ++  S++  +AN  WTEM VL++RS 
Sbjct  388   SPTRQGLSLKDAISASISRGKLVSGKPETDSSSMSSSSSAMATFANPFWTEMWVLTRRSA  447

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N+RR PE+   RLG V VTGFILAT+FW++D+SPKG+QERLGFFAFAMSTTFYTCAD L
Sbjct  448   LNIRRTPELFLIRLGAVVVTGFILATIFWKLDHSPKGVQERLGFFAFAMSTTFYTCADAL  507

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QERYIF+RETA+NAYRRSSY LS+++V+ P LV+L+  F+A+TFWA GLGGGT+GF
Sbjct  508   PVFLQERYIFMRETAYNAYRRSSYVLSNSVVAVPALVLLSGAFAASTFWAVGLGGGTSGF  567

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
             FF++ II ASFWAG+SFVTFLS VV HVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  568   FFFFLIIFASFWAGSSFVTFLSGVVSHVMLGYTVVVAILAYFLLFSGFFINRDRIPAYWI  627

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPYEAVLQNEF DPT CF RGTQ+FD+TPL A+  A+K   L  +  ++  
Sbjct  628   WFHYLSLVKYPYEAVLQNEFNDPTICFSRGTQVFDNTPLGAMTPAMKTMFLRLLSGSIGR  687

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              +T STCVT+G DIL  QG+T L KW CLW+T+AWGF FRILFYFSLLLGS+NKRR
Sbjct  688   NVTESTCVTSGVDILREQGITQLGKWECLWVTIAWGFFFRILFYFSLLLGSKNKRR  743



>ref|XP_008241789.1| PREDICTED: ABC transporter G family member 20 [Prunus mume]
Length=701

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/481 (68%), Positives = 375/481 (78%), Gaps = 30/481 (6%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++SIHQPS RI+ LLDRLI LS G+TVY
Sbjct  241   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVVMSIHQPSYRILSLLDRLIFLSHGQTVY  300

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP NLP F  +FGH +PE +NR EFALDLIRELE +P GTKSLVEF+  W   +N + 
Sbjct  301   GGSPANLPVFFREFGHPIPETENRTEFALDLIRELEETPGGTKSLVEFNESWQLNKNQQR  360

Query  1254  ATAVHN----------LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVL  1105
               A  N          LSLK+AISAS+S+GKLVSGA ND +  SSVP +AN  W E+AV+
Sbjct  361   QEADPNNLINSITKPKLSLKDAISASISRGKLVSGAPNDPSLSSSVPTFANPCWIEIAVI  420

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             SKRS TN RRMPE+ G RLG V VTG ILATMFW++DNSPK                   
Sbjct  421   SKRSLTNSRRMPELFGIRLGAVLVTGLILATMFWKLDNSPK-------------------  461

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
              A+ +P+F+QERYIF+RETA+NAYRRSSY L+H+L+S P L+ L+L F+ATTFWA GL G
Sbjct  462   -AEAIPIFLQERYIFMRETAYNAYRRSSYVLAHSLISIPSLLFLSLAFAATTFWAVGLAG  520

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G  GF F++  I A+FWAG SFVTFLS +V HVML Y +VVAILAYFLLFSGFF++R RI
Sbjct  521   GVHGFLFFFFTICAAFWAGGSFVTFLSGIVTHVMLGYTVVVAILAYFLLFSGFFISRDRI  580

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             PLYWIWFHYISL+KYPYE VLQNEF+DPTKCFVRGTQMFD+TPL  VP A+K +LL +M 
Sbjct  581   PLYWIWFHYISLVKYPYEGVLQNEFDDPTKCFVRGTQMFDNTPLGTVPVAMKLELLKSMS  640

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              TL V IT STCVTTG DIL  QG+TDLSKW+CLWITVAWGF FRILFYF+LLLGS+NKR
Sbjct  641   TTLGVNITGSTCVTTGTDILKQQGITDLSKWSCLWITVAWGFFFRILFYFTLLLGSKNKR  700

Query  204   R  202
             R
Sbjct  701   R  701



>ref|XP_009597344.1| PREDICTED: ABC transporter G family member 20-like [Nicotiana 
tomentosiformis]
Length=739

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/476 (65%), Positives = 389/476 (82%), Gaps = 5/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+ LLD LI+LSRG TV+
Sbjct  264   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDHLIILSRGNTVF  323

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             T SP +L  F ++FG+ +PE +NR+EFALD IRELEG+P GTK+LVEF++ W   + S  
Sbjct  324   TSSPSSLQHFFAEFGNPIPENENRIEFALDFIRELEGTPNGTKNLVEFNKTWQRKKTSNS  383

Query  1254  ATAVHN---LSLKEAISASVSQGKLVSGATNDANPVSS--VPAYANSLWTEMAVLSKRSF  1090
             ++  +N    SLK+AISASVS+GKLVSG TN    +SS  VP +AN  W +M V++KRS 
Sbjct  384   SSFFYNGSKPSLKDAISASVSRGKLVSGGTNIDPSLSSSNVPKFANPFWVDMVVIAKRSM  443

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  RMPE+ G R G V VTG ILAT+FW++DNSPKG+QER+GFFAFAMSTTFYTCA+ +
Sbjct  444   LNSMRMPELFGMRFGAVVVTGVILATIFWKLDNSPKGVQERVGFFAFAMSTTFYTCAEAI  503

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QERYIF+RETA+NAYRRSSY LSHA++S P +++L++ F+  T+W+ GL GG +GF
Sbjct  504   PVFLQERYIFMRETAYNAYRRSSYVLSHAIISLPSILVLSIAFAVITYWSVGLAGGVSGF  563

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              F+   ++ASFWAG+SFVTFLS V+ +VM+AY +VVAILAYF+LFSG+F++R RIP YWI
Sbjct  564   LFFLLFMVASFWAGSSFVTFLSGVIYNVMMAYTVVVAILAYFVLFSGYFISRDRIPPYWI  623

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPY+ VLQNEF+DP +CFV+G Q+FD +PL AVP  LK KLL  M +TL +
Sbjct  624   WFHYMSLVKYPYQGVLQNEFDDPLECFVKGIQIFDGSPLRAVPEQLKIKLLHNMSKTLGM  683

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              ITSSTC+TTGADIL   GV DL+KW+CLWIT+A GF FRILFYF+L++GS+NKRR
Sbjct  684   NITSSTCLTTGADILKQTGVNDLNKWSCLWITIALGFFFRILFYFALVIGSKNKRR  739



>ref|XP_003625526.1| ABC transporter G family member [Medicago truncatula]
 gb|AES81744.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=750

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/478 (67%), Positives = 384/478 (80%), Gaps = 7/478 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIV++++HQPS RI+GLLDRLI LS G+TVY
Sbjct  273   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVMMTVHQPSYRILGLLDRLIFLSHGQTVY  332

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP F  +FGH +PE +N+ EFALDLIRELE +P GTKSLVEF++ W        
Sbjct  333   SGSPANLPSFFHEFGHPIPENENKTEFALDLIRELEENPGGTKSLVEFNKSWQLKYKPAS  392

Query  1254  ATAVH--NLSLKEAISASVSQGKLVSGATNDA----NPVSSVPAYANSLWTEMAVLSKRS  1093
              TAV+   +SLK+AISAS+S+GKLVSG         +  SSV  +AN  W EMAV+ KRS
Sbjct  393   VTAVNGPKMSLKDAISASISRGKLVSGTNGGNGNGNSIASSVATFANPFWIEMAVIGKRS  452

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
               N RRMPE+ G RLG V VTG ILAT+F+R+D+SPKG+QERLGFFAFAMSTTFYTCA+ 
Sbjct  453   LLNSRRMPELFGIRLGAVLVTGGILATIFYRLDDSPKGVQERLGFFAFAMSTTFYTCAEA  512

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             +PVF+QERYIF+RETA+NAYRRSSY L+H+++S P L+ L+  FS TTFW+ GL GGT+G
Sbjct  513   IPVFLQERYIFMRETAYNAYRRSSYVLAHSIISLPALIFLSFAFSVTTFWSVGLAGGTSG  572

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F FY+  ILASFWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R RIP YW
Sbjct  573   FLFYFFTILASFWAGSSFVTFLSGVVSHVMLGFTVVVAILAYFLLFSGFFISRDRIPPYW  632

Query  552   IWFHYISLIKYPYEAVLQNEFE-DPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETL  376
             IWFHY+SL+KYP+E VLQNEF+  P +CFV+G QMFD+TPL  VP +LK +LL ++  TL
Sbjct  633   IWFHYLSLVKYPFEGVLQNEFDIKPPRCFVKGIQMFDNTPLGDVPGSLKVELLKSLSSTL  692

Query  375   NVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
                ITSSTCV TGADIL  QGVT LSKWNCL+IT+A GF FR LFY +LL GS+NKR+
Sbjct  693   GTNITSSTCVVTGADILKQQGVTQLSKWNCLFITIALGFFFRFLFYLALLFGSKNKRK  750



>ref|XP_003520635.1| PREDICTED: ABC transporter G family member 20-like [Glycine max]
Length=734

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/474 (69%), Positives = 381/474 (80%), Gaps = 3/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS RI+ LLD LI LS G TV+
Sbjct  261   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRILSLLDHLIFLSHGNTVF  320

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS-GGRNSE  1258
             +GSP NLP F S+FGH +PE +NR EFALDLIRELE  P GTKSLV+F++ W    +N  
Sbjct  321   SGSPANLPGFFSEFGHPIPENENRTEFALDLIRELEQEPTGTKSLVDFNKSWQLKNKNQA  380

Query  1257  PATAVHNLSLKEAISASVSQGKLVSGA-TNDANPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
                A   LSLK+AISAS+S+GKLVSG   N++  + SVPA+AN  W EM V+ KRS TN 
Sbjct  381   QNGAKPKLSLKDAISASISRGKLVSGTKNNNSTALVSVPAFANPFWMEMLVIGKRSLTNS  440

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              RMPE+ G RL  V VTG ILAT+F+ +D+SPKG+QER+GFFAFAMSTTFYTCA+ +PVF
Sbjct  441   MRMPELFGIRLVAVLVTGAILATIFFHLDDSPKGVQERVGFFAFAMSTTFYTCAEAMPVF  500

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QERYIF+RETAHNAYRRSSY L HA++S P L+ L+L F+ATTFWA GL GG++GF FY
Sbjct  501   LQERYIFMRETAHNAYRRSSYVLVHAIISLPSLLFLSLAFAATTFWAVGLAGGSSGFLFY  560

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
             +  ILASFWAGNSFVTFLS VV HVM+ + +VVAILAYFLLFSGFF++R RIP YWIWFH
Sbjct  561   FLTILASFWAGNSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFISRDRIPPYWIWFH  620

Query  540   YISLIKYPYEAVLQNEFE-DPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             Y+SL+KYPYE VLQNEF+    +CFVRG QMFD+TPL  VP ALK +LL +M ETL + I
Sbjct  621   YLSLVKYPYEGVLQNEFDVRSPRCFVRGIQMFDNTPLGMVPEALKVELLKSMSETLGMNI  680

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             + STCV TG D+L  QG+T LSKWNC W+TVAWGF FR LFY +LL GSRNKRR
Sbjct  681   SRSTCVVTGEDVLKQQGITQLSKWNCFWVTVAWGFFFRFLFYLALLFGSRNKRR  734



>ref|XP_002525222.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF37188.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=743

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/474 (68%), Positives = 390/474 (82%), Gaps = 5/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+ LLDRLI LS G+TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILSLLDRLIFLSHGQTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G P +LP F ++FGH +PE +NR EFALDLIRELE  P GT+SLV+F+R W   +N  P
Sbjct  332   GGPPTSLPDFFAEFGHPIPENENRTEFALDLIRELEEIPGGTRSLVDFNRSWQALKN--P  389

Query  1254  ATAV---HNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
                +     LSLK+AISAS+S+GKLVSGA ND+N  SSVP +AN  W EM V++KRS  N
Sbjct  390   RNHICRSSKLSLKDAISASISKGKLVSGARNDSNLSSSVPTFANPFWVEMLVIAKRSLIN  449

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RRMPE+ G R G V VTG ILAT+FW +DNSP+G QERLGFFAFAMSTT+YTCA+++P 
Sbjct  450   SRRMPELFGIRFGAVFVTGLILATIFWHLDNSPRGAQERLGFFAFAMSTTYYTCAESIPA  509

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERYIF+RETA+NAYRRSSY L+H+++S P L+I ++ F+ATT+WA GL GG +GF F
Sbjct  510   FLQERYIFMRETAYNAYRRSSYVLAHSIISIPSLIIFSIAFAATTYWAVGLAGGASGFLF  569

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             ++  +L++FWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF++R RIP YWIWF
Sbjct  570   FFFTVLSAFWAGSSFVTFLSGVVSHVMLGFTIVVAILAYFLLFSGFFISRDRIPPYWIWF  629

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HY+SL+KYPYE  LQNEF+DPTKC+VRG QMFD+TPLS VP ALK KLL ++  TL   I
Sbjct  630   HYLSLVKYPYEGALQNEFQDPTKCYVRGVQMFDNTPLSEVPVALKLKLLQSLSSTLGRNI  689

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TSSTC+ TG DIL  QG+TDLSKW+CLWIT+AWGF FR+LFYF+LLLGS+NKRR
Sbjct  690   TSSTCIVTGPDILKGQGITDLSKWSCLWITIAWGFFFRVLFYFTLLLGSKNKRR  743



>ref|XP_009412596.1| PREDICTED: ABC transporter G family member 6-like [Musa acuminata 
subsp. malaccensis]
Length=759

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/471 (68%), Positives = 377/471 (80%), Gaps = 0/471 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA SGSIVI+S+HQPS RI+ LLDRL+ LSRG+TVY
Sbjct  289   LFLDEPTSGLDSTSAFMVVKVLQRIAHSGSIVIMSVHQPSYRILCLLDRLLFLSRGQTVY  348

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G P  L +F SDFGH +P+ +N  EFALDLIRELEG+P G +SLVEF++     + +  
Sbjct  349   SGPPEGLHRFFSDFGHPIPDNENPTEFALDLIRELEGTPAGARSLVEFNKSRQDEQPALV  408

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
               A  +LSL +AI AS+S+GKLVSG T      SSV  YAN  W EM VL+KRSFTN +R
Sbjct  409   PAARSSLSLNDAIGASISRGKLVSGTTEGTTSASSVQKYANPFWIEMGVLTKRSFTNTKR  468

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
             MPE+   RL  V +TGFILAT+FWR+DNSPKG+QERLGFFA AMST FYTCAD LP+F+Q
Sbjct  469   MPELFAIRLAAVLLTGFILATIFWRLDNSPKGVQERLGFFAIAMSTMFYTCADALPIFLQ  528

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ER IF+RETA+NAYRRSSY LSHA+V FP L++L++ F+ TT++A GL GG  GF F+  
Sbjct  529   ERNIFMRETAYNAYRRSSYVLSHAIVGFPPLILLSVAFALTTYFAVGLAGGMQGFVFFVL  588

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
             IILASFWAG+ FVTFLS VV HVML Y +VVAILAYFLLFSGFF+NR RI  YWIWFHY+
Sbjct  589   IILASFWAGSGFVTFLSGVVTHVMLGYTVVVAILAYFLLFSGFFINRDRIHDYWIWFHYL  648

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYEAV+QNEF+D  KCFVRG QMFD+TPL  +P A+K ++L +M  +L V ITS 
Sbjct  649   SLVKYPYEAVMQNEFDDRHKCFVRGVQMFDNTPLGVLPDAIKLRVLKSMSNSLGVNITSR  708

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TC+TTG DIL  Q +T LSKW+CLW+TVAWGFLFR LFY SLLLGSRNKRR
Sbjct  709   TCITTGTDILKQQSITQLSKWDCLWVTVAWGFLFRFLFYISLLLGSRNKRR  759



>ref|XP_009139200.1| PREDICTED: ABC transporter G family member 16 [Brassica rapa]
Length=718

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/473 (68%), Positives = 381/473 (81%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL++IA+SGSIVI+SIHQPS R++GLL+RLI LSRG+TV+
Sbjct  246   LFLDEPTSGLDSTSAFMVVNVLKKIAESGSIVIMSIHQPSHRVLGLLNRLIFLSRGKTVF  305

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN-SE  1258
             +GSP +LP F + FG  VPE +N+ EFALDLIRELEGS  GT+ LVEF++RW   +N S 
Sbjct  306   SGSPASLPGFFARFGSPVPENENQTEFALDLIRELEGSAGGTRGLVEFNKRWQEMKNRSP  365

Query  1257  PATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPA-YANSLWTEMAVLSKRSFTNL  1081
             PA+   NL+LKEAISAS+S+GKLVSG              +AN  W E+  L++RS  N 
Sbjct  366   PASPNPNLTLKEAISASISRGKLVSGGGGGGGSSVVSHGGFANPFWIEIKTLTERSILNS  425

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             RR PE+ GTRL  V VTGFILAT+FWR+DNSPKG+QERLGFFAFAMST FYTCAD LPVF
Sbjct  426   RRQPELFGTRLAAVLVTGFILATVFWRLDNSPKGVQERLGFFAFAMSTMFYTCADALPVF  485

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QERYIF+RETA+NAYRRSSY LSHA+VS P LV L+L F++TTFWA GL GG  GF FY
Sbjct  486   LQERYIFMRETAYNAYRRSSYVLSHAVVSLPSLVFLSLAFASTTFWAVGLEGGPMGFLFY  545

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
               II ASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YW+WFH
Sbjct  546   CLIIFASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPQYWLWFH  605

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPYEAVLQNEF DP +CFVRG QMFD+TPL  +   +K +LL ++  ++ +RIT
Sbjct  606   YLSLVKYPYEAVLQNEFSDPMECFVRGVQMFDNTPLGQLSYGMKLRLLDSVSRSIGMRIT  665

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             SSTC+TTGADIL  QGVT+LSKW+CL +TV +GF FR LFY  LL GS+NKRR
Sbjct  666   SSTCLTTGADILRQQGVTELSKWSCLLVTVGFGFFFRALFYLCLLFGSKNKRR  718



>gb|KCW65320.1| hypothetical protein EUGRSUZ_G02773 [Eucalyptus grandis]
Length=708

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/475 (71%), Positives = 385/475 (81%), Gaps = 36/475 (8%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIV++++HQPS RI+GLLDRL+ LSRG+TVY
Sbjct  266   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVVMTVHQPSYRILGLLDRLLFLSRGQTVY  325

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS----GGR  1267
             +GSP +LP F S+FGH +PE +NR EFALDLIRELEGSP GT+SLVEF++ W     G R
Sbjct  326   SGSPTSLPLFFSEFGHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQSMKQGAR  385

Query  1266  NSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFT  1087
             NSEP    + LSLKEAI AS+S+GKLVSGATNDA+P S VP +AN  W EMAVLSKRS T
Sbjct  386   NSEPDR--NGLSLKEAIGASISRGKLVSGATNDASPASMVPTFANPFWIEMAVLSKRSIT  443

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RRMPE+ G RLG V VTGFILATMFW++DNSPKG+QERLGF AFAMSTTFYTCAD LP
Sbjct  444   NSRRMPELFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFIAFAMSTTFYTCADALP  503

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+QERYIF+RETA+NAYRR SY LSH+LV+ P LV+LAL FSATTF+A GL GG +GF 
Sbjct  504   VFLQERYIFMRETAYNAYRRWSYVLSHSLVALPALVLLALAFSATTFFAVGLDGGFSGFL  563

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             FY+ II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIW
Sbjct  564   FYFLIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPSYWIW  623

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FHY+SL+KYPYE VLQNEF+DPT                                TL ++
Sbjct  624   FHYLSLVKYPYEGVLQNEFQDPTN------------------------------NTLGMK  653

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             IT+STC+TTG DIL  QGVTDLSKW+CLW+TVAWGFLFRILFYFSLLLGS+NKRR
Sbjct  654   ITASTCLTTGTDILQQQGVTDLSKWSCLWVTVAWGFLFRILFYFSLLLGSKNKRR  708



>emb|CDX73549.1| BnaC08g24540D [Brassica napus]
Length=756

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/483 (66%), Positives = 388/483 (80%), Gaps = 12/483 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQR+AQSGSIVI+SIHQPS RI+GLLD+L+ LSRG TVY
Sbjct  274   LFLDEPTSGLDSTSAYIVVKVLQRVAQSGSIVIMSIHQPSYRILGLLDKLLFLSRGNTVY  333

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LP+F S++GH +PE +N+ EFALDLIRELE SPEGTK+LV+F ++W   +    
Sbjct  334   SGSPTDLPRFFSEYGHIIPENENKTEFALDLIRELEDSPEGTKTLVDFHKQWRAKQTLNE  393

Query  1254  ATAVHNLSLKEAISASVSQGKLVSG------------ATNDANPVSSVPAYANSLWTEMA  1111
              T   N+SLK+AI AS+S+ KLVS             +  + N  S+   +AN  WTE+ 
Sbjct  394   TTRNTNVSLKDAIDASISREKLVSACRAGPEILRDRSSGGETNLKSTFQTFANPFWTEIL  453

Query  1110  VLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTF  931
             V++KRS  N RR PE+ G RLG V VTG ILATMF+++DNSP+GIQERLGFFAFAMSTTF
Sbjct  454   VIAKRSMLNSRRQPELFGIRLGAVLVTGTILATMFYKLDNSPRGIQERLGFFAFAMSTTF  513

Query  930   YTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaagl  751
             YTCA+ +PVF+QERYIF+RETA+NAYRRSSY L+H ++S P LVIL+  F+ATTF++ GL
Sbjct  514   YTCAEAIPVFLQERYIFMRETAYNAYRRSSYVLAHTIISLPALVILSATFAATTFFSVGL  573

Query  750   gggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRA  571
              GG+ GFFF++  ILA+FWAG+SFVTFLS VV HVM+ + +VVAILAYFLLFSGFF+ R 
Sbjct  574   AGGSEGFFFFFLTILAAFWAGSSFVTFLSGVVSHVMIGFTVVVAILAYFLLFSGFFIARD  633

Query  570   RIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTA  391
             RIPLYW+WFHY+SL+KYPYE VLQNEFED TKCFVRG QMFD +PL  VP A+K  LL +
Sbjct  634   RIPLYWLWFHYLSLVKYPYEGVLQNEFEDSTKCFVRGIQMFDSSPLGQVPDAVKISLLKS  693

Query  390   MGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRN  211
             M   L   +T+ TCVTTG DIL  QG+T++SKWNCLWITVAWGFLFR+LFYF+LL+GS+N
Sbjct  694   MSGVLGFNVTAETCVTTGVDILRKQGITEMSKWNCLWITVAWGFLFRVLFYFTLLIGSKN  753

Query  210   KRR  202
             KRR
Sbjct  754   KRR  756



>ref|XP_009402343.1| PREDICTED: ABC transporter G family member 6-like [Musa acuminata 
subsp. malaccensis]
Length=754

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/471 (67%), Positives = 374/471 (79%), Gaps = 0/471 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF V KVLQRIA SGSIVI+S+HQPS RI+ LLDRL+ LSRG+TVY
Sbjct  284   LFLDEPTSGLDSTSAFMVTKVLQRIAHSGSIVIMSVHQPSYRILCLLDRLLFLSRGQTVY  343

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G P  L  F SDFGH +P  +N  EFALDLIRELEG+P G +SLV+F++     R +  
Sbjct  344   SGPPDGLRGFFSDFGHPIPANENPTEFALDLIRELEGTPTGARSLVDFNKAHQSVRLAVA  403

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
             A    +LSL +AISAS+S+GKLVSGAT  A    SV  YAN  W E+ VL+KRSFTN +R
Sbjct  404   AADKPSLSLNDAISASISRGKLVSGATEGAPSAPSVQNYANPFWIEVGVLTKRSFTNSKR  463

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
             MPE+ G RLG V VTGFILAT+FWR+DNSP+G+QERLGFFA AMST FYTCAD LPVF+Q
Sbjct  464   MPELFGVRLGAVLVTGFILATIFWRLDNSPRGVQERLGFFAIAMSTMFYTCADALPVFLQ  523

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ER IF+RETAHNAYRRSSY LSH +V FP LV+L++ F++TTF+A GL G   GF F+  
Sbjct  524   ERNIFMRETAHNAYRRSSYVLSHTIVGFPPLVLLSIAFASTTFFAVGLAGSMQGFVFFVL  583

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
             I+LASFWAG+ FVTFLS VV H+ML   +V+++LAYFLLFSGFF++R RIP YWIWFHY+
Sbjct  584   IVLASFWAGSGFVTFLSGVVTHIMLGCAVVLSVLAYFLLFSGFFIDRTRIPDYWIWFHYL  643

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYEAV+QNEF+DP KCFVRG QMFD+TP   +P A+K  +L ++  +L V ITS 
Sbjct  644   SLVKYPYEAVMQNEFDDPRKCFVRGVQMFDNTPFGGLPEAIKLNVLKSISSSLGVSITSQ  703

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TC+TTG +IL  Q VT LSKW+CLWI VAWGF FR LFY SLLLGSRNKRR
Sbjct  704   TCITTGTNILEQQSVTQLSKWDCLWIAVAWGFFFRFLFYISLLLGSRNKRR  754



>ref|XP_011019268.1| PREDICTED: ABC transporter G family member 20 [Populus euphratica]
Length=716

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/473 (65%), Positives = 382/473 (81%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPS R++ LLDRLI LS G+TVY
Sbjct  244   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSYRLLTLLDRLIFLSHGQTVY  303

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP+F ++FGH +PE +NR EFALD IR+LE  P GTK+LVEF++ W   +N++ 
Sbjct  304   AGSPGSLPEFFAEFGHPIPENENRTEFALDYIRDLEEIPGGTKTLVEFNKSWQAMKNAKN  363

Query  1254  A-TAVHNLSLKEAISASVSQGKLVSGATNDANPVSS-VPAYANSLWTEMAVLSKRSFTNL  1081
               +    LSL++ IS S+S+GKLVSGA ND N  SS V ++AN LW E+ V+ KRS  N 
Sbjct  364   RFSNASKLSLRDTISVSISRGKLVSGAPNDLNSTSSPVLSFANPLWVEVMVIGKRSSLNA  423

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             +RMPE+ G RL  V VTG ILAT+++ +DNSP+G+QERLGFFAFA+STT+YTCA+++P F
Sbjct  424   KRMPELFGIRLAAVLVTGIILATVYYHLDNSPRGVQERLGFFAFAISTTYYTCAESIPAF  483

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             IQERYIF+RETA+NAYRRSSY L+H+L+S P L++L++ F+ TTFWA GL GG +GF FY
Sbjct  484   IQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIVLSIAFATTTFWAVGLDGGFSGFCFY  543

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
             +  I  +FWAG+SFVTFLS VV HVML++ LVVAIL+YFLLFSGF+++R RIP +W+WFH
Sbjct  544   FFTIFCAFWAGSSFVTFLSGVVSHVMLSFTLVVAILSYFLLFSGFYISRDRIPPFWLWFH  603

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPYEA LQNEF  PTKCFV G QMFD+TPL+ +P ++K K+L  +   L   IT
Sbjct  604   YMSLVKYPYEAALQNEFHSPTKCFVMGVQMFDNTPLAVMPLSMKLKMLKTISTRLGRNIT  663

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             S+TC  TG DIL  QG+T LSKWNCLWIT+AWGF FRILFYF+LLL S+NKRR
Sbjct  664   SNTCAVTGTDILQQQGITQLSKWNCLWITIAWGFFFRILFYFALLLWSKNKRR  716



>gb|KFK36825.1| hypothetical protein AALP_AA4G176400 [Arabis alpina]
Length=713

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/473 (66%), Positives = 379/473 (80%), Gaps = 4/473 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL++IAQSGSIVI+SIHQPS R++ LLDRLI LSRG TVY
Sbjct  243   LFLDEPTSGLDSTSAFMVVNVLKKIAQSGSIVIMSIHQPSHRVLCLLDRLIFLSRGHTVY  302

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSPV+LP+F +DFG  +PE +N  EFALD IRELEGS  GT++LVEF++RW     + P
Sbjct  303   SGSPVSLPRFFADFGSPIPENENITEFALDFIRELEGSATGTRALVEFNKRWQ--EMTPP  360

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATN--DANPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
             ++   NL+LKEAI+AS+S+GKLVSG  +      + +VPA+AN +W E+  LS+RS  N 
Sbjct  361   SSPHPNLTLKEAIAASISRGKLVSGGESIGTTTTILAVPAFANPMWIEIKTLSQRSMLNS  420

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             RR PE+ G +L  V VTGFILAT+FWR+DNSPKGI+ERLGFF+FAMST +YTCA  LP F
Sbjct  421   RRQPELFGIKLVAVFVTGFILATVFWRLDNSPKGIRERLGFFSFAMSTMYYTCAQALPEF  480

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             ++ERYIF+RETA+N YRRSSY LSHA+VSFP L++L L F+  TFWA GL GG  G  FY
Sbjct  481   LEERYIFMRETAYNTYRRSSYVLSHAIVSFPGLIVLTLAFAIPTFWAVGLDGGPMGLLFY  540

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
               IILASFW+G+SFVTFLS V+P+VM+ Y +VVAILAYFLLF GFF+N+ RIP YWIWFH
Sbjct  541   CLIILASFWSGSSFVTFLSGVIPNVMVGYTIVVAILAYFLLFCGFFINKNRIPDYWIWFH  600

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPYEAVLQNEF D TKCFVRG Q FD+TPL  +P  +K  +L  + ++L   IT
Sbjct  601   YLSLVKYPYEAVLQNEFSDATKCFVRGVQTFDNTPLEELPYDMKLSMLDTVSQSLGKNIT  660

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             SSTC+TTGADIL  Q V  LSKW+CL++TVA+GF FR LFYFSLLLGS+NKRR
Sbjct  661   SSTCLTTGADILMHQSVNQLSKWHCLFVTVAFGFFFRALFYFSLLLGSKNKRR  713



>gb|EYU19905.1| hypothetical protein MIMGU_mgv1a026629mg [Erythranthe guttata]
Length=666

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/471 (66%), Positives = 362/471 (77%), Gaps = 54/471 (11%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+SIHQPS RI+GLLDR+I LSRG+TVY
Sbjct  248   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSIHQPSYRILGLLDRMIFLSRGQTVY  307

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G P NLP + SDFGH +P+ +N+ +                                  
Sbjct  308   SGPPSNLPVYFSDFGHPIPDNENKTD----------------------------------  333

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSS-VPAYANSLWTEMAVLSKRSFTNLR  1078
                             +S+GKLVSGAT ++  V+  VP +AN  W EMAVLSKRSFTN R
Sbjct  334   ----------------ISRGKLVSGATTNSTAVNRLVPTFANPSWIEMAVLSKRSFTNSR  377

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             RMPE+ G RLG V VTGFILATMFWR+DNSP+G+QERLGFFAFAMSTTFYTCAD LPVF+
Sbjct  378   RMPELFGVRLGAVMVTGFILATMFWRLDNSPRGVQERLGFFAFAMSTTFYTCADALPVFL  437

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERY+F+RETA+NAYRRSSY +SH+LV+ P L+ L+L F+ATTFWA GL GG      Y+
Sbjct  438   QERYVFMRETAYNAYRRSSYVVSHSLVALPSLLFLSLAFAATTFWAVGLDGGFFF---YF  494

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              II ASFWAG+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIWFHY
Sbjct  495   LIIFASFWAGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPAYWIWFHY  554

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             +SL+KYPYEAVLQNEFEDP KCFVRG Q+FD+TPL +VP ALK KLL  M  +L ++ITS
Sbjct  555   LSLVKYPYEAVLQNEFEDPVKCFVRGIQIFDNTPLGSVPNALKVKLLDGMSSSLGLKITS  614

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             +TCVTTGADIL  QG+TDL+KW+CLW+TVAWGFLFR+LFY SLL GS+NKR
Sbjct  615   TTCVTTGADILQQQGITDLTKWSCLWVTVAWGFLFRVLFYLSLLAGSKNKR  665



>ref|XP_004984786.1| PREDICTED: ABC transporter G family member 16-like [Setaria italica]
Length=794

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/489 (66%), Positives = 383/489 (78%), Gaps = 23/489 (5%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGS+V++SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  311   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRILGLLDRLLFLSRGQTVY  370

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS-------  1276
              G P  LP F  DFG  +P  +N  EFALDLIRELE  P+G + LVE +R+W        
Sbjct  371   YGPPGALPSFFDDFGKPIPGNENPTEFALDLIRELETMPDGARDLVEHNRKWQMRMAPKA  430

Query  1275  ---GGRNSEPATAVHNLSLKEAISASVSQGKLVSGATN--------DANPVSSVPAYANS  1129
                 GR  +P+     LSLKEAISAS+S+GKLVSGAT+        +  P ++V  +AN 
Sbjct  431   KHHDGRGEKPS-----LSLKEAISASISRGKLVSGATDGSVSVHSGEPLPAAAVSKFANP  485

Query  1128  LWTEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAF  949
              W EM VL++R+F N +R PEI   RL  V VTGFILAT+FWR+D+SPKG+QERLGFFA 
Sbjct  486   FWIEMGVLTRRAFINTKRTPEIFIIRLAAVLVTGFILATIFWRLDDSPKGVQERLGFFAI  545

Query  948   AMSTTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSatt  769
             AMST FYTC+D LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP L++L+L F+ TT
Sbjct  546   AMSTMFYTCSDALPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFPSLIVLSLAFALTT  605

Query  768   fwaaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSG  589
             F+A GL GG  GFFF+ AI+LASFWAG+ F TFLS VV +VML Y +VV+ LAYFLLFSG
Sbjct  606   FFAVGLAGGAEGFFFFVAIVLASFWAGSGFATFLSGVVTNVMLGYPVVVSTLAYFLLFSG  665

Query  588   FFMNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALK  409
             FF+NR RIP YWIWFHY+SL+KYPYEAV+QNEF DP +CFVRG QMFD+TPL+A+P  LK
Sbjct  666   FFINRDRIPRYWIWFHYLSLVKYPYEAVMQNEFSDPGRCFVRGVQMFDNTPLAALPGVLK  725

Query  408   EKLLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSL  229
              ++L AM ++L V I ++TC+TTG D LA Q VTDL+KW+CLWITVAWGFLFRILFY SL
Sbjct  726   VRVLRAMSQSLGVDIGTATCITTGPDFLAQQAVTDLTKWDCLWITVAWGFLFRILFYISL  785

Query  228   LLGSRNKRR  202
             LLGSRNKRR
Sbjct  786   LLGSRNKRR  794



>gb|ACN28499.1| unknown [Zea mays]
Length=747

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/487 (65%), Positives = 384/487 (79%), Gaps = 18/487 (4%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGS+V++SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  263   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRILGLLDRLLFLSRGQTVY  322

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G P  LP F +DFG  +P  +N  EFALDLIRELE  P+G   LVE +++W     + P
Sbjct  323   YGPPGALPSFFNDFGKPIPGNENPTEFALDLIRELETMPDGATDLVEHNKKWQ--MRTAP  380

Query  1254  ATAVHN-------LSLKEAISASVSQGKLVSGATN---------DANPVSSVPAYANSLW  1123
                 H+       LSLKEAISAS+S+GKLVSGAT+         ++ P ++V  +AN  W
Sbjct  381   KAKHHDGHGEKPSLSLKEAISASISRGKLVSGATDGSVSVHSAGESAPAAAVSKFANPFW  440

Query  1122  TEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAM  943
              EM VL++R+F N +R PEI   RL  V VTGFILAT+FWR+D+SPKG+QERLGFFA AM
Sbjct  441   VEMGVLTRRAFLNTKRTPEIFIIRLAAVMVTGFILATIFWRLDDSPKGVQERLGFFAIAM  500

Query  942   STTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfw  763
             ST FYTC+D+LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP L++L+  F+ TTF+
Sbjct  501   STMFYTCSDSLPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFPSLIVLSFAFALTTFF  560

Query  762   aaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF  583
             A GL GG  GFFF+ AI+LASFWAG+ F TFLS VV +VML + +VV+ LAYFLLFSGFF
Sbjct  561   AVGLAGGADGFFFFVAIVLASFWAGSGFATFLSGVVTNVMLGFPVVVSTLAYFLLFSGFF  620

Query  582   MNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEK  403
             +NR RIP YW+WFHY+SL+KYPYEAV+QNEF DPT+CFVRG QMFD+TPL+ +PA LK +
Sbjct  621   INRDRIPRYWLWFHYLSLVKYPYEAVMQNEFSDPTRCFVRGVQMFDNTPLAVLPAVLKVR  680

Query  402   LLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLL  223
             +L AM ++L V I ++TC+TTG D LA Q VTDL+KW+CLWITVAWGFLFRILFY SLLL
Sbjct  681   VLRAMSQSLGVDIGTATCITTGPDFLAQQAVTDLTKWDCLWITVAWGFLFRILFYISLLL  740

Query  222   GSRNKRR  202
             GSRNKRR
Sbjct  741   GSRNKRR  747



>ref|XP_002308489.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEE92012.2| ABC transporter family protein [Populus trichocarpa]
Length=717

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/473 (64%), Positives = 380/473 (80%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA  VVKVLQRIAQSGSIVI+SIHQPS R++ LLDRLI LS G+TVY
Sbjct  245   LFLDEPTSGLDSTSALMVVKVLQRIAQSGSIVIMSIHQPSYRLLTLLDRLIFLSHGQTVY  304

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP+F ++FGH +PE +NR EFALD IR+LE  P GTK+LV+F++ W   +N++ 
Sbjct  305   AGSPGSLPEFFAEFGHPIPENENRTEFALDYIRDLEEIPGGTKTLVKFNKSWQAMKNAKN  364

Query  1254  A-TAVHNLSLKEAISASVSQGKLVSGATNDANPVSS-VPAYANSLWTEMAVLSKRSFTNL  1081
               +    LSLK+ IS S+S+GKLVSGA ND+N  SS V ++AN LW E+ V+ KRS  N 
Sbjct  365   RFSNASKLSLKDTISVSISRGKLVSGAPNDSNSTSSPVLSFANPLWVEVMVIGKRSSLNA  424

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             +RMPE+ G RL  V VTG ILAT+++ +DNSP+G+QERLGFFAFA+STT+YT A+++P F
Sbjct  425   KRMPELFGIRLAAVLVTGIILATVYYHLDNSPRGVQERLGFFAFAISTTYYTSAESIPAF  484

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             IQERYIF+RETA+NAYRRSSY L+H+L+S P L++L++ F+ TTFWA GL GG +GF FY
Sbjct  485   IQERYIFMRETAYNAYRRSSYVLAHSLISIPSLIVLSIAFATTTFWAVGLDGGFSGFCFY  544

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
             +  I  +FWAG+SFVTFLS VV HVML++ LVVAIL+YF LFSGF+++R RIP +W+WFH
Sbjct  545   FFTIFCAFWAGSSFVTFLSGVVSHVMLSFTLVVAILSYFPLFSGFYISRDRIPPFWLWFH  604

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPYEA LQNEF  PTKCFV G QMFD+TPL+ +P ++K K+L  +   L   IT
Sbjct  605   YMSLVKYPYEAALQNEFHSPTKCFVMGVQMFDNTPLAVMPLSMKLKMLKTISTRLGRNIT  664

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             S+TC  TG DIL  QG+T LSKWNCLWIT+AWGF FRILFYF+LLL S+NKRR
Sbjct  665   SNTCAVTGTDILQQQGITQLSKWNCLWITIAWGFFFRILFYFALLLWSKNKRR  717



>ref|NP_001151504.1| ATPase, coupled to transmembrane movement of substances [Zea 
mays]
 gb|ACG43107.1| ATPase, coupled to transmembrane movement of substances [Zea 
mays]
Length=790

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/487 (65%), Positives = 384/487 (79%), Gaps = 18/487 (4%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGS+V++SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  306   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRILGLLDRLLFLSRGQTVY  365

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G P  LP F +DFG  +P  +N  EFALDLIRELE  P+G   LVE +++W     + P
Sbjct  366   YGPPGALPSFFNDFGKPIPGNENPTEFALDLIRELETMPDGATDLVEHNKKWQ--MRTAP  423

Query  1254  ATAVHN-------LSLKEAISASVSQGKLVSGATN---------DANPVSSVPAYANSLW  1123
                 H+       LSLKEAISAS+S+GKLVSGAT+         ++ P ++V  +AN  W
Sbjct  424   KAKHHDGHGEKPSLSLKEAISASISRGKLVSGATDGSVSVHSAGESAPAAAVSKFANPFW  483

Query  1122  TEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAM  943
              EM VL++R+F N +R PEI   RL  V VTGFILAT+FWR+D+SPKG+QERLGFFA AM
Sbjct  484   VEMGVLTRRAFLNTKRTPEIFIIRLAAVMVTGFILATIFWRLDDSPKGVQERLGFFAIAM  543

Query  942   STTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfw  763
             ST FYTC+D+LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP L++L+  F+ TTF+
Sbjct  544   STMFYTCSDSLPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFPSLIVLSFAFALTTFF  603

Query  762   aaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF  583
             A GL GG  GFFF+ AI+LASFWAG+ F TFLS VV +VML + +VV+ LAYFLLFSGFF
Sbjct  604   AVGLAGGADGFFFFVAIVLASFWAGSGFATFLSGVVTNVMLGFPVVVSTLAYFLLFSGFF  663

Query  582   MNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEK  403
             +NR RIP YW+WFHY+SL+KYPYEAV+QNEF DPT+CFVRG QMFD+TPL+ +PA LK +
Sbjct  664   INRDRIPRYWLWFHYLSLVKYPYEAVMQNEFSDPTRCFVRGVQMFDNTPLAVLPAVLKVR  723

Query  402   LLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLL  223
             +L AM ++L V I ++TC+TTG D LA Q VTDL+KW+CLWITVAWGFLFRILFY SLLL
Sbjct  724   VLRAMSQSLGVDIGTATCITTGPDFLAQQAVTDLTKWDCLWITVAWGFLFRILFYISLLL  783

Query  222   GSRNKRR  202
             GSRNKRR
Sbjct  784   GSRNKRR  790



>tpg|DAA44748.1| TPA: ATPase, coupled to transmembrane movement of substance [Zea 
mays]
Length=841

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/487 (65%), Positives = 384/487 (79%), Gaps = 18/487 (4%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGS+V++SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  357   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRILGLLDRLLFLSRGQTVY  416

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G P  LP F +DFG  +P  +N  EFALDLIRELE  P+G   LVE +++W     + P
Sbjct  417   YGPPGALPSFFNDFGKPIPGNENPTEFALDLIRELETMPDGATDLVEHNKKWQ--MRTAP  474

Query  1254  ATAVHN-------LSLKEAISASVSQGKLVSGATN---------DANPVSSVPAYANSLW  1123
                 H+       LSLKEAISAS+S+GKLVSGAT+         ++ P ++V  +AN  W
Sbjct  475   KAKHHDGHGEKPSLSLKEAISASISRGKLVSGATDGSVSVHSAGESAPAAAVSKFANPFW  534

Query  1122  TEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAM  943
              EM VL++R+F N +R PEI   RL  V VTGFILAT+FWR+D+SPKG+QERLGFFA AM
Sbjct  535   VEMGVLTRRAFLNTKRTPEIFIIRLAAVMVTGFILATIFWRLDDSPKGVQERLGFFAIAM  594

Query  942   STTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfw  763
             ST FYTC+D+LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP L++L+  F+ TTF+
Sbjct  595   STMFYTCSDSLPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFPSLIVLSFAFALTTFF  654

Query  762   aaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF  583
             A GL GG  GFFF+ AI+LASFWAG+ F TFLS VV +VML + +VV+ LAYFLLFSGFF
Sbjct  655   AVGLAGGADGFFFFVAIVLASFWAGSGFATFLSGVVTNVMLGFPVVVSTLAYFLLFSGFF  714

Query  582   MNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEK  403
             +NR RIP YW+WFHY+SL+KYPYEAV+QNEF DPT+CFVRG QMFD+TPL+ +PA LK +
Sbjct  715   INRDRIPRYWLWFHYLSLVKYPYEAVMQNEFSDPTRCFVRGVQMFDNTPLAVLPAVLKVR  774

Query  402   LLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLL  223
             +L AM ++L V I ++TC+TTG D LA Q VTDL+KW+CLWITVAWGFLFRILFY SLLL
Sbjct  775   VLRAMSQSLGVDIGTATCITTGPDFLAQQAVTDLTKWDCLWITVAWGFLFRILFYISLLL  834

Query  222   GSRNKRR  202
             GSRNKRR
Sbjct  835   GSRNKRR  841



>ref|XP_010684173.1| PREDICTED: ABC transporter G family member 20 [Beta vulgaris 
subsp. vulgaris]
Length=728

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/475 (66%), Positives = 375/475 (79%), Gaps = 4/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VLQRIA+SGSIVI++IHQPSSRI+ LLDRL+LLSRG+TV+
Sbjct  254   LFLDEPTSGLDSTSAFMVVNVLQRIARSGSIVIMTIHQPSSRILNLLDRLLLLSRGQTVF  313

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE-  1258
              G+  +LP F S+FGH +PE +NR EFALD IRELE SP+GT+ +V F++ W   +  + 
Sbjct  314   NGTSSDLPMFFSEFGHSIPENENRTEFALDHIRELEESPQGTQGMVNFNKSWQQQQQRKN  373

Query  1257  ---PATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFT  1087
                P+  +  +SL +AISAS+S+GKLVSG  ND +  +SVP YAN  W E+ V+ KRSF 
Sbjct  374   TSLPSRTLPRMSLSDAISASISKGKLVSGGANDESNPTSVPKYANPFWLEVYVIGKRSFL  433

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RRMPE+ G RLG + VTG ILAT+FW +D SPKG +ERLGFFAFAMSTTFYTCA+ +P
Sbjct  434   NSRRMPELFGIRLGAIVVTGTILATIFWHLDQSPKGAKERLGFFAFAMSTTFYTCAEAIP  493

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
              F+QERYIF+RETA+N YRRSSY LS AL+S P L+IL+L F+A TFWA GL GG  GF 
Sbjct  494   TFLQERYIFMRETAYNTYRRSSYVLSQALISIPSLIILSLTFAAITFWAVGLAGGLQGFL  553

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             +Y+  ILASFWAG+SFVTFLS VV HVML + +VVAILAYFLLFSGFF+ R RIP YW W
Sbjct  554   YYFGFILASFWAGHSFVTFLSGVVTHVMLGFTVVVAILAYFLLFSGFFITRDRIPSYWQW  613

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FH+ISL+KYPYE VLQNEF D TKCFV+G QMFD TPL AVP  LK  LL  MG+ L   
Sbjct  614   FHFISLVKYPYEGVLQNEFSDHTKCFVKGVQMFDSTPLQAVPDILKLTLLKNMGDVLGRN  673

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +T S+C+TTG DIL  QG+TDLS+ +CL IT+AWGFLFR LFY +L+ GS+NKRR
Sbjct  674   LTGSSCLTTGLDILQQQGITDLSRLSCLLITIAWGFLFRFLFYVTLMFGSKNKRR  728



>ref|XP_010534454.1| PREDICTED: ABC transporter G family member 18-like [Tarenaya 
hassleriana]
Length=727

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/481 (63%), Positives = 381/481 (79%), Gaps = 11/481 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             L LDEPTSGLDSTSAF VV+VL+RIAQSGSIV++SIHQPS RIV LLDRLI+LSRG+TV+
Sbjct  248   LLLDEPTSGLDSTSAFMVVQVLKRIAQSGSIVMMSIHQPSYRIVELLDRLIILSRGQTVF  307

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS-------  1276
             +GSP +LP+FLS+FGH +PE +N  EFALDLIRELEGSPEG K LVEF R+W        
Sbjct  308   SGSPASLPRFLSEFGHPIPEKENIAEFALDLIRELEGSPEGNKGLVEFHRKWQEEKLSLC  367

Query  1275  -GGRNSEPATAVHNLSLKEAISASVSQGKLVSGATNDANP--VSSVPAYANSLWTEMAVL  1105
                R +   T    LSLKEAI+ SVS+GKLVSG +  ANP  ++ + +YAN  W E  +L
Sbjct  368   QSARATPRITPHQGLSLKEAINVSVSRGKLVSG-SGGANPNSMAKISSYANPSWLETLIL  426

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             +KR   N  RMPE++G RL  V +TGF+LAT++WR+D++P+G+QERLGFFAFAM+T FY 
Sbjct  427   AKRYAINWSRMPELIGVRLATVFITGFLLATVYWRVDDTPRGVQERLGFFAFAMATMFYC  486

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             CAD LPVFIQERYIFL+ETAHNAYR SSY +SH+LVS P L  L++ F+ATTF++ GL G
Sbjct  487   CADNLPVFIQERYIFLKETAHNAYRISSYVISHSLVSLPQLFALSVAFAATTFFSVGLSG  546

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G  GF +Y  II ASFW+G+SFVTF+S VVP+VM++Y++ +A L+Y LLF+GF++NR RI
Sbjct  547   GFDGFLYYCLIIYASFWSGSSFVTFVSGVVPNVMISYMVTIAFLSYCLLFAGFYINRDRI  606

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             P YWIW+HYISL+KYPYEAVLQNEF  P++C++RG Q+FD+T L+ VP ++K KLL  + 
Sbjct  607   PPYWIWYHYISLLKYPYEAVLQNEFSGPSRCYIRGIQVFDNTILAEVPESMKVKLLGTLS  666

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
               L + IT STC+ TG+++L  QG+T L KW+CLW TVAWGF FR LFYFSLLLGS+NKR
Sbjct  667   SALGMEITESTCLRTGSELLRQQGITQLDKWDCLWATVAWGFFFRTLFYFSLLLGSKNKR  726

Query  204   R  202
             R
Sbjct  727   R  727



>emb|CDX76122.1| BnaA04g03860D [Brassica napus]
Length=1282

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/472 (68%), Positives = 385/472 (82%), Gaps = 2/472 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL++IA+SGSIVI+SIHQPS R++GLL+RLI LSRG+TV+
Sbjct  812   LFLDEPTSGLDSTSAFMVVNVLKKIAESGSIVIMSIHQPSHRVLGLLNRLIFLSRGKTVF  871

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN-SE  1258
             +GSP +LP F + FG  VPE +N+ EFALDLIRELEGS  GT+ LVEF++RW   +N S 
Sbjct  872   SGSPASLPGFFARFGSPVPENENQTEFALDLIRELEGSAGGTRGLVEFNKRWQEMKNRSP  931

Query  1257  PATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
             PA+   NL+LKEAISAS+S+GKLVSG    ++ VS    +AN  W E+  L++RS  N R
Sbjct  932   PASPNPNLTLKEAISASISRGKLVSGGGGGSSVVSHG-GFANPFWIEIKTLTERSILNSR  990

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE+ GTRL  V VTGFILAT+FWR+DNSPKG+QERLGFFAFAMST FYTCAD LPVF+
Sbjct  991   RQPELFGTRLAAVLVTGFILATVFWRLDNSPKGVQERLGFFAFAMSTMFYTCADALPVFL  1050

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETA+NAYRRSSY LSHA+VS P LV L+L F++TTFWA GL GG  GF FY 
Sbjct  1051  QERYIFMRETAYNAYRRSSYVLSHAVVSLPSLVFLSLAFASTTFWAVGLEGGPMGFLFYC  1110

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              II ASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YW+WFHY
Sbjct  1111  LIIFASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPQYWLWFHY  1170

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             +SL+KYPYEAVLQNEF DP +CFVRG QMFD+TPL  +   +K +LL ++  ++ +RITS
Sbjct  1171  LSLVKYPYEAVLQNEFSDPMECFVRGVQMFDNTPLGQLSYGMKLRLLDSVSRSIGMRITS  1230

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             STC+TTGADIL  QGVT+LSKW+CL +TV +GF FR LFY  LL GS+NKRR
Sbjct  1231  STCLTTGADILRQQGVTELSKWSCLLVTVGFGFFFRALFYLCLLFGSKNKRR  1282


 Score =   433 bits (1114),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 223/380 (59%), Positives = 289/380 (76%), Gaps = 7/380 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST AF VV+VL++IA SGSIV++SIHQPS RI+  LDRL++LS G+ V+
Sbjct  197   LFLDEPTSGLDSTCAFMVVQVLKKIACSGSIVVMSIHQPSCRIMEFLDRLLVLSSGQCVF  256

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             + SP  LP F S+FG  +P+ +N  EF LDLI++LEG+  GT  LVEF+R W   +    
Sbjct  257   SDSPATLPLFFSEFGRPIPDKENNAEFTLDLIKDLEGTSGGTSRLVEFNRSWQQKKLRGS  316

Query  1254  ATAVHNLS-LKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                 HN S L+E I+AS+++GKLV+ + N      S  +Y N  W E  +L+KR   N  
Sbjct  317   QEPHHNSSPLRETINASITRGKLVTTSYN------SKASYVNPWWVETLILAKRYMINWT  370

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE++GTR+ IV +TGF+LAT++WR+D+SP+G+QERL FF+FAM+T FY+CAD LP FI
Sbjct  371   RTPELIGTRVFIVMMTGFLLATVYWRVDDSPRGVQERLSFFSFAMATMFYSCADGLPTFI  430

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETAHNAYRRSSY +SH+LV+ P L  L++ F+ATTFW  GL GG AGF +Y 
Sbjct  431   QERYIFMRETAHNAYRRSSYVISHSLVTLPHLFALSVGFAATTFWFVGLNGGLAGFIYYL  490

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              II ASFW+G SFVTF+S V+P+VM++Y++    L+Y LLFSGF++NR RI LYWIW HY
Sbjct  491   LIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYINRDRIHLYWIWIHY  550

Query  537   ISLIKYPYEAVLQNEFEDPT  478
             ISL+KYPYEAVL NEF+DP+
Sbjct  551   ISLLKYPYEAVLHNEFDDPS  570



>ref|XP_002468066.1| hypothetical protein SORBIDRAFT_01g038970 [Sorghum bicolor]
 gb|EER95064.1| hypothetical protein SORBIDRAFT_01g038970 [Sorghum bicolor]
Length=796

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/488 (65%), Positives = 382/488 (78%), Gaps = 19/488 (4%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGS+V++SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  311   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRILGLLDRLLFLSRGQTVY  370

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP  LP F +DFG  +P  +N  EFALDLIRELE  P+G + LVE +++W       P
Sbjct  371   YGSPRALPSFFNDFGKPIPGNENPTEFALDLIRELETMPQGARDLVEHNKKWQ--TRMAP  428

Query  1254  ATAVHN-------LSLKEAISASVSQGKLVSGATND----------ANPVSSVPAYANSL  1126
                 H+       LSLKEAISAS+S+GKLVSGAT+           A P + V  +AN  
Sbjct  429   KAKHHDGHGEKPSLSLKEAISASISRGKLVSGATDGSVSVHSPGMLAAPAAPVSKFANPF  488

Query  1125  WTEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFA  946
             W EM VL++R+F + +R PEI   RL  V VTGFILAT+FWR+D+SPKG++ERLGFFA A
Sbjct  489   WVEMGVLTRRAFLSTKRTPEIFIIRLAAVMVTGFILATIFWRLDDSPKGVEERLGFFAIA  548

Query  945   MSTTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattf  766
             MST FYTC+D+LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP L++L+  F+ TTF
Sbjct  549   MSTMFYTCSDSLPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFPSLIVLSFAFALTTF  608

Query  765   waaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGF  586
             +A GL GG  GFFF+ AI+LASFWAG+ F TFLS VV +VML + +VV+ LAYFLLFSGF
Sbjct  609   FAVGLAGGADGFFFFVAIVLASFWAGSGFATFLSGVVTNVMLGFPVVVSTLAYFLLFSGF  668

Query  585   FMNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKE  406
             F+NR RIP YW+WFHY+SL+KYPYEAV+QNEF DPT+CFVRG QMFD+TPL+A+P  LK 
Sbjct  669   FINRDRIPKYWLWFHYLSLVKYPYEAVMQNEFSDPTRCFVRGVQMFDNTPLAALPGVLKV  728

Query  405   KLLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLL  226
             ++L AM ++L V I ++TC+TTG D L  Q VTDL+KW+CLWITVAWGFLFRILFY SLL
Sbjct  729   RVLRAMSQSLGVDIGTNTCITTGPDFLRQQAVTDLTKWDCLWITVAWGFLFRILFYISLL  788

Query  225   LGSRNKRR  202
             LGSRNKRR
Sbjct  789   LGSRNKRR  796



>emb|CDY02906.1| BnaC04g25800D [Brassica napus]
Length=1285

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/473 (67%), Positives = 382/473 (81%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL++IA+SGSIVI+SIHQPS R++GLL+RLI LSRG+TV+
Sbjct  813   LFLDEPTSGLDSTSAFMVVNVLKKIAESGSIVIMSIHQPSHRVLGLLNRLIFLSRGKTVF  872

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN-SE  1258
             +GSP +LP F + FG  VPE +N+ EFALDLIRELEGS  GT+ LVEF++RW   +N S 
Sbjct  873   SGSPASLPGFFARFGSPVPENENQTEFALDLIRELEGSAGGTRGLVEFNKRWQEMKNLSP  932

Query  1257  PATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPA-YANSLWTEMAVLSKRSFTNL  1081
             PA+   NL+LKEAISAS+S+GKLVSG         +    +AN  W E+  L++RS  N 
Sbjct  933   PASPNPNLTLKEAISASISRGKLVSGGGGGGGSSVASHGGFANPFWIEIKTLTERSILNS  992

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             RR PE+ GTRL  V +TGFILAT+FWR+DNSPKG+QERLGFFAFAMST FYTCAD LPVF
Sbjct  993   RRQPELFGTRLVTVLITGFILATVFWRLDNSPKGVQERLGFFAFAMSTMFYTCADALPVF  1052

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QERYIF+RETA+NAYRRSSY LSHA+VS P L+ L+L F+ATTFWA GL GG  GF FY
Sbjct  1053  LQERYIFMRETAYNAYRRSSYVLSHAVVSLPSLIFLSLAFAATTFWAVGLEGGPMGFLFY  1112

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
               II ASFW+G+SFVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YW+WFH
Sbjct  1113  CLIIFASFWSGSSFVTFLSGVVPHVMLGYTIVVAILAYFLLFSGFFINRDRIPQYWLWFH  1172

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPYEAVLQNEF DP +CFVRG QMFD+TPL  +   +K +LL ++  ++ +RIT
Sbjct  1173  YLSLVKYPYEAVLQNEFSDPMECFVRGVQMFDNTPLGQLSYGMKLRLLDSVSRSIGMRIT  1232

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              STC+TTGADIL  QGVT+LSKW+CL +T+ +GF FR+LFY  LL GS+NKRR
Sbjct  1233  GSTCLTTGADILKQQGVTELSKWSCLLVTIGFGFFFRVLFYLCLLFGSKNKRR  1285


 Score =   436 bits (1121),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 290/381 (76%), Gaps = 7/381 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VL++IA SGSIV +SIHQPS RI+  LDRL++LS G+ V+
Sbjct  198   LFLDEPTSGLDSTSAFMVVQVLKKIACSGSIVFMSIHQPSCRIMEFLDRLLVLSSGQCVF  257

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             + SP  LP F S+FG  +P+ +N  EF LDLI++LEGS EG + LVEF+R W   +    
Sbjct  258   SDSPATLPLFFSEFGRPIPDKENNAEFTLDLIKDLEGSSEGARRLVEFNRSWQQKKLRGS  317

Query  1254  ATAVHNLS-LKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                 HN S L E I+AS+++GKLV+ + N      S  +Y N  W E  +L+KR   N  
Sbjct  318   QEPHHNSSPLIETINASITRGKLVTTSYN------SKASYVNPWWVETLILAKRYMINWT  371

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE++GTR+ IV +TGF+LAT++WR+D+SP+G+QERL FF+FAM+T FY+CAD LP FI
Sbjct  372   RTPELIGTRVFIVMMTGFLLATVYWRVDDSPRGVQERLSFFSFAMATMFYSCADGLPAFI  431

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETAHNAYRRSSY +SH+LV+ P L  L++ F+ATTFW  GL GG AGF +Y 
Sbjct  432   QERYIFMRETAHNAYRRSSYVISHSLVTLPHLFALSVGFAATTFWFVGLNGGIAGFIYYL  491

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              II ASFW+G SFVTF+S V+P+VM++Y++    L+Y LLFSGF++NR RI LYWIW HY
Sbjct  492   LIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYINRDRIHLYWIWIHY  551

Query  537   ISLIKYPYEAVLQNEFEDPTK  475
             ISL+KYPYEAVL NEF+DP++
Sbjct  552   ISLLKYPYEAVLHNEFDDPSR  572



>emb|CBI25312.3| unnamed protein product [Vitis vinifera]
Length=663

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/472 (66%), Positives = 354/472 (75%), Gaps = 67/472 (14%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLI LSRG+TVY
Sbjct  258   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVY  317

Query  1434  TGSPVNLPQFLSDFGHQVP-EGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSE  1258
             +G P+NLP F ++FGH +P + +NR EFALDLIRELEGSP GTKSLVEF+++W       
Sbjct  318   SGPPMNLPLFFAEFGHPIPPDNENRTEFALDLIRELEGSPGGTKSLVEFNKQWQ------  371

Query  1257  PATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                                        TNDA+  S VP +ANS W EMAVLSKRS TN R
Sbjct  372   --------------------------TTNDASSTSLVPTFANSFWVEMAVLSKRSITNSR  405

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             RMPE+ G RLG V +TGFILAT++W++DNSPKG QERLGFFAFAMSTTFYTCAD LPVF+
Sbjct  406   RMPELFGIRLGAVLITGFILATIYWQLDNSPKGAQERLGFFAFAMSTTFYTCADALPVFL  465

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIFLRETA+NAYRRSSY LSH+L S P L+ L+  F+ATTF+A GL GG +GF FY+
Sbjct  466   QERYIFLRETAYNAYRRSSYVLSHSLTSLPALIFLSFAFAATTFFAVGLDGGLSGFLFYF  525

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              II ASFWAGNSFVTFLS VVPHVML Y +VVA+LAYFLLFSGFF+NR RIP YWIWFHY
Sbjct  526   LIIFASFWAGNSFVTFLSGVVPHVMLGYTIVVALLAYFLLFSGFFINRNRIPSYWIWFHY  585

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             +SL+KYPYE VLQNEF DP KC+                                  ITS
Sbjct  586   VSLVKYPYEGVLQNEFNDPAKCY----------------------------------ITS  611

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             STCVTTG DIL  QG+TDLSKWNCLW+TVAWGF FRILFYF+LL+GS+NKRR
Sbjct  612   STCVTTGVDILKQQGITDLSKWNCLWVTVAWGFFFRILFYFALLMGSKNKRR  663



>ref|XP_009406965.1| PREDICTED: ABC transporter G family member 6-like [Musa acuminata 
subsp. malaccensis]
Length=759

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/471 (67%), Positives = 376/471 (80%), Gaps = 0/471 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA SGSIVI+S+HQPS RI+ LLDRL+ LSRG+TVY
Sbjct  289   LFLDEPTSGLDSTSAFMVVKVLQRIAHSGSIVIMSVHQPSYRILCLLDRLLFLSRGQTVY  348

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G P  +P+F +DFGH +P+ +N  EFALDLIRE EG+P+G K LV+F++     + +  
Sbjct  349   SGPPDGIPRFFADFGHPIPDNENPTEFALDLIRESEGTPDGAKPLVDFNKSRQNTQLALT  408

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
                  ++SLK+AISAS+S+GKLVSGAT+     SSV  +AN  W EMAVL+KRSFTN +R
Sbjct  409   TAEESSVSLKDAISASISRGKLVSGATDRTTSASSVQKHANPFWIEMAVLTKRSFTNTKR  468

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
             MPE+   RLG V VTGFILAT+FWR+DNSPKG+QERLGFFA AMST FYTCAD LPVF+Q
Sbjct  469   MPELFAIRLGAVLVTGFILATIFWRLDNSPKGVQERLGFFAIAMSTMFYTCADALPVFLQ  528

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ER IF+RETA+NAYRRSSY LSHA+V FP L++L++ FS TTF+A GL GGT GF F+  
Sbjct  529   ERNIFMRETAYNAYRRSSYVLSHAIVGFPPLILLSIAFSLTTFFAVGLAGGTQGFLFFVL  588

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
             I+LASFWAG+ FVTFLS VV HVML Y +VVAILAYFLLFSGFF+ R RI  YWIWFHY+
Sbjct  589   IVLASFWAGSGFVTFLSGVVTHVMLGYTVVVAILAYFLLFSGFFITRDRIHDYWIWFHYM  648

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPYEAV+QNEF+D  KCF RG QMFD+TPL  +P  +K  +L +M  +L   IT +
Sbjct  649   SLVKYPYEAVMQNEFDDSHKCFARGVQMFDNTPLGGLPDVMKLNVLKSMSNSLGANITGT  708

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TC+TTG DIL  Q +T L KW CLW+TVAWGFLFR LFY +LLLGSRNKRR
Sbjct  709   TCITTGTDILKQQSITQLDKWECLWVTVAWGFLFRFLFYIALLLGSRNKRR  759



>gb|EYU41661.1| hypothetical protein MIMGU_mgv1a002205mg [Erythranthe guttata]
Length=701

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/473 (62%), Positives = 375/473 (79%), Gaps = 5/473 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA  VVKVLQRIAQ+GSIV++SIHQPS RI+GLL+RLI+LS G+TV+
Sbjct  232   LFLDEPTSGLDSTSAHMVVKVLQRIAQTGSIVVMSIHQPSYRILGLLNRLIILSHGQTVF  291

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRN--S  1261
             TGSP  LPQF  +FG+ +P  D+++EFALD IRELE +P GT +L +F+++W    N   
Sbjct  292   TGSPSLLPQFFQEFGNPIPTNDDKIEFALDYIRELECNPGGTDNLSDFNKKWQKKNNPPR  351

Query  1260  EPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
              P T    +SLK AISAS+S GKLVSG  N+ N  SS+P YAN  W EM V+SKRS  N 
Sbjct  352   NPNTIGPRISLKNAISASISMGKLVSGPNNNNNLESSIPKYANPFWKEMIVISKRSILNS  411

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              R PE+ G R G V +TG ILAT+F ++++SPKG+QERLGFFAFAMSTTFYTCA+ +PVF
Sbjct  412   TRSPELFGARFGAVLITGIILATIFRKLEDSPKGVQERLGFFAFAMSTTFYTCAEAIPVF  471

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             + ERYIF+RETA+NAYRRSSY +SHA++S P L+IL+  F+ATT+WA GL GG      +
Sbjct  472   LLERYIFMRETAYNAYRRSSYVISHAVISIPALLILSAAFAATTYWAVGLSGGFFF---F  528

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
             Y  +LASFWAG+SFVTFLS V+ ++M+AY +VVAILAYF+LFSGFF+ R RIP YWIWFH
Sbjct  529   YTFVLASFWAGSSFVTFLSGVIFNLMMAYTVVVAILAYFVLFSGFFITRDRIPSYWIWFH  588

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y SL+KYPY+ V+QNEF+D  +CF+RG Q+FD TPL+ VP ++K K+L +M  TL + IT
Sbjct  589   YASLVKYPYQGVMQNEFDDSKRCFMRGVQVFDGTPLAGVPHSVKLKMLKSMSGTLGMNIT  648

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +STC+T G+DIL   GV+D+ KW+CL IT+  GFLFR+LFYF+L++GS+NKR+
Sbjct  649   ASTCLTNGSDILKRAGVSDVDKWSCLLITIGLGFLFRVLFYFALMIGSKNKRK  701



>ref|XP_010504355.1| PREDICTED: ABC transporter G family member 18-like [Camelina 
sativa]
Length=708

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/472 (63%), Positives = 374/472 (79%), Gaps = 4/472 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI++IHQPS+RIV LLDRLI+LSRG+TV+
Sbjct  238   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMTIHQPSARIVDLLDRLIILSRGKTVF  297

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP + SDFG  VPE +N +EFALD+IRELEG  EG + LVEF+ +W   +++  
Sbjct  298   NGSPTSLPSYFSDFGRPVPEKENIIEFALDVIRELEGPSEGNRGLVEFNEKWQQNQSTR-  356

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSFTNL  1081
             AT  + LSLKEAI+ASVS+GKLVSG++  ANP+S   V +Y N   TE  +L+KR   N 
Sbjct  357   ATPQNGLSLKEAITASVSRGKLVSGSSG-ANPISMERVSSYVNPPLTETFILAKRYMRNW  415

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              R PE++ TR+  V VTG +LAT++WR+DN+P+G QER+GFFAF MST FY CAD +PVF
Sbjct  416   IRTPELIATRIATVMVTGLLLATIYWRLDNTPRGAQERMGFFAFGMSTMFYCCADNIPVF  475

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             IQERYIFLRET +NAYR SSY +SHALVS P L+ L++ F+ATTFW  GL GG   FF+Y
Sbjct  476   IQERYIFLRETTYNAYRTSSYVISHALVSLPQLLALSIAFAATTFWTVGLTGGLENFFYY  535

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
               II A+FW+G+SFVTF+S +VP+VM++Y++ +A L+Y LL  GFF+NR RIP YWIWFH
Sbjct  536   CLIIYAAFWSGSSFVTFISGIVPNVMMSYMVTIAYLSYCLLLGGFFINRDRIPFYWIWFH  595

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             YISL+KYPYEAVL NEF+DP++CFV+G Q+FD T L+ VP A+K KLL  +  +L  +IT
Sbjct  596   YISLLKYPYEAVLMNEFDDPSRCFVKGVQVFDGTLLAEVPHAMKVKLLDTLSGSLGTKIT  655

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              STC+ TG D+L  QG+T LSKW+CLWIT AWG  FRILFYFSLL GS+NKR
Sbjct  656   ESTCLRTGTDLLMQQGITQLSKWDCLWITFAWGLFFRILFYFSLLFGSKNKR  707



>ref|XP_010427259.1| PREDICTED: ABC transporter G family member 18 [Camelina sativa]
Length=708

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/472 (63%), Positives = 374/472 (79%), Gaps = 4/472 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI+SIHQPS+RIV LLDRLI+LSRG++V+
Sbjct  238   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVDLLDRLIILSRGKSVF  297

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP + SDFG  VPE +N +EFALD++RELEGS EG + LVEF+ +W   +++  
Sbjct  298   NGSPTSLPSYFSDFGRPVPEKENIIEFALDVVRELEGSSEGNRGLVEFNEKWQQNQSAR-  356

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSFTNL  1081
             AT  + LSLKEAI+ASVS+GKLVSG++  A+P+S   V +Y N   TE  +L+KR   N 
Sbjct  357   ATPQNGLSLKEAITASVSRGKLVSGSSG-ASPISMERVSSYVNPPLTETFILAKRYMRNW  415

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              R PE++ TR+  V VTG +LAT++WR+DN+P+G QER+GFFAF MST FY CAD +PVF
Sbjct  416   IRTPELIATRIATVMVTGLLLATIYWRLDNTPRGAQERMGFFAFGMSTMFYCCADNIPVF  475

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             IQERYIFLRET HNAYR SSY +SHALV+ P L+ L++ F+ATTFW  GL GG   FFFY
Sbjct  476   IQERYIFLRETTHNAYRTSSYVISHALVALPQLLALSIAFAATTFWTVGLTGGLENFFFY  535

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
               II A FW+G+SFVTF+S +VP+VM++Y++ +A L+Y LL  GFF+NR RIP YWIWFH
Sbjct  536   CLIIYAGFWSGSSFVTFISGIVPNVMISYMVTIAYLSYCLLLGGFFINRDRIPFYWIWFH  595

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             YISL+KYPYEAVL NEF+DP++CFV+G Q+FD T L+ VP A+K KLL  +  +L  +IT
Sbjct  596   YISLLKYPYEAVLINEFDDPSRCFVKGVQVFDGTLLAEVPHAMKVKLLDTLSGSLGTKIT  655

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              STC+ TG D+L  QG+T LSKW+CLWIT AWG  FRILFYFSLL GS+NKR
Sbjct  656   ESTCLRTGTDLLMQQGITQLSKWDCLWITFAWGLFFRILFYFSLLFGSKNKR  707



>gb|KFK36824.1| hypothetical protein AALP_AA4G176300 [Arabis alpina]
Length=713

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/473 (64%), Positives = 369/473 (78%), Gaps = 4/473 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL++IAQSGSIVI+SIHQPS R++ LLDRLI LS G TVY
Sbjct  243   LFLDEPTSGLDSTSAFMVVNVLKKIAQSGSIVIMSIHQPSHRVLCLLDRLIFLSHGHTVY  302

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSPV+ P+F +D G  +P  +N  EFALD IRELEGS  GT++LVEF+++W     + P
Sbjct  303   SGSPVSFPRFFADLGSPIPANENIAEFALDFIRELEGSAGGTRALVEFNKKWQ--EMTPP  360

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSS--VPAYANSLWTEMAVLSKRSFTNL  1081
             ++   NL+LKEAISAS+S+GKLVSG  +     ++  VPA+AN +W E+  LS+RS  N 
Sbjct  361   SSPHSNLTLKEAISASISRGKLVSGGESIGTTTTALVVPAFANPMWIEIKTLSQRSMLNS  420

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             RR P++ G ++  V +T FIL+T+FWR+DNS  GI E LGFFA+AMST + TCA  LP  
Sbjct  421   RRQPKLFGVKVVAVFITAFILSTVFWRLDNSRNGIGEHLGFFAYAMSTMYTTCAQALPEL  480

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QERYIF+RETA+NAYRRSSY LSHA+VSFP L++L L F+  TFWA GL GG  G  FY
Sbjct  481   LQERYIFMRETAYNAYRRSSYVLSHAIVSFPGLMVLTLAFAVLTFWAVGLDGGPTGLLFY  540

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
               IILASFW+G+SFVTFLS V+P+VM+ Y +V+AILAYFLLFSGFF+NR RIP YWIWFH
Sbjct  541   CLIILASFWSGSSFVTFLSGVIPNVMVGYTIVIAILAYFLLFSGFFINRNRIPDYWIWFH  600

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             YISL+KYPYEAVLQNEF D TKCFVRG Q FD+TPL  +   +K  +L  + ++L   IT
Sbjct  601   YISLVKYPYEAVLQNEFSDATKCFVRGVQTFDNTPLEELSYDMKLSMLETVSQSLGKSIT  660

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             SSTC+TTGADIL  Q V  LSKW+CL++TVA+GF FR LFYFSLLLGS+NKRR
Sbjct  661   SSTCLTTGADILTHQSVNQLSKWHCLFVTVAFGFFFRALFYFSLLLGSKNKRR  713



>dbj|BAJ97356.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=757

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/474 (66%), Positives = 370/474 (78%), Gaps = 3/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIVI SIHQPS RI+GLLDRLILLS G TV+
Sbjct  284   LFLDEPTSGLDSTSAFMVVKVLRRIAESGSIVITSIHQPSQRILGLLDRLILLSGGHTVF  343

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS---GGRN  1264
             +G+P  LP + ++FGH VP+ +NR EFALDLIRELE SP GTK LVEF R W      R+
Sbjct  344   SGAPSALPTYFAEFGHPVPDDENRAEFALDLIRELEASPTGTKPLVEFHRTWKLMHAARS  403

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
              + A     +SLKEAISAS+S+GKLVSGA   +   +S+  YAN  W EM VL+KRS  N
Sbjct  404   DDAAAWAPTMSLKEAISASISRGKLVSGADVSSGEAASMHTYANPFWVEMKVLTKRSAIN  463

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RRMPE+   RLG V VTG ILAT+F+++D SPKG QERLGFFAFAMST FYTCAD LPV
Sbjct  464   TRRMPELFLIRLGAVVVTGVILATVFFKLDQSPKGAQERLGFFAFAMSTMFYTCADALPV  523

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QERY+FLRETA+ AYR  SY LS+A+VSFP LV+L+L F+ TTF+A GL GG +GF F
Sbjct  524   FLQERYVFLRETAYGAYRHVSYVLSNAIVSFPPLVVLSLAFALTTFFAVGLAGGASGFAF  583

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y   ILASFWAG+ FVTFLS V+PHVM+ Y +VVAILAYFLLFSGFF+NR RIP YW+WF
Sbjct  584   YTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFFINRDRIPAYWLWF  643

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HY+SL+KYP+E VLQNEF    +CFVRG Q+FD++PL A+P A+KE++L ++   L V I
Sbjct  644   HYLSLVKYPFEGVLQNEFARGGECFVRGAQIFDNSPLGALPEAVKERVLASISSALGVGI  703

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              + TCV TG  +L    VT L KW CL +T AWGF FRILFYFSL+LGS+NKRR
Sbjct  704   GADTCVATGRSVLRQAAVTQLGKWECLLVTAAWGFFFRILFYFSLVLGSKNKRR  757



>ref|XP_006290668.1| hypothetical protein CARUB_v10016759mg [Capsella rubella]
 gb|EOA23566.1| hypothetical protein CARUB_v10016759mg [Capsella rubella]
Length=708

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/472 (63%), Positives = 373/472 (79%), Gaps = 4/472 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI+SIHQPS+RIV LLDRLI+LSRG++V+
Sbjct  238   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVDLLDRLIILSRGKSVF  297

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP + S+FG  +PE +N  EFALD+IRELEGS EG + LVEF+ +W   +++  
Sbjct  298   NGSPTSLPSYFSEFGRPIPEKENITEFALDVIRELEGSSEGNRGLVEFNEKWQQNQSAR-  356

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSFTNL  1081
              T    LSL+E+I+ASVS+GKLVSG++  ANPVS   V +Y NS  TE  +L+KR   N 
Sbjct  357   VTPQSGLSLEESITASVSRGKLVSGSSG-ANPVSMERVSSYVNSPLTEAFILAKRYMRNW  415

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              R PE++G R+G V VTG +LAT++WR+DN+P+G QER+GFFAFAMST FY CAD +PVF
Sbjct  416   IRTPELIGMRMGTVMVTGLLLATVYWRLDNTPRGAQERMGFFAFAMSTMFYCCADNIPVF  475

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             IQE+YIFLRET HNAYR SSY +SHALVS P L+ L++ F+ATTFW  GL GG   FF+Y
Sbjct  476   IQEQYIFLRETTHNAYRTSSYVISHALVSLPQLLALSIAFAATTFWTVGLSGGLENFFYY  535

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
               II A FW+G+SFVTF+S +VP+VM++Y++ ++ L+Y LL  GFF+NR RIPLYWIWFH
Sbjct  536   CLIIYAGFWSGSSFVTFISGIVPNVMMSYMVTISYLSYCLLLGGFFINRDRIPLYWIWFH  595

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             YISL+KYPYEAVL NEF+DP++CFV+G Q+FD T L+ VP  +K KLL  +  +L  +IT
Sbjct  596   YISLLKYPYEAVLINEFDDPSRCFVKGVQVFDGTLLAEVPHVMKVKLLDTLSGSLGTKIT  655

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              STC+ TG D+L  QG+T LSKW+CLWIT AWG  FRILFY SLL GS+NKR
Sbjct  656   ESTCLRTGTDLLMQQGITQLSKWDCLWITFAWGLFFRILFYLSLLFGSKNKR  707



>ref|NP_191071.1| ABC transporter G family member 18 [Arabidopsis thaliana]
 sp|Q9M2V5.1|AB18G_ARATH RecName: Full=ABC transporter G family member 18; Short=ABC transporter 
ABCG.18; Short=AtABCG18; AltName: Full=Probable white-brown 
complex homolog protein 18; Short=AtWBC18 [Arabidopsis 
thaliana]
 emb|CAB82706.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AEE79341.1| ABC transporter G family member 18 [Arabidopsis thaliana]
Length=708

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/472 (62%), Positives = 373/472 (79%), Gaps = 4/472 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGS+VI+SIHQPS+RI+GLLDRLI+LS G++V+
Sbjct  238   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSVVIMSIHQPSARIIGLLDRLIILSHGKSVF  297

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSPV+LP F S FG  +PE +N  EFALD+IRELEGS EGT+ LVEF+ +W   + +  
Sbjct  298   NGSPVSLPSFFSSFGRPIPEKENITEFALDVIRELEGSSEGTRDLVEFNEKWQQNQTAR-  356

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSFTNL  1081
             AT    +SLKEAI+ASVS+GKLVSG++  ANP+S  +V +YAN    E  +L+KR   N 
Sbjct  357   ATTQSRVSLKEAIAASVSRGKLVSGSSG-ANPISMETVSSYANPPLAETFILAKRYIKNW  415

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              R PE++G R+G V VTG +LAT++WR+DN+P+G QER+GFFAF MST FY CAD +PVF
Sbjct  416   IRTPELIGMRIGTVMVTGLLLATVYWRLDNTPRGAQERMGFFAFGMSTMFYCCADNIPVF  475

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             IQERYIFLRET HNAYR SSY +SHALVS P L+ L++ F+ATTFW  GL GG   FF+Y
Sbjct  476   IQERYIFLRETTHNAYRTSSYVISHALVSLPQLLALSIAFAATTFWTVGLSGGLESFFYY  535

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
               II A+FW+G+S VTF+S ++P+VM++Y++ +A L+Y LL  GF++NR RIPLYWIWFH
Sbjct  536   CLIIYAAFWSGSSIVTFISGLIPNVMMSYMVTIAYLSYCLLLGGFYINRDRIPLYWIWFH  595

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             YISL+KYPYEAVL NEF+DP++CFV+G Q+FD T L+ V   +K KLL  +  +L  +IT
Sbjct  596   YISLLKYPYEAVLINEFDDPSRCFVKGVQVFDGTLLAEVSHVMKVKLLDTLSGSLGTKIT  655

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              STC+ TG D+L  QG+T LSKW+CLWIT+AWG  FRILFY SLL GS+NKR
Sbjct  656   ESTCLRTGPDLLMQQGITQLSKWDCLWITLAWGLFFRILFYLSLLFGSKNKR  707



>ref|XP_003558198.1| PREDICTED: ABC transporter G family member 16-like [Brachypodium 
distachyon]
Length=788

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/485 (64%), Positives = 376/485 (78%), Gaps = 16/485 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGS+V++SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  306   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRILGLLDRLLFLSRGQTVY  365

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G P  L  F  DFG  + + +N  EFALDL+RELE  P+G + LVE ++ W   +   P
Sbjct  366   YGPPGALSSFFHDFGKPIHDNENPTEFALDLVRELETMPDGARDLVEHNKSWQ--KRMGP  423

Query  1254  ATAVHN-------LSLKEAISASVSQGKLVSGATN-------DANPVSSVPAYANSLWTE  1117
                 H+       LSLKEAISAS+S+GKLVSGAT+        A+P S+V  +AN  W E
Sbjct  424   KMKHHDDDGEKPSLSLKEAISASISRGKLVSGATDGNVTVSSSASPESAVSKFANPFWVE  483

Query  1116  MAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMST  937
             M VL++R+F N +R PEI   RLG V +TGFILAT+FWR+D+SPKG++ERLGFFA AMST
Sbjct  484   MGVLTRRAFLNTKRTPEIFVIRLGAVLITGFILATIFWRLDDSPKGVEERLGFFAIAMST  543

Query  936   TFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaa  757
              FYTC+D LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP L++L+L F+ TTF+A 
Sbjct  544   MFYTCSDALPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFPSLIVLSLAFAVTTFFAV  603

Query  756   glgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMN  577
             GL GG  GFFF+ AI+LASFWAG+ F TFLS VV +VML + +VV+ LAYFLLFSGFF+N
Sbjct  604   GLAGGVDGFFFFVAIVLASFWAGSGFATFLSGVVTNVMLGFPVVVSTLAYFLLFSGFFIN  663

Query  576   RARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLL  397
             R RIP YW+WFHY SL+KYPYEAV+ NEF DP++CFVRG QMFD+TPLS +  A+K ++L
Sbjct  664   RDRIPKYWLWFHYASLVKYPYEAVMINEFSDPSRCFVRGVQMFDNTPLSILSPAVKVRVL  723

Query  396   TAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGS  217
              AM  +L + I +STC+TTG D L  Q V DL+KW CLWITVAWGFLFRILFY +LLLGS
Sbjct  724   RAMSSSLGINIGTSTCITTGPDFLKQQAVNDLTKWECLWITVAWGFLFRILFYIALLLGS  783

Query  216   RNKRR  202
             RNKRR
Sbjct  784   RNKRR  788



>dbj|BAF00471.1| ABC transporter - like protein [Arabidopsis thaliana]
Length=708

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/472 (62%), Positives = 373/472 (79%), Gaps = 4/472 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGS+VI+SIHQPS+RI+GLLDRLI+LS G++V+
Sbjct  238   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSVVIMSIHQPSARIIGLLDRLIILSHGKSVF  297

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSPV+LP F S FG  +PE +N  EFALD+IRELEGS EGT+ LVEF+ +W   + +  
Sbjct  298   NGSPVSLPSFFSSFGRPIPEKENITEFALDVIRELEGSSEGTRDLVEFNEKWQQNQTAR-  356

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSFTNL  1081
             AT    +SLKEAI+ASVS+GKLVSG++  ANP+S  +V +YAN    E  +L+KR   N 
Sbjct  357   ATTQSRVSLKEAIAASVSRGKLVSGSSG-ANPISMETVSSYANPPLAETFILAKRYIKNW  415

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              R PE++G R+G V VTG +LAT++WR+DN+P+G QER+GFFAF MST FY CAD +PVF
Sbjct  416   IRTPELIGMRIGTVMVTGLLLATVYWRLDNTPRGAQERMGFFAFGMSTMFYCCADNIPVF  475

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             IQERYIFLRET HNAYR SSY +SHALVS P L+ L++ F+ATTFW  GL GG   FF+Y
Sbjct  476   IQERYIFLRETTHNAYRTSSYVISHALVSLPQLLALSIAFAATTFWTVGLSGGLESFFYY  535

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
               +I A+FW+G+S VTF+S ++P+VM++Y++ +A L+Y LL  GF++NR RIPLYWIWFH
Sbjct  536   CLVIYAAFWSGSSIVTFISGLIPNVMMSYMVTIAYLSYCLLLGGFYINRDRIPLYWIWFH  595

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             YISL+KYPYEAVL NEF+DP++CFV+G Q+FD T L+ V   +K KLL  +  +L  +IT
Sbjct  596   YISLLKYPYEAVLINEFDDPSRCFVKGVQVFDGTLLAEVSHVMKVKLLDTLSGSLGTKIT  655

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              STC+ TG D+L  QG+T LSKW+CLWIT+AWG  FRILFY SLL GS+NKR
Sbjct  656   ESTCLRTGPDLLMQQGITQLSKWDCLWITLAWGLFFRILFYLSLLFGSKNKR  707



>gb|KFK36826.1| hypothetical protein AALP_AA4G176500 [Arabis alpina]
Length=691

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/472 (64%), Positives = 365/472 (77%), Gaps = 6/472 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL++IAQSGSIVI+SIHQPS R++ LLDRLI LSRG+TVY
Sbjct  225   LFLDEPTSGLDSTSAFMVVNVLKKIAQSGSIVIMSIHQPSHRVLCLLDRLIFLSRGQTVY  284

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LP+F +DFG  +P+ +N  EF LDLIRE EGS  GT++LVEF+++W     + P
Sbjct  285   SGSPASLPRFFADFGKPIPQNENITEFTLDLIREFEGSATGTRALVEFNKKWQ--EMTPP  342

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGA-TNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
             +++  NL+LKEAI+AS+S+GKLVSG  +  A     VPA+AN +W E+  LSKRS  N  
Sbjct  343   SSSHPNLTLKEAIAASISRGKLVSGGQSGGATTTLVVPAFANPIWIEIKTLSKRSMLNSC  402

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE    +L  V +T FILAT+FW +DNSP+GIQERLGFFAFAMST +YTC + LP F+
Sbjct  403   RQPEFFAIKLASVVITAFILATVFWGLDNSPQGIQERLGFFAFAMSTMYYTCVEALPDFL  462

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETA+N YRRSSY LSHA+VSFP L++L + F+A TFWA GL GG      Y 
Sbjct  463   QERYIFMRETAYNTYRRSSYVLSHAIVSFPGLIVLTVAFAAMTFWAVGLDGGFLF---YC  519

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              IILAS+W G+SFVTFLS +VP++ML Y + VAILAYFLLFSGFF+NR RIP YWIWFHY
Sbjct  520   LIILASYWLGSSFVTFLSAIVPNLMLGYTISVAILAYFLLFSGFFINRNRIPDYWIWFHY  579

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             +SL+KY YEAVLQNEF D  KCFVRG Q FD+TPL  +P  +K  LL  + ++L   ITS
Sbjct  580   MSLVKYSYEAVLQNEFSDANKCFVRGVQTFDNTPLEELPYEMKLNLLDTVSQSLGTTITS  639

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             STC+TT ADI+  QGVT LSKW+ L ITVA GF  R+LFY  LLLGS+NKRR
Sbjct  640   STCLTTSADIMTHQGVTQLSKWHWLLITVAVGFFLRVLFYLCLLLGSKNKRR  691



>ref|XP_002878018.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54277.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=708

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/472 (62%), Positives = 373/472 (79%), Gaps = 4/472 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI+SIHQPS+RI+ LLDRLI+LS G++V+
Sbjct  238   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIIDLLDRLIILSHGKSVF  297

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP F S+FG  +PE +N  EFALD+IRELEGS EGT+ LVEF+ +W   +++  
Sbjct  298   NGSPASLPSFFSNFGRPIPEKENITEFALDVIRELEGSSEGTRGLVEFNEKWQQNQSAR-  356

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSFTNL  1081
             AT    +SLKEAI+ASVS+GKLVSG++  ANPVS  +V +YAN    E  +L+KR   N 
Sbjct  357   ATTQSGVSLKEAITASVSRGKLVSGSSG-ANPVSMETVSSYANPPLAETFILAKRYIRNW  415

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              R PE++G R+  V VTG +LAT++WR+DN+P+G QER+GFFAF MST FY CAD +PVF
Sbjct  416   IRTPELIGMRIATVMVTGLLLATIYWRLDNTPRGAQERMGFFAFGMSTMFYCCADNIPVF  475

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             IQERYIFLRET HNAYR SSY +SHALVS P L+ L++ F+ATTFW  GL GG   F++Y
Sbjct  476   IQERYIFLRETTHNAYRTSSYVISHALVSLPQLLALSIAFAATTFWTVGLSGGLESFYYY  535

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
               II A+FW+G+S VTF+S ++P+VM++Y+  +A L+Y LL  GF++NR RIPLYWIWFH
Sbjct  536   CLIIYAAFWSGSSIVTFISGLIPNVMMSYMATIAYLSYCLLLGGFYINRDRIPLYWIWFH  595

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             YISL+KYPYEAVL NEF+DP++CFV+G Q+FD T L+ VP  +K KLL  +  +L  +IT
Sbjct  596   YISLLKYPYEAVLINEFDDPSRCFVKGVQVFDGTLLAEVPHTMKVKLLDTLSSSLGTKIT  655

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              STC+ TG D+L  QG+T LSKW+CLWIT+AWG  FRILFYF+LL GS+NKR
Sbjct  656   ESTCLRTGPDLLMQQGITQLSKWDCLWITLAWGLFFRILFYFTLLFGSKNKR  707



>gb|ACN28998.1| unknown [Zea mays]
Length=469

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/470 (64%), Positives = 368/470 (78%), Gaps = 18/470 (4%)
 Frame = -2

Query  1563  VVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVYTGSPVNLPQFLSDFGHQ  1384
             VVKVLQRIAQSGS+V++SIHQPS RI+GLLDRL+ LSRG+TVY G P  LP F +DFG  
Sbjct  2     VVKVLQRIAQSGSVVVMSIHQPSYRILGLLDRLLFLSRGQTVYYGPPGALPSFFNDFGKP  61

Query  1383  VPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEPATAVHN-------LSLK  1225
             +P  +N  EFALDLIRELE  P+G   LVE +++W     + P    H+       LSLK
Sbjct  62    IPGNENPTEFALDLIRELETMPDGATDLVEHNKKWQ--MRTAPKAKHHDGHGEKPSLSLK  119

Query  1224  EAISASVSQGKLVSGATN---------DANPVSSVPAYANSLWTEMAVLSKRSFTNLRRM  1072
             EAISAS+S+GKLVSGAT+         ++ P ++V  +AN  W EM VL++R+F N +R 
Sbjct  120   EAISASISRGKLVSGATDGSVSVHSAGESAPAAAVSKFANPFWVEMGVLTRRAFLNTKRT  179

Query  1071  PEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQE  892
             PEI   RL  V VTGFILAT+FWR+D+SPKG+QERLGFFA AMST FYTC+D+LPVF+ E
Sbjct  180   PEIFIIRLAAVMVTGFILATIFWRLDDSPKGVQERLGFFAIAMSTMFYTCSDSLPVFLNE  239

Query  891   RYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYAI  712
             RYIFLRETA+NAYRRSSY LSH +V FP L++L+  F+ TTF+A GL GG  GFFF+ AI
Sbjct  240   RYIFLRETAYNAYRRSSYVLSHTIVGFPSLIVLSFAFALTTFFAVGLAGGADGFFFFVAI  299

Query  711   ILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYIS  532
             +LASFWAG+ F TFLS VV +VML + +VV+ LAYFLLFSGFF+NR RIP YW+WFHY+S
Sbjct  300   VLASFWAGSGFATFLSGVVTNVMLGFPVVVSTLAYFLLFSGFFINRDRIPRYWLWFHYLS  359

Query  531   LIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSST  352
             L+KYPYEAV+QNEF DPT+CFVRG QMFD+TPL+ +PA LK ++L AM ++L V I ++T
Sbjct  360   LVKYPYEAVMQNEFSDPTRCFVRGVQMFDNTPLAVLPAVLKVRVLRAMSQSLGVDIGTAT  419

Query  351   CVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             C+TTG D LA Q VTDL+KW+CLWITVAWGFLFRILFY SLLLGSRNKRR
Sbjct  420   CITTGPDFLAQQAVTDLTKWDCLWITVAWGFLFRILFYISLLLGSRNKRR  469



>ref|XP_003561756.1| PREDICTED: ABC transporter G family member 6-like [Brachypodium 
distachyon]
Length=751

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/480 (64%), Positives = 374/480 (78%), Gaps = 9/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIA SGS+V++S+HQPS RI+GLLDRL+ LSRG TVY
Sbjct  272   LFLDEPTSGLDSTSAFMVVKVLQRIAHSGSVVVMSVHQPSYRILGLLDRLLFLSRGRTVY  331

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G+P  LP F S+FGH +P+G+N  EFALD IRELE + +GTK LV+ S+ W     S  
Sbjct  332   YGAPAALPLFFSEFGHPIPDGENPAEFALDHIRELESTQDGTKELVQLSKSWQEKPLSRA  391

Query  1254  ATAVHN----LSLKEAISASVSQGKLVSGATNDANPVSS----VPAYANSLWTEMAVLSK  1099
              +A  +    LSLKEAIS S+++GKLVSG +  +  V++    V  YAN  W E+ VL++
Sbjct  392   VSAASSDKPSLSLKEAISLSIARGKLVSGTSTGSPEVAAATTEVATYANPWWAEVWVLTR  451

Query  1098  RSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCA  919
             R+FTN RR PE+   RLG V VTGF+LAT+FWR+DN+PKG+ ER GFFA AMST FYT A
Sbjct  452   RAFTNTRRTPELFLIRLGAVVVTGFVLATIFWRLDNTPKGVNERFGFFAIAMSTMFYTSA  511

Query  918   DTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggt  739
             D LPVF+ ERYIFLRETAHNAYRRSSY LS+A+V+FP LV L+L F+A TF+A GL GG 
Sbjct  512   DALPVFLIERYIFLRETAHNAYRRSSYTLSNAIVAFPPLVFLSLAFTAITFFAVGLAGGA  571

Query  738   agffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPL  559
              GF F+  I+LASFWAG+ FVTFLS VVPHV++ Y +VVA+LAYFLLFSGFF+ R RIP 
Sbjct  572   EGFVFFALIVLASFWAGSGFVTFLSGVVPHVIIGYTVVVAMLAYFLLFSGFFVTRDRIPD  631

Query  558   YWIWFHYISLIKYPYEAVLQNEF-EDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
             YWIWFHY+SLIKYPYEAV+QNEF  DP+KCF+RG QMFD TP+  +P A +  +L AM +
Sbjct  632   YWIWFHYLSLIKYPYEAVMQNEFGADPSKCFMRGVQMFDGTPMGKLPVATQVTVLNAMSK  691

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             ++ +   S++C+TTG DILA Q V  L KWNCLW TVAWGFLFR+LFY +L+LGSRNKRR
Sbjct  692   SMKIDFNSTSCITTGTDILAKQAVNQLGKWNCLWATVAWGFLFRVLFYLTLVLGSRNKRR  751



>emb|CDX67624.1| BnaA07g16640D [Brassica napus]
Length=707

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/475 (62%), Positives = 374/475 (79%), Gaps = 6/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIA+SGSIVI+SIHQPS+R++ LLDRLI+LSRG++V+
Sbjct  233   LFLDEPTSGLDSTNAFMVVQVLRRIARSGSIVIMSIHQPSARVIDLLDRLIILSRGKSVF  292

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS---GGRN  1264
              GSP +LP FLSDFGH VPE +N  EF LDL+R+LEGS EG + LVEF+ +W      R 
Sbjct  293   NGSPTSLPTFLSDFGHPVPEKENITEFTLDLVRKLEGSTEGARELVEFNEKWQHNQSARA  352

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSF  1090
             +   T    LSLKE+I+ASVS+GKLVSG+T+ +NP+S  SV +YANS   E  +L+KR  
Sbjct  353   TPMTTPYQALSLKESITASVSRGKLVSGSTS-SNPISMESVSSYANSPLVETFILAKRYM  411

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  R PE++GTR+  V VTG +LAT++WR+DN+P+G QER+ F A+ MST FY CAD++
Sbjct  412   KNWMRTPELMGTRIATVMVTGLLLATVYWRLDNTPRGAQERMSFVAYGMSTMFYVCADSV  471

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             P FIQER+IFLRET  NAYR SSY +SH+LVS P L+ L++ F+ATTFW  GL GG   F
Sbjct  472   PAFIQERFIFLRETTRNAYRTSSYVISHSLVSLPQLLALSIAFAATTFWTVGLSGGLESF  531

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
             FFY  II A FW+G+SFVTF+S +VP+VM+++++ +A L+Y LL  GF++NR RIP+YWI
Sbjct  532   FFYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLSYCLLMGGFYINRDRIPIYWI  591

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF+DP++CFVRG Q+FD T L+ VP A+K KLL  M ++L  
Sbjct  592   WFHYISLLKYPYEAVLINEFDDPSRCFVRGVQVFDGTLLAKVPEAMKVKLLDTMSDSLGT  651

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              IT STC+ TG D+L  QG++ LSKW+CLWIT+AWG  FRILFYFSLL GS+NKR
Sbjct  652   NITESTCLRTGPDLLLQQGISQLSKWDCLWITLAWGLFFRILFYFSLLFGSKNKR  706



>gb|AEP23076.1| ATP-binding cassette protein subfamily G member 5 [Lolium perenne]
Length=793

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/484 (64%), Positives = 373/484 (77%), Gaps = 14/484 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGS+V++SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  311   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRILGLLDRLLFLSRGQTVY  370

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G P +L  F  DFG  + + +N  EFALDL+RELE  PEG   LVE ++ W      + 
Sbjct  371   YGPPGSLSSFFHDFGKPIHDNENPTEFALDLVRELETMPEGASDLVEHNKSWQKRMGPKI  430

Query  1254  ATAVH----NLSLKEAISASVSQGKLVSGATNDAN---------PVSSVPAYANSLWTEM  1114
               A      +LSLKEAISAS+S+GKLVSGAT D N         P S+V  +AN  W EM
Sbjct  431   KHADDGGKPSLSLKEAISASISRGKLVSGAT-DGNVTVPSELSAPDSAVTKFANPFWIEM  489

Query  1113  AVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTT  934
              VL++R+F N +R PEI   RLG V +TGFILAT+FWR+D+SPKG++ERLGFFA AMST 
Sbjct  490   GVLTRRAFINTKRTPEIFVIRLGAVLITGFILATIFWRLDDSPKGVEERLGFFAIAMSTM  549

Query  933   FYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaag  754
             FYTC+D LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP L++L+  F+ TTF+A G
Sbjct  550   FYTCSDALPVFLNERYIFLRETAYNAYRRSSYVLSHTVVGFPSLIVLSFAFAVTTFFAVG  609

Query  753   lgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNR  574
             L GG  GFFF+ AI+LASFWAG+ F TFLS VV +V L + +VV+ LAYFLLFSGFF+NR
Sbjct  610   LAGGAQGFFFFVAIVLASFWAGSGFATFLSGVVTNVQLGFPVVVSTLAYFLLFSGFFINR  669

Query  573   ARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLT  394
              RIP YW+WFHY SL+KYPYEAV+ NEF DP +CFVRG QMFD+TPL+ +P  LK +LL 
Sbjct  670   DRIPKYWLWFHYASLVKYPYEAVMMNEFSDPARCFVRGVQMFDNTPLAVLPVPLKVRLLR  729

Query  393   AMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSR  214
             AM  +L + I ++TC+TTG D L  Q VTDL+KW+CLWITVAWGFLFRILFY +L+LGSR
Sbjct  730   AMSSSLGINIGTNTCITTGPDFLRQQAVTDLTKWDCLWITVAWGFLFRILFYIALVLGSR  789

Query  213   NKRR  202
             NKRR
Sbjct  790   NKRR  793



>ref|XP_009103951.1| PREDICTED: ABC transporter G family member 18-like [Brassica 
rapa]
Length=707

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/475 (62%), Positives = 373/475 (79%), Gaps = 6/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIA+SGSIVI+SIHQPS+R++ LLDRLI+LSRG++V+
Sbjct  233   LFLDEPTSGLDSTNAFMVVQVLRRIARSGSIVIMSIHQPSARVIDLLDRLIILSRGKSVF  292

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS---GGRN  1264
              GSP +LP FLSDFGH VPE +N  EF LDL+R+LEGS EG + LVEF+ +W      R 
Sbjct  293   NGSPTSLPTFLSDFGHPVPEKENITEFTLDLVRKLEGSTEGARELVEFNEKWQHNQSARA  352

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSF  1090
             +   T    LSLKE+I+ASVS+GKLVSG+T+ +NP+S  SV +YANS   E  +L+KR  
Sbjct  353   TPMTTPYQALSLKESITASVSRGKLVSGSTS-SNPISMESVSSYANSPLVETFILAKRYM  411

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  R PE++GTR+  V VTG +LAT++WR+DN+P+G QER+ F A+ MST FY CAD++
Sbjct  412   KNWMRTPELMGTRIATVMVTGLLLATVYWRLDNTPRGAQERMSFVAYGMSTMFYVCADSV  471

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             P FIQER+IFLRET  NAYR SSY +SH+LVS P L+ L++ F+ATTFW  GL GG   F
Sbjct  472   PAFIQERFIFLRETTRNAYRTSSYVISHSLVSLPQLLALSIAFAATTFWTVGLSGGLESF  531

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
             FFY  II A FW+G+SFVTF+S +VP+VM+++++ +A L+Y LL  GF++NR RIP+YWI
Sbjct  532   FFYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLSYCLLMGGFYINRDRIPIYWI  591

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF+DP +CFVRG Q+FD T L+ VP A+K KLL  M ++L  
Sbjct  592   WFHYISLLKYPYEAVLINEFDDPFRCFVRGVQVFDGTLLAKVPEAMKVKLLDTMSDSLGT  651

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              IT STC+ TG D+L  QG++ LSKW+CLWIT+AWG  FRILFYFSLL GS+NKR
Sbjct  652   NITESTCLRTGPDLLLQQGISQLSKWDCLWITLAWGLFFRILFYFSLLFGSKNKR  706



>ref|XP_008657087.1| PREDICTED: ABC transporter G family member 16-like [Zea mays]
 gb|AFW84654.1| hypothetical protein ZEAMMB73_004093 [Zea mays]
Length=743

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/477 (66%), Positives = 372/477 (78%), Gaps = 7/477 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIVI SIHQPS RI+GLLDRLILLS G TV+
Sbjct  268   LFLDEPTSGLDSTSAFMVVKVLRRIAESGSIVITSIHQPSQRILGLLDRLILLSGGRTVF  327

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS--GGRNS  1261
             +G P  LP + ++FG  VP+ +NR EFALDLIRELE SP GTK LV+F R W     R +
Sbjct  328   SGPPSALPSYFAEFGFPVPDDENRAEFALDLIRELESSPTGTKPLVDFQRTWQLMHARTT  387

Query  1260  EPATAVHN----LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRS  1093
              PA A  +    +SLKEAISAS+S+GKLVSG ++ A   +SV  YAN  W EM VL+KRS
Sbjct  388   SPAAAQGDGGSAMSLKEAISASISRGKLVSG-SDVAGEAASVRTYANPFWVEMKVLTKRS  446

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
               N RRMPE+   RLG V VTG ILAT+F+R+D SPKG QERLGFFAFAMST +YTCAD 
Sbjct  447   AINTRRMPELFLIRLGAVVVTGAILATVFFRLDQSPKGAQERLGFFAFAMSTMYYTCADA  506

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVF+QERY+FLRETA+ AYRR+SY LS+ALVSFP LV+L+L F+ TTF+A GL GG  G
Sbjct  507   LPVFLQERYVFLRETAYGAYRRASYVLSNALVSFPPLVVLSLAFALTTFFAVGLAGGVPG  566

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F FY   ILASFWAG+ FVTFLS V+PHVM+ Y +VVAILAYFLLFSGFF+ R RIP YW
Sbjct  567   FAFYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFFITRDRIPPYW  626

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHY+SLIKYP+E VLQNEF    +CFVRG Q+FD++PL+ +P A+K ++L ++   L 
Sbjct  627   IWFHYLSLIKYPFEGVLQNEFGRGGECFVRGAQIFDNSPLAGLPDAVKARVLASISSALG  686

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             V I + TCV TG  +L    VT L KW CL +T+AWGFLFRILFYFSL+LGS+NKRR
Sbjct  687   VGIGADTCVVTGRGVLQQAAVTQLGKWECLLVTMAWGFLFRILFYFSLVLGSKNKRR  743



>ref|XP_008674853.1| PREDICTED: ABC transporter G family member 16 [Zea mays]
 tpg|DAA56944.1| TPA: hypothetical protein ZEAMMB73_747644 [Zea mays]
Length=761

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/483 (64%), Positives = 369/483 (76%), Gaps = 12/483 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIVI SIHQPS RI+GLLDRLILLS G+TV+
Sbjct  279   LFLDEPTSGLDSTSAFMVVKVLRRIAESGSIVITSIHQPSQRILGLLDRLILLSGGQTVF  338

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW--------  1279
             +G P  LP + ++FG  VP+ +NR EFALDLIRE E SP GTK LV+F R W        
Sbjct  339   SGPPSALPSYFAEFGFPVPDDENRAEFALDLIREFESSPTGTKPLVDFHRTWQHMHARSH  398

Query  1278  ----SGGRNSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMA  1111
                 +G      A     + LKEAISAS+S+GKLV G+   A   +SV  YAN  W EM 
Sbjct  399   GQGSAGAAGQTLAATAPTMPLKEAISASISRGKLVLGSDGVAGEAASVRTYANPFWVEMK  458

Query  1110  VLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTF  931
             VL+KRS  N RRMPE+   RLG V VTG ILAT+F+R+D SPKG QERLGFFAFAMST F
Sbjct  459   VLTKRSAINTRRMPELFLIRLGAVVVTGAILATVFFRLDQSPKGAQERLGFFAFAMSTMF  518

Query  930   YTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaagl  751
             YTCAD LPVF+QERY+FLRETA+ AYRR+SY LS+A+VSFP +V+L+L F+ TTF+A GL
Sbjct  519   YTCADALPVFLQERYVFLRETAYGAYRRASYVLSNAIVSFPPIVVLSLAFAFTTFFAVGL  578

Query  750   gggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRA  571
              GG +GF FY   ILASFWAG+ FVTFLS V+PHVM+ Y +VVAILAYFLLF+GFF+NR 
Sbjct  579   AGGVSGFAFYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFTGFFINRD  638

Query  570   RIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTA  391
             RIP YWIWFHY+SLIKYP+E VLQNEF    +CFVRG QMFD++PL+ +P A+K ++L +
Sbjct  639   RIPAYWIWFHYLSLIKYPFEGVLQNEFGRGGECFVRGAQMFDNSPLAGLPDAVKGRVLAS  698

Query  390   MGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRN  211
             +   L VRI + TCV TG  +L    VT L KW CL +T+AWGFLFRILFYFSL+LGS+N
Sbjct  699   ISSALGVRIGADTCVVTGRGVLHQAAVTQLGKWECLLVTMAWGFLFRILFYFSLVLGSKN  758

Query  210   KRR  202
             KRR
Sbjct  759   KRR  761



>sp|B8ALI0.1|AB5G_ORYSI RecName: Full=ABC transporter G family member 5; Short=ABC transporter 
ABCG.5; Short=OsABCG5; AltName: Full=White-brown complex 
homolog protein 5; Short=OsWBC5 [Oryza sativa Indica 
Group]
 gb|EEC74989.1| hypothetical protein OsI_11044 [Oryza sativa Indica Group]
Length=787

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/485 (63%), Positives = 368/485 (76%), Gaps = 14/485 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL+ IAQSGS+V++SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  303   LFLDEPTSGLDSTSAFMVVTVLKAIAQSGSVVVMSIHQPSYRILGLLDRLLFLSRGKTVY  362

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G P  LP F  DFG  +P+ +N  EFALDLI+E+E   EGTK L E +  W    + E 
Sbjct  363   YGPPSELPPFFLDFGKPIPDNENPTEFALDLIKEMETETEGTKRLAEHNAAWQLKHHGEG  422

Query  1254  AT--AVHNLSLKEAISASVSQGKLVSGATNDANPVSSVP------------AYANSLWTE  1117
                     +SLKEAISAS+S+GKLVSGAT+    V++               + N  W E
Sbjct  423   RGYGGKPGMSLKEAISASISRGKLVSGATDGTMSVAASDHSAPPPSSSSVSKFVNPFWIE  482

Query  1116  MAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMST  937
             M VL++R+F N +R PE+   RL  V VTGFILAT+FWR+D SPKG+QERLGFFA AMST
Sbjct  483   MGVLTRRAFINTKRTPEVFIIRLAAVLVTGFILATIFWRLDESPKGVQERLGFFAIAMST  542

Query  936   TFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaa  757
              +YTC+D LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP LV+L+  F+ TTF++ 
Sbjct  543   MYYTCSDALPVFLSERYIFLRETAYNAYRRSSYVLSHTIVGFPSLVVLSFAFALTTFFSV  602

Query  756   glgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMN  577
             GL GG  GFF++ AI+LASFWAG+ F TFLS VV HVML + +V++ LAYFLLFSGFF+N
Sbjct  603   GLAGGVNGFFYFVAIVLASFWAGSGFATFLSGVVTHVMLGFPVVLSTLAYFLLFSGFFIN  662

Query  576   RARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLL  397
             R RIP YW+WFHYISL+KYPYEAV+QNEF DPT+CFVRG QMFD+TPL+A+PAA+K ++L
Sbjct  663   RDRIPRYWLWFHYISLVKYPYEAVMQNEFGDPTRCFVRGVQMFDNTPLAALPAAVKVRVL  722

Query  396   TAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGS  217
              +M  +L V I + TC+TTG D L  Q +TD  KW CLWITVAWGFLFRILFY SLLLGS
Sbjct  723   QSMSASLGVNIGTGTCITTGPDFLKQQAITDFGKWECLWITVAWGFLFRILFYISLLLGS  782

Query  216   RNKRR  202
             RNKRR
Sbjct  783   RNKRR  787



>ref|NP_001049746.1| Os03g0281900 [Oryza sativa Japonica Group]
 sp|Q8H8V7.1|AB5G_ORYSJ RecName: Full=ABC transporter G family member 5; Short=ABC transporter 
ABCG.5; Short=OsABCG5; AltName: Full=Protein REDUCED 
CULM NUMBER 1; AltName: Full=White-brown complex homolog 
protein 5; Short=OsWBC5 [Oryza sativa Japonica Group]
 gb|AAN64474.1| putative ATP-binding-cassette transporter protein [Oryza sativa 
Japonica Group]
 gb|ABF95316.1| ABC transporter family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11660.1| Os03g0281900 [Oryza sativa Japonica Group]
 gb|EAZ26487.1| hypothetical protein OsJ_10379 [Oryza sativa Japonica Group]
Length=787

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/485 (63%), Positives = 368/485 (76%), Gaps = 14/485 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL+ IAQSGS+V++SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  303   LFLDEPTSGLDSTSAFMVVTVLKAIAQSGSVVVMSIHQPSYRILGLLDRLLFLSRGKTVY  362

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G P  LP F  DFG  +P+ +N  EFALDLI+E+E   EGTK L E +  W    + E 
Sbjct  363   YGPPSELPPFFLDFGKPIPDNENPTEFALDLIKEMETETEGTKRLAEHNAAWQLKHHGEG  422

Query  1254  AT--AVHNLSLKEAISASVSQGKLVSGATNDANPVSSVP------------AYANSLWTE  1117
                     +SLKEAISAS+S+GKLVSGAT+    V++               + N  W E
Sbjct  423   RGYGGKPGMSLKEAISASISRGKLVSGATDGTVSVAASDHSAPPPSSSSVSKFVNPFWIE  482

Query  1116  MAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMST  937
             M VL++R+F N +R PE+   RL  V VTGFILAT+FWR+D SPKG+QERLGFFA AMST
Sbjct  483   MGVLTRRAFINTKRTPEVFIIRLAAVLVTGFILATIFWRLDESPKGVQERLGFFAIAMST  542

Query  936   TFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaa  757
              +YTC+D LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP LV+L+  F+ TTF++ 
Sbjct  543   MYYTCSDALPVFLSERYIFLRETAYNAYRRSSYVLSHTIVGFPSLVVLSFAFALTTFFSV  602

Query  756   glgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMN  577
             GL GG  GFF++ AI+LASFWAG+ F TFLS VV HVML + +V++ LAYFLLFSGFF+N
Sbjct  603   GLAGGVNGFFYFVAIVLASFWAGSGFATFLSGVVTHVMLGFPVVLSTLAYFLLFSGFFIN  662

Query  576   RARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLL  397
             R RIP YW+WFHYISL+KYPYEAV+QNEF DPT+CFVRG QMFD+TPL+A+PAA+K ++L
Sbjct  663   RDRIPRYWLWFHYISLVKYPYEAVMQNEFGDPTRCFVRGVQMFDNTPLAALPAAVKVRVL  722

Query  396   TAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGS  217
              +M  +L V I + TC+TTG D L  Q +TD  KW CLWITVAWGFLFRILFY SLLLGS
Sbjct  723   QSMSASLGVNIGTGTCITTGPDFLKQQAITDFGKWECLWITVAWGFLFRILFYISLLLGS  782

Query  216   RNKRR  202
             RNKRR
Sbjct  783   RNKRR  787



>gb|EAZ26488.1| hypothetical protein OsJ_10380 [Oryza sativa Japonica Group]
Length=621

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/489 (61%), Positives = 367/489 (75%), Gaps = 18/489 (4%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQ IA+SGS+VI+SIHQPS RI+GL+DRL+ LSRG TVY
Sbjct  133   LFLDEPTSGLDSTSAFMVVKVLQGIAKSGSVVIMSIHQPSYRIIGLIDRLMFLSRGRTVY  192

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW-----SGG  1270
              G P +LP F S+FGH +P+G N VEFALD +R+LE  PEGT  LVEFS+ W     +  
Sbjct  193   YGPPASLPLFFSEFGHPIPDGQNPVEFALDHVRQLEAIPEGTDELVEFSKAWREKALARA  252

Query  1269  RNSEPATAVHN---LSLKEAISASVSQGKLVSGATNDANP---------VSSVPAYANSL  1126
              +S   T  H+   L LKEAI  S+++GKLVSGAT               + V  YAN  
Sbjct  253   VSSAACTGRHDKPSLPLKEAIRMSIARGKLVSGATTSTGDNGTAAAAASTAKVATYANPW  312

Query  1125  WTEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFA  946
             W E+ VL++R+FTN RR PE+   RL  V VT FILAT+FWR+DN+PKG+ ER GFFA A
Sbjct  313   WAEVWVLARRAFTNTRRTPELFLIRLATVVVTAFILATVFWRLDNTPKGVNERFGFFAIA  372

Query  945   MSTTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattf  766
             +ST FYT AD LPVF+ ERYI+LRETAHNAYRRSSY +S+A+V+FP LV L+L F+A TF
Sbjct  373   VSTMFYTSADALPVFLVERYIYLRETAHNAYRRSSYTVSNAIVAFPPLVALSLAFTAITF  432

Query  765   waaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGF  586
             +A GL GG  GF F+  I+LASFWAG+ FVTFLS VVPHV++ Y +VVA LAYFLL SGF
Sbjct  433   FAVGLAGGAGGFLFFALIVLASFWAGSGFVTFLSGVVPHVIIGYTVVVAGLAYFLLLSGF  492

Query  585   FMNRARIPLYWIWFHYISLIKYPYEAVLQNEF-EDPTKCFVRGTQMFDDTPLSAVPAALK  409
             F+ R RIP YWIW HY+SLIKYPYEAV+QNEF  +  +CF+RG QMFD TP++ +P   K
Sbjct  493   FITRDRIPSYWIWLHYLSLIKYPYEAVMQNEFGAEAGRCFMRGVQMFDGTPMARLPVETK  552

Query  408   EKLLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSL  229
              ++L AM  ++ + + S +C+TTG DILA Q VT+L KW+CLW+TVAWGFLFR LFY +L
Sbjct  553   VRVLEAMSRSMGLELNSGSCITTGPDILARQAVTELGKWSCLWVTVAWGFLFRALFYLTL  612

Query  228   LLGSRNKRR  202
             +LGSRN+RR
Sbjct  613   VLGSRNRRR  621



>gb|EMS46278.1| ABC transporter G family member 16 [Triticum urartu]
Length=747

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/491 (64%), Positives = 376/491 (77%), Gaps = 26/491 (5%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGS+V++SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  263   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSVVVMSIHQPSYRILGLLDRLLFLSRGQTVY  322

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW--------  1279
              G P +L  F SDFG  + + +N  EFALDL+RELE  P G   LVE ++ W        
Sbjct  323   YGPPGSLSSFFSDFGKPIHDNENPTEFALDLVRELETMPNGACDLVEHNKSWQKRMGPKM  382

Query  1278  ---SGGRNSEPATAVHNLSLKEAISASVSQGKLVSGATNDAN---------PVSSVPAYA  1135
                  G   +P+     LSL+EAISAS+S+GKLVSGAT D N         P S+V  +A
Sbjct  383   KHADDGNGGKPS-----LSLQEAISASISRGKLVSGAT-DGNVTVPSPSSAPASAVAKFA  436

Query  1134  NSLWTEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFF  955
             N  W EM VL++R+F N +R PEI   RLG V +TGFILAT+FWR+D+SPKG++ERLGFF
Sbjct  437   NPFWIEMGVLTRRAFLNTKRTPEIFVIRLGAVLITGFILATIFWRLDDSPKGVEERLGFF  496

Query  954   AFAMSTTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSa  775
             A AMST FYTC+D LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP L++L+L F+ 
Sbjct  497   AIAMSTMFYTCSDALPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFPSLIVLSLAFAV  556

Query  774   ttfwaaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLF  595
             TTF+A GL GG  GFFF+ AI+LASFWAG+ F TFLS VV +V L + +VV+ LAYFLLF
Sbjct  557   TTFFAVGLAGGAEGFFFFVAIVLASFWAGSGFATFLSGVVTNVQLGFPVVVSTLAYFLLF  616

Query  594   SGFFMNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAA  415
             SGFF+NR RIP YW+WFHY SL+KYPYEAV+ NEF DP +CFVRG QMFD+TPLS +P A
Sbjct  617   SGFFINRDRIPKYWLWFHYASLVKYPYEAVMINEFSDPGRCFVRGVQMFDNTPLSVLPPA  676

Query  414   LKEKLLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYF  235
             +K ++L AM  +L + I ++TC+TTG D L  Q VTDL+KW+CLWITVAWGFLFRILFY 
Sbjct  677   IKVRVLRAMSSSLGINIGTATCITTGPDFLKQQAVTDLTKWDCLWITVAWGFLFRILFYI  736

Query  234   SLLLGSRNKRR  202
             SLLLGSRNKRR
Sbjct  737   SLLLGSRNKRR  747



>ref|XP_006649877.1| PREDICTED: ABC transporter G family member 6-like [Oryza brachyantha]
Length=760

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/488 (61%), Positives = 363/488 (74%), Gaps = 22/488 (5%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQ IAQSGS+VI+SIHQPS RI+GLLDRL+ LSRG TVY
Sbjct  278   LFLDEPTSGLDSTSAFMVVKVLQGIAQSGSVVIMSIHQPSYRIIGLLDRLLFLSRGRTVY  337

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG------  1273
              G P  LP F SDFGH +P+G N  EFALD +R+LE SP+G   LVEFS  W        
Sbjct  338   YGPPAGLPLFFSDFGHPIPDGQNPAEFALDHVRQLESSPKGADELVEFSNSWQKKPVARA  397

Query  1272  -------GRNSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSS---VPAYANSLW  1123
                    G + +P     +L LKEAI  S+++GKLVSG ++     +S   V  YAN  W
Sbjct  398   VSAAARTGHHDKP-----SLPLKEAIRMSIARGKLVSGTSDSGTAAASTAEVATYANPWW  452

Query  1122  TEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAM  943
              E+ VL++R+FTN RR PE+   RLG V VT FILAT+FWR+D++PKG+ ER GFFA A+
Sbjct  453   VEVWVLARRAFTNTRRTPELFLIRLGTVVVTAFILATVFWRLDSTPKGVNERFGFFAIAI  512

Query  942   STTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfw  763
             ST FYT AD LPVF+ ERYI+LRETAHNAYRRSSY LS+A+VSFP LV+L+L F+  TF+
Sbjct  513   STMFYTSADALPVFLIERYIYLRETAHNAYRRSSYVLSNAIVSFPPLVVLSLAFALITFF  572

Query  762   aaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF  583
             A GL GG  GF F+  I+LASFWAG+ FVTFLS VV HV++ Y +VV +LAYFLL SGFF
Sbjct  573   AVGLAGGAGGFLFFVLIVLASFWAGSGFVTFLSGVVRHVIIGYTVVVGLLAYFLLLSGFF  632

Query  582   MNRARIPLYWIWFHYISLIKYPYEAVLQNEF-EDPTKCFVRGTQMFDDTPLSAVPAALKE  406
             + R RIP YW W HY+SLIKYPYEAV+QNEF  +P +CF+RG QMFD TP+ A+PA  K 
Sbjct  633   VTRDRIPSYWTWLHYLSLIKYPYEAVMQNEFGGEPGRCFMRGVQMFDGTPIGALPAETKV  692

Query  405   KLLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLL  226
              +L AM  ++ V   SS+C+TTG DILA Q V +L KW+CLW+TVAWGFLFR LFY +L+
Sbjct  693   SVLNAMSRSMGVDFNSSSCITTGPDILARQAVAELGKWSCLWVTVAWGFLFRALFYLTLV  752

Query  225   LGSRNKRR  202
             +GSRN+RR
Sbjct  753   VGSRNRRR  760



>ref|XP_002456598.1| hypothetical protein SORBIDRAFT_03g039110 [Sorghum bicolor]
 gb|EES01718.1| hypothetical protein SORBIDRAFT_03g039110 [Sorghum bicolor]
Length=745

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/474 (65%), Positives = 368/474 (78%), Gaps = 4/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIVI SIHQPS RI+GLLDRLILLS G TV+
Sbjct  273   LFLDEPTSGLDSTSAFMVVKVLRRIAESGSIVITSIHQPSQRILGLLDRLILLSGGRTVF  332

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G P  LP + ++FG  VP+ +NR EFALDLIRE E SP GTK LV+F R W       P
Sbjct  333   SGPPSALPSYFAEFGFPVPDDENRAEFALDLIREFESSPTGTKPLVDFHRAWQQMHARSP  392

Query  1254  ---ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
                + A   +SLKEAISAS+S+GKLVSG ++ A   +S+  YAN  W EM VL+KRS  N
Sbjct  393   GPVSAAADQMSLKEAISASISRGKLVSG-SDVAGEAASMHTYANPFWVEMKVLTKRSAIN  451

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RRMPE+   RL  V VTG ILAT+F+R+D SPKG QERLGFFAFAMST FYTCAD LPV
Sbjct  452   TRRMPELFLIRLAAVVVTGAILATVFFRLDQSPKGAQERLGFFAFAMSTMFYTCADALPV  511

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+ ERY+FLRETA+ AYRR+SY LS+A+VSFP LV+L+L F+ TTF+A GL GG  GF F
Sbjct  512   FLNERYVFLRETAYGAYRRASYVLSNAIVSFPALVVLSLAFAFTTFFAVGLAGGVPGFAF  571

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y   ILASFWAG+ FVTFLS V+PHVM+ Y +VVAILAYFLLFSGFF+NR RIP YWIWF
Sbjct  572   YTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFFINRDRIPAYWIWF  631

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HY+SLIKYP+E VLQNEF    +CFVRG Q+FD++PL+A+P A+K ++L ++   L V I
Sbjct  632   HYLSLIKYPFEGVLQNEFARSGECFVRGAQIFDNSPLAALPDAVKARVLASISSALGVGI  691

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              + TCV TG  +L    VT L KW CL +T+AWGFLFRILFYFSL+LGS+NKRR
Sbjct  692   GADTCVVTGRGVLHEVAVTQLGKWECLLVTMAWGFLFRILFYFSLVLGSKNKRR  745



>ref|XP_009139198.1| PREDICTED: ABC transporter G family member 18-like [Brassica 
rapa]
Length=699

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/476 (61%), Positives = 369/476 (78%), Gaps = 9/476 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIA+SGS+VI+SIHQPS+RI+ LLDRLI+LSRG++V+
Sbjct  226   LFLDEPTSGLDSTNAFMVVQVLKRIARSGSMVIMSIHQPSARIIDLLDRLIILSRGKSVF  285

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP +LPQFLSDFGH VP  +N  EFALDL+RELEGS +GT+ LVEF+ +W   +N  P
Sbjct  286   SGSPTSLPQFLSDFGHPVPGKENITEFALDLVRELEGSTKGTEELVEFNEKWQ--QNQSP  343

Query  1254  -----ATAVHNLSLKEAISASVSQGKLVSGATNDANPVS-SVPAYANSLWTEMAVLSKRS  1093
                   T    LSLKE+I+ SVS+GKLVSG+T+ +NP+S    +YAN+   E  +LSKR 
Sbjct  344   RATPMTTPYKALSLKESITTSVSRGKLVSGSTS-SNPISMETVSYANTPLVETYILSKRY  402

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
               N  R PE++ TRL  V VTG ILAT++WR+DN+P+G QER+ FF+FAMST FYTCAD 
Sbjct  403   MKNWSRTPELIITRLATVLVTGLILATIYWRLDNTPRGAQERIAFFSFAMSTMFYTCADN  462

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVFI ERYIFLRET HNAYR  SY +SH LVS P L+ L++ F+ TTFW  GL GG   
Sbjct  463   LPVFIHERYIFLRETTHNAYRTYSYVISHVLVSLPQLLALSIAFAVTTFWTVGLSGGLES  522

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F +Y  II A+FW+G+SFVTF+S ++P+VM+++++ ++ L+Y LL  GFF+NR RIP YW
Sbjct  523   FLYYCLIIYAAFWSGSSFVTFISGLIPNVMISFMVTISYLSYCLLMGGFFINRDRIPGYW  582

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHYISL+KYPYEAVL NEF+DP++CFVRG Q+FD T  + VP A+K K+   +G +L 
Sbjct  583   IWFHYISLMKYPYEAVLINEFDDPSRCFVRGVQVFDGTLFAKVPDAIKVKMFDTLGNSLG  642

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              +I  STC+ TG D+L  QG++ LSKW+CLWIT AWG  FRILFY SLL G++NKR
Sbjct  643   TKIKESTCLRTGPDLLLQQGISQLSKWDCLWITFAWGIFFRILFYLSLLFGNKNKR  698



>emb|CDM84867.1| unnamed protein product [Triticum aestivum]
Length=757

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/473 (65%), Positives = 366/473 (77%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIAQSGSIVI SIHQPS RI+GLLDRLILLS G TV+
Sbjct  285   LFLDEPTSGLDSTSAFMVVKVLRRIAQSGSIVITSIHQPSQRILGLLDRLILLSGGHTVF  344

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS--GGRNS  1261
             +G+P  LP + ++FG+ VP+ +NR EFALDLIRELE SP GTK L +F R W        
Sbjct  345   SGAPSALPTYFAEFGYPVPDDENRAEFALDLIRELEASPTGTKPLADFHRTWKLMHAARD  404

Query  1260  EPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
             + A     +SLKEAISAS+S+GKLVSGA       +S+  YAN  W EM VL+KRS  N 
Sbjct  405   DAAAWAPTMSLKEAISASISRGKLVSGADVSTGEAASMHTYANPFWVEMKVLTKRSAINT  464

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
             RRMPE+   RLG V VTG ILAT+F+++D SPKG QERLGFFAFAMST FYTCAD LPVF
Sbjct  465   RRMPELFLIRLGAVVVTGAILATVFFKLDQSPKGAQERLGFFAFAMSTMFYTCADALPVF  524

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QERY+FLRETA+ AYR  SY LS+A+VSFP LV+L+L F+ TTF+A GL GG +GF FY
Sbjct  525   LQERYVFLRETAYGAYRHVSYVLSNAIVSFPPLVVLSLAFALTTFFAVGLAGGASGFAFY  584

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
                ILASFWAG+ FVTFLS V+PHVM+ Y +VVAILAYFLLFSGFF+NR RIP YW+WFH
Sbjct  585   TLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFFINRDRIPAYWLWFH  644

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYP+E VLQNEF    +CFVRG Q+FD++PL A+P A+KE++L ++   L V I 
Sbjct  645   YLSLVKYPFEGVLQNEFARGGECFVRGAQIFDNSPLGALPEAVKERVLASISSALGVGIG  704

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             + TCV TG  +L    VT L KW CL +T AWGF FRILFYFSL+LGS+NKRR
Sbjct  705   ADTCVATGRSVLRQAAVTQLGKWECLLVTAAWGFFFRILFYFSLVLGSKNKRR  757



>ref|XP_007027150.1| ABC transporter G family member 2 [Theobroma cacao]
 gb|EOY07652.1| ABC transporter G family member 2 [Theobroma cacao]
Length=686

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/475 (61%), Positives = 364/475 (77%), Gaps = 4/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+SIHQPSSRI+GLLDRLI+LS G+ +Y
Sbjct  212   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSIHQPSSRILGLLDRLIILSHGQALY  271

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG--GRNS  1261
             + SP NL QF SDFGH +PE +N  EFALD IRELEG+P GT++LVEF++ W      N 
Sbjct  272   SSSPANLSQFFSDFGHPIPEKENPSEFALDFIRELEGAPSGTQNLVEFNKSWQTLTNVND  331

Query  1260  EPATAVHNLSLKEAISASVSQGKLVSGA--TNDANPVSSVPAYANSLWTEMAVLSKRSFT  1087
               A+   +L+LK+AIS S+S+GKLVSGA  T+D +  SSVP++AN  W E+ VLS+R  T
Sbjct  332   NIASNRPSLALKDAISRSISRGKLVSGAIATSDLDHSSSVPSFANPFWIEVLVLSRRLLT  391

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RRMP   G RLG + VTG +LATMFW++D+SP G+QERLG  A +++  F+ C   +P
Sbjct  392   NSRRMPAKFGVRLGTIMVTGIVLATMFWQLDDSPSGVQERLGCIAISIAAIFFNCITEVP  451

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
              FIQERYIF+RETA+NAYRRSSY L+ +L+  P+L IL+L FS  TFWA GL GG +GF 
Sbjct  452   TFIQERYIFMRETAYNAYRRSSYVLARSLIHIPLLFILSLFFSIITFWAVGLAGGLSGFL  511

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             F++   LASFWAG+SF  FLS +VP V LA+++ +AI++YFL   GF ++R RIP YWIW
Sbjct  512   FFFFTTLASFWAGSSFAAFLSGLVPDVFLAFVIGIAIVSYFLFLCGFLVSRDRIPKYWIW  571

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
              HY SL+KYPYEA+LQNEF DPTKCF RG Q+FD + L  +P + K  LL++MG  L   
Sbjct  572   LHYTSLVKYPYEALLQNEFLDPTKCFARGVQLFDQSALGTLPTSTKNDLLSSMGNVLGRN  631

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             ITSSTC+TTG DIL  QG+T LSKWN +WI +AWGF FRILFY +LL GS++KR+
Sbjct  632   ITSSTCLTTGKDILMQQGITKLSKWNRVWIIIAWGFFFRILFYLTLLFGSKSKRK  686



>ref|XP_004987055.1| PREDICTED: ABC transporter G family member 16-like [Setaria italica]
Length=758

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/486 (63%), Positives = 367/486 (76%), Gaps = 15/486 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQ IAQSGS+VI+SIHQPS RI+GLLDRL+ LSRG TVY
Sbjct  273   LFLDEPTSGLDSTSAFMVVKVLQHIAQSGSVVIMSIHQPSYRILGLLDRLLFLSRGRTVY  332

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G P  LP F  +FGH +P+G+N  EFALD IRELEG+P GTK LVEFS+ W     S  
Sbjct  333   YGPPAGLPPFFLEFGHPIPDGENPAEFALDTIRELEGTPNGTKELVEFSKSWQEKPLSRT  392

Query  1254  ATAVHN-------LSLKEAISASVSQGKLVSGATNDANPVS-------SVPAYANSLWTE  1117
              +A  +       L+LKEAI  S+++GKLVSG +      S        V  YAN  W E
Sbjct  393   ISAASSGPEHKPSLTLKEAIGLSIARGKLVSGTSPGGGGGSSTSASTAKVATYANPWWVE  452

Query  1116  MAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMST  937
             + VL++R+FTN RR PE+   RLG V+VT FILAT+FWR+DN+PKG+ ER GFFA  MST
Sbjct  453   VWVLTRRAFTNTRRTPELFLIRLGTVTVTAFILATVFWRLDNTPKGVNERFGFFAIGMST  512

Query  936   TFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaa  757
              FYT AD LPVF+ ERYIFLRETAHNAYRRSSY LS+A+V+ P LV+L+L F+  TF+A 
Sbjct  513   MFYTSADALPVFLVERYIFLRETAHNAYRRSSYTLSNAIVALPPLVLLSLAFAGITFFAV  572

Query  756   glgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMN  577
             GL GG  GF F+  I+LASFWAG+ FVTFLS VVPHV++ Y +VVA+LAYFLLFSGFF+ 
Sbjct  573   GLAGGAQGFAFFALIVLASFWAGSGFVTFLSAVVPHVIIGYTVVVAVLAYFLLFSGFFVT  632

Query  576   RARIPLYWIWFHYISLIKYPYEAVLQNEF-EDPTKCFVRGTQMFDDTPLSAVPAALKEKL  400
             R RIP YWIWFHY+SLIKYPY+AV+QNEF  DP +CF+RG QMFD TP+  +P A K  +
Sbjct  633   RDRIPSYWIWFHYLSLIKYPYQAVMQNEFGADPGRCFMRGVQMFDGTPMGRLPEATKVNV  692

Query  399   LTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLG  220
             L AM  ++ V   SS+C+T G D+LA Q VTDL KW CLWITVAWGF+FR+LFY +LLLG
Sbjct  693   LNAMSRSMRVDFNSSSCITAGPDVLAKQAVTDLGKWACLWITVAWGFVFRVLFYLTLLLG  752

Query  219   SRNKRR  202
             SRNKRR
Sbjct  753   SRNKRR  758



>ref|XP_010504358.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
19-like [Camelina sativa]
Length=731

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/480 (62%), Positives = 370/480 (77%), Gaps = 11/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI+SIHQPS+RIV LLDRLI+LSRG++V+
Sbjct  252   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVF  311

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP F SDFG  +PE +N  EFALDL+RELEGS EGT+SLV+F+ +W   + S  
Sbjct  312   NGSPASLPGFFSDFGRPIPEKENITEFALDLVRELEGSTEGTRSLVDFNEKWQQNKLSFS  371

Query  1254  ATAVHN--------LSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVL  1105
              +A H         L+LKEAI+ASVS+GKLVSG T+ AN VS  +V +YAN    E  +L
Sbjct  372   QSAPHTNMFELDSPLTLKEAINASVSRGKLVSG-TSRANLVSMETVSSYANPSLFETFIL  430

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             +KR   N  RMPE++GTR+  V VTGF+LAT++W++D++P+G QERL  FAF + T FY 
Sbjct  431   AKRYMKNWMRMPELVGTRIATVMVTGFLLATVYWKLDHTPRGAQERLTLFAFVVPTMFYC  490

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             C D +PVFIQERYIFLRET HN YR SSY +SH+LVS P L+  +LVFS  TFW  GL G
Sbjct  491   CLDNVPVFIQERYIFLRETTHNTYRTSSYVISHSLVSLPQLIAPSLVFSTITFWTVGLSG  550

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
                GF+FY  +I ASFW+G+S VTF+S VVP++ML+Y++ ++ LAY LL SGF++NR RI
Sbjct  551   XLEGFYFYCLLIYASFWSGSSVVTFISGVVPNIMLSYMVAISYLAYCLLLSGFYVNRDRI  610

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             P+YW WFHYISL+KYPYEAVL NEF+DP++CFV+G Q+FD T L  V  + K KLL  +G
Sbjct  611   PVYWTWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDSTLLGGVSDSGKVKLLETLG  670

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              +L  RIT STC+ TG+D+LA QG+T+LSKW CLWIT A G  FRILFYF+LL GSRNKR
Sbjct  671   NSLKTRITESTCLRTGSDLLAQQGITELSKWECLWITFASGLFFRILFYFALLFGSRNKR  730



>gb|AAN64479.1| putative ATP-binding-cassette transporter protein [Oryza sativa 
Japonica Group]
 gb|ABF95318.1| ABC transporter family protein, putative [Oryza sativa Japonica 
Group]
Length=765

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/489 (61%), Positives = 367/489 (75%), Gaps = 18/489 (4%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQ IA+SGS+VI+SIHQPS RI+GL+DRL+ LSRG TVY
Sbjct  277   LFLDEPTSGLDSTSAFMVVKVLQGIAKSGSVVIMSIHQPSYRIIGLIDRLMFLSRGRTVY  336

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW-----SGG  1270
              G P +LP F S+FGH +P+G N VEFALD +R+LE  PEGT  LVEFS+ W     +  
Sbjct  337   YGPPASLPLFFSEFGHPIPDGQNPVEFALDHVRQLEAIPEGTDELVEFSKAWREKALARA  396

Query  1269  RNSEPATAVHN---LSLKEAISASVSQGKLVSGATNDANP---------VSSVPAYANSL  1126
              +S   T  H+   L LKEAI  S+++GKLVSGAT               + V  YAN  
Sbjct  397   VSSAACTGRHDKPSLPLKEAIRMSIARGKLVSGATTSTGDNGTAAAAASTAKVATYANPW  456

Query  1125  WTEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFA  946
             W E+ VL++R+FTN RR PE+   RL  V VT FILAT+FWR+DN+PKG+ ER GFFA A
Sbjct  457   WAEVWVLARRAFTNTRRTPELFLIRLATVVVTAFILATVFWRLDNTPKGVNERFGFFAIA  516

Query  945   MSTTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattf  766
             +ST FYT AD LPVF+ ERYI+LRETAHNAYRRSSY +S+A+V+FP LV L+L F+A TF
Sbjct  517   VSTMFYTSADALPVFLVERYIYLRETAHNAYRRSSYTVSNAIVAFPPLVALSLAFTAITF  576

Query  765   waaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGF  586
             +A GL GG  GF F+  I+LASFWAG+ FVTFLS VVPHV++ Y +VVA LAYFLL SGF
Sbjct  577   FAVGLAGGAGGFLFFALIVLASFWAGSGFVTFLSGVVPHVIIGYTVVVAGLAYFLLLSGF  636

Query  585   FMNRARIPLYWIWFHYISLIKYPYEAVLQNEF-EDPTKCFVRGTQMFDDTPLSAVPAALK  409
             F+ R RIP YWIW HY+SLIKYPYEAV+QNEF  +  +CF+RG QMFD TP++ +P   K
Sbjct  637   FITRDRIPSYWIWLHYLSLIKYPYEAVMQNEFGAEAGRCFMRGVQMFDGTPMARLPVETK  696

Query  408   EKLLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSL  229
              ++L AM  ++ + + S +C+TTG DILA Q VT+L KW+CLW+TVAWGFLFR LFY +L
Sbjct  697   VRVLEAMSRSMGLELNSGSCITTGPDILARQAVTELGKWSCLWVTVAWGFLFRALFYLTL  756

Query  228   LLGSRNKRR  202
             +LGSRN+RR
Sbjct  757   VLGSRNRRR  765



>gb|EAY89510.1| hypothetical protein OsI_11045 [Oryza sativa Indica Group]
Length=765

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/489 (61%), Positives = 367/489 (75%), Gaps = 18/489 (4%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQ IA+SGS+VI+SIHQPS RI+GL+DRL+ LSRG TVY
Sbjct  277   LFLDEPTSGLDSTSAFMVVKVLQGIAKSGSVVIMSIHQPSYRIIGLIDRLMFLSRGRTVY  336

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW-----SGG  1270
              G P +LP F S+FGH +P+G N VEFALD +R+LE  PEGT  LVEFS+ W     +  
Sbjct  337   YGPPASLPLFFSEFGHPIPDGQNPVEFALDHVRQLEAIPEGTDELVEFSKAWREKALARA  396

Query  1269  RNSEPATAVHN---LSLKEAISASVSQGKLVSGATNDANP---------VSSVPAYANSL  1126
              +S   T  H+   L LKEAI  S+++GKLVSGAT               + V  YAN  
Sbjct  397   VSSAACTGRHDKPSLPLKEAIRMSIARGKLVSGATTSTGDNGTAAAAASTAKVATYANPW  456

Query  1125  WTEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFA  946
             W E+ VL++R+FTN RR PE+   RL  V VT FILAT+FWR+DN+PKG+ ER GFFA A
Sbjct  457   WAEVWVLARRAFTNTRRTPELFLIRLATVVVTAFILATVFWRLDNTPKGVNERFGFFAIA  516

Query  945   MSTTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattf  766
             +ST FYT AD LPVF+ ERYI+LRETAHNAYRRSSY +S+A+V+FP LV L+L F+A TF
Sbjct  517   VSTMFYTSADALPVFLVERYIYLRETAHNAYRRSSYTVSNAIVAFPPLVALSLAFTAITF  576

Query  765   waaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGF  586
             +A GL GG  GF F+  I+LASFWAG+ FVTFLS VVPHV++ Y +VVA LAYFLL SGF
Sbjct  577   FAVGLAGGAGGFLFFALIVLASFWAGSGFVTFLSGVVPHVIIGYTVVVAGLAYFLLLSGF  636

Query  585   FMNRARIPLYWIWFHYISLIKYPYEAVLQNEF-EDPTKCFVRGTQMFDDTPLSAVPAALK  409
             F+ R RIP YWIW HY+SLIKYPYEAV+QNEF  +  +CF+RG QMFD TP++ +P   K
Sbjct  637   FITRDRIPSYWIWLHYLSLIKYPYEAVMQNEFGAEAGRCFMRGVQMFDGTPMARLPVETK  696

Query  408   EKLLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSL  229
              ++L AM  ++ + + S +C+TTG DILA Q VT+L KW+CLW+TVAWGFLFR LFY +L
Sbjct  697   VRVLEAMSRSMGLELNSGSCITTGPDILARQAVTELGKWSCLWVTVAWGFLFRALFYLTL  756

Query  228   LLGSRNKRR  202
             +LGSRN+RR
Sbjct  757   VLGSRNRRR  765



>ref|XP_006292173.1| hypothetical protein CARUB_v10018379mg [Capsella rubella]
 gb|EOA25071.1| hypothetical protein CARUB_v10018379mg [Capsella rubella]
Length=725

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/479 (62%), Positives = 370/479 (77%), Gaps = 9/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI+SIHQPS+RIV LLDRLI+LSRG++V+
Sbjct  246   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVF  305

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNS--  1261
              GSP +LP F SDFG  +PE +N  EF LDL+RELEGS EGT+SLVEF+ +W   + S  
Sbjct  306   NGSPASLPGFFSDFGRPIPEKENITEFTLDLVRELEGSTEGTRSLVEFNEKWQRNKLSLS  365

Query  1260  --EPATAV----HNLSLKEAISASVSQGKLVSGATN-DANPVSSVPAYANSLWTEMAVLS  1102
                P T +    H L+LKEAI+ SVS+GKLVSG++  +   + +V +YAN    E  +L+
Sbjct  366   QCAPQTNMLELDHTLTLKEAINVSVSRGKLVSGSSRANLTSMETVSSYANPSLFETFILA  425

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
             KR   N  RMPE++GTR+  V VTGF+LAT++W++D+SP+G QERL  FAF + T FY C
Sbjct  426   KRYMKNWMRMPELVGTRIATVMVTGFLLATVYWKLDHSPRGAQERLTLFAFVVPTMFYCC  485

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
              D +PVFIQERYIFLRET HNAYR SSY +SH+LVS P L+  +LVFSA TFW  GL GG
Sbjct  486   LDNVPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLLAPSLVFSAITFWTVGLSGG  545

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
               GFFFY  II ASFW+G+S VTF+S VVP++ML+Y++ ++ LAY LL SGF++NR RIP
Sbjct  546   LEGFFFYCLIIYASFWSGSSVVTFISGVVPNIMLSYMVAISYLAYCLLLSGFYVNRDRIP  605

Query  561   LYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
             +YW WFHYISL+KYPYEAVL NEF+DP++CFV+G Q+FD T L  V  + K KLL  +G+
Sbjct  606   IYWTWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDSTLLGGVSESGKVKLLETLGK  665

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             +L  RIT STC+ TG+D L  QG+T+LSKW CLWIT A G  FRILFYF+LLLGSRNKR
Sbjct  666   SLQTRITESTCLRTGSDFLEQQGITELSKWECLWITFASGLFFRILFYFALLLGSRNKR  724



>ref|XP_006644973.1| PREDICTED: ABC transporter G family member 16-like [Oryza brachyantha]
Length=603

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/475 (64%), Positives = 369/475 (78%), Gaps = 5/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VL+ IA SGSIVI SIHQPS RI+ LLDRLILLS G TV+
Sbjct  130   LFLDEPTSGLDSTSAFMVVQVLRSIAASGSIVITSIHQPSHRILVLLDRLILLSGGRTVF  189

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS--GGRNS  1261
             +G P  +P + ++FG+ VP+ +NR EFALDLIRE E SP GT  LV F+++W        
Sbjct  190   SGPPSAIPAYFAEFGYPVPDDENRAEFALDLIREFESSPTGTTPLVHFNQKWQLMHAARH  249

Query  1260  EPATA--VHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFT  1087
              PA A     +SLKEAI+ S+S+GKLVSG ++ A   +S+  YAN  W EM VL+KRS  
Sbjct  250   YPADAPWEPTMSLKEAITTSISRGKLVSG-SDVAGEAASMHTYANPFWVEMKVLTKRSAI  308

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RRMPE+   RLG V +TG ILAT+F+++D SPKG QERLGFFAFAMST FYTCAD LP
Sbjct  309   NTRRMPELFLIRLGAVVITGAILATVFYKLDQSPKGAQERLGFFAFAMSTMFYTCADALP  368

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+QERYIFLRETA+ AYRR+SY LS+A+VSFP LV+L+L F+ TTF+A GL GG +GF 
Sbjct  369   VFLQERYIFLRETAYGAYRRTSYVLSNAIVSFPPLVVLSLAFAFTTFFAVGLAGGVSGFT  428

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             FY   ILASFWAG+ FVTFLS V+PHVM+ Y +VVA+LAYFLLFSGFF+NR RIP YWIW
Sbjct  429   FYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAVLAYFLLFSGFFINRDRIPQYWIW  488

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FHY+SL+KYP+E VLQNEF    +CFVRGTQMFD++PL+ +P A+K ++L ++G  L V+
Sbjct  489   FHYLSLVKYPFEGVLQNEFARGGECFVRGTQMFDNSPLAMMPDAVKTRVLASIGSALGVK  548

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             I  +TCV TG ++L    VT L KW CL +T AWGF FR+LFYFSL+LGS+NKRR
Sbjct  549   IGPNTCVMTGHNVLREAAVTQLGKWECLLVTAAWGFFFRLLFYFSLVLGSKNKRR  603



>ref|XP_006403491.1| hypothetical protein EUTSA_v10010159mg [Eutrema salsugineum]
 gb|ESQ44944.1| hypothetical protein EUTSA_v10010159mg [Eutrema salsugineum]
Length=716

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/476 (60%), Positives = 366/476 (77%), Gaps = 6/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIA+SGSIVI+SIHQPSSRIV LLDRLI+LSRG++V+
Sbjct  240   LFLDEPTSGLDSTNAFMVVQVLKRIAKSGSIVIMSIHQPSSRIVDLLDRLIILSRGKSVF  299

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG---GRN  1264
              GSP  LP F SDFG  +PE +N  EFALDLIR+LEG+ +GT+ LVEF+ +W      R 
Sbjct  300   NGSPAKLPSFFSDFGFPIPEKENTTEFALDLIRQLEGTSQGTRELVEFNEKWQHNQPARA  359

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVS---SVPAYANSLWTEMAVLSKRS  1093
             +   T    LSLKE+I+ASVS+GKLVSG+++  N +    SV +YAN    E  +L+KR 
Sbjct  360   TPQTTPYQALSLKESINASVSRGKLVSGSSSGTNLIPMELSVSSYANPPLIETFILAKRY  419

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
               N  R PE++GTR+  V VTG +LAT++WR+DN+P+G QER+GFFAF MST FY CAD 
Sbjct  420   VKNWIRTPELIGTRIATVMVTGLLLATIYWRLDNTPRGAQERMGFFAFGMSTMFYVCADN  479

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             +PVFIQERY+FLRET HNAYR SSY +SH+LVS P L+ L++ F+ATTFW  GL GG   
Sbjct  480   IPVFIQERYVFLRETTHNAYRTSSYVISHSLVSLPQLLALSIAFAATTFWTVGLSGGLNS  539

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F +Y  II ASFW G+S V+F+S +VP+VM++Y++ +A L+Y +L  GF++NR RIP YW
Sbjct  540   FLYYCLIIYASFWCGSSVVSFISGLVPNVMISYMITIAYLSYCVLLGGFYINRDRIPFYW  599

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHYIS++KYPYEA L NEF+DP++CFV G Q+FD T L+ V   +K KLL  + ++L 
Sbjct  600   IWFHYISVLKYPYEAGLINEFDDPSRCFVEGGQVFDGTLLAGVSDVMKVKLLDTLSKSLG  659

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              +IT +TC+ TG+D+L  QG+T LSKW+CLWIT AWG  FRILFYFSLL G++NKR
Sbjct  660   TKITETTCLRTGSDLLMQQGITQLSKWDCLWITFAWGLFFRILFYFSLLFGNKNKR  715



>gb|EEE62138.1| hypothetical protein OsJ_16925 [Oryza sativa Japonica Group]
Length=699

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/476 (63%), Positives = 369/476 (78%), Gaps = 5/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+RIAQSGS+VI++IHQPS+RI+ +LDRL+LLSRG TVY
Sbjct  224   LFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSARILNILDRLLLLSRGRTVY  283

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G+PV L  F S+FG  +P+ +N  EFALD IRELE  P+G   L +F+ +W     + P
Sbjct  284   AGTPVGLKPFFSEFGDPIPDNENPAEFALDTIRELEHQPDGAAPLADFNVKWQSMHAALP  343

Query  1254  ATAVHN-----LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSF  1090
             A    +     + L+ AI+ SVS+GKLV+G+ +     +SVP +AN L  E+ VL KRSF
Sbjct  344   AADSKDSKRCTMPLELAITESVSRGKLVAGSGSGTASSTSVPTFANPLSVEVWVLMKRSF  403

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN  RMPE+   RLG + VTGFILAT+FWR+D++PKG+QERLGFFA AMST FY CAD L
Sbjct  404   TNTGRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGVQERLGFFAMAMSTMFYVCADAL  463

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QER+I+LRETAHNAYRR SY  ++A+V+FP LV L+L F+ TTF+A GL GG   F
Sbjct  464   PVFVQERHIYLRETAHNAYRRLSYVFANAVVAFPPLVFLSLAFAVTTFFAVGLAGGGGSF  523

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              F+  IILASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  524   LFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPSYWI  583

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPY+AVLQNEF D T+CF RG +MFD TP+ A+  A+K K+L A+ +TL  
Sbjct  584   WFHYLSLVKYPYQAVLQNEFRDATRCFSRGVEMFDGTPIGAMSRAVKLKVLDAISKTLGT  643

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              +T++TCVTTGAD+LA Q VTD+ KW CL +TVAWGF FR LFY  LL+GS+NKRR
Sbjct  644   NMTANTCVTTGADVLAQQAVTDIGKWKCLLVTVAWGFFFRALFYVVLLVGSKNKRR  699



>ref|XP_004970499.1| PREDICTED: ABC transporter G family member 16-like [Setaria italica]
Length=755

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/476 (65%), Positives = 369/476 (78%), Gaps = 8/476 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIVI SIHQPS RI+GLLDRLILLS G TV+
Sbjct  283   LFLDEPTSGLDSTSAFMVVKVLRRIAESGSIVITSIHQPSQRILGLLDRLILLSGGRTVF  342

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +G P  LP + ++FG  VP+ +NR EFALDLIRE E SP GTK LV+F R W   R   P
Sbjct  343   SGPPSALPSYFAEFGFPVPDDENRAEFALDLIREFESSPTGTKPLVDFHRTWQ--RTHAP  400

Query  1254  ATAV-----HNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSF  1090
             +  +      ++SLKEAISAS+S+GKLVSG ++ A   +SV  YAN  W EM VL++RS 
Sbjct  401   SPGLPGADPSSMSLKEAISASISRGKLVSG-SDVAGEAASVRTYANPFWVEMKVLTRRSA  459

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N RRMPE+   RLG V VTG ILAT+F+R+D SPKG QERLGFFAFAMST FYTCAD L
Sbjct  460   INTRRMPELFLIRLGAVVVTGAILATVFFRLDQSPKGAQERLGFFAFAMSTMFYTCADAL  519

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QERY+FLRETA+ AYRR+SY LS+++VSFP LV+L+L F+ TTF+A GL GG  GF
Sbjct  520   PVFLQERYVFLRETAYGAYRRASYVLSNSIVSFPPLVVLSLSFALTTFFAVGLAGGLPGF  579

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY   ILASFWAG+ FVTFLS V+PHVM+ Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  580   AFYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFFINRDRIPGYWI  639

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYP+E VLQNEF    +CFVRG Q+FD++PL+A+P A+K ++L ++   L V
Sbjct  640   WFHYLSLVKYPFEGVLQNEFGRSGECFVRGAQIFDNSPLAALPDAVKARVLASISSALGV  699

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              I   TCV TG  +L    VT L KW CL +T AWGFLFR+ FYFSL+LGS+NKRR
Sbjct  700   GIGVDTCVVTGRGVLQQAAVTQLGKWECLLVTAAWGFLFRLFFYFSLVLGSKNKRR  755



>ref|XP_003564558.1| PREDICTED: ABC transporter G family member 6-like [Brachypodium 
distachyon]
Length=752

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/481 (64%), Positives = 370/481 (77%), Gaps = 16/481 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVL+RIA+SGSIVI SIHQPS RI+GLLDRLILLS G TV+
Sbjct  278   LFLDEPTSGLDSTSAFMVVKVLRRIAESGSIVITSIHQPSQRILGLLDRLILLSGGRTVF  337

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW--------  1279
             +G+P  LP + ++FG  VP+ +NR EFALDLIRE E SP GTK LV+F R W        
Sbjct  338   SGAPSALPPYFAEFGFPVPDNENRAEFALDLIREFESSPTGTKPLVDFHRTWKLMHAGDT  397

Query  1278  --SGGRNSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVL  1105
               +G R  E  T    +SLKEAI AS+S+GKLVSGA + ++  +S+  YAN  W EM VL
Sbjct  398   SSTGARPWEQPT----MSLKEAIGASISRGKLVSGAADVSH--TSMHTYANPFWVEMKVL  451

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             ++RS  N RRMPE+   RLG V VTG ILAT+F+R+D SPKG QERLGFFAFAMST FYT
Sbjct  452   TRRSAINTRRMPELFLIRLGAVVVTGGILATVFFRLDQSPKGAQERLGFFAFAMSTMFYT  511

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             CAD LPVF+QERY+FLRETA+ AYRR+SY LS+A+VSFP LV+L+L F+ TTF+A GL G
Sbjct  512   CADALPVFLQERYVFLRETAYGAYRRASYVLSNAIVSFPPLVVLSLAFALTTFFAVGLAG  571

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G +GF FY   ILASFWAG+ FVTFLS V+PHVM+ Y +VVAILAYFLLFSGFF+NR RI
Sbjct  572   GASGFAFYALAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFFINRDRI  631

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             P YW+WFHY+SL+KYP+E VLQNEF    +CFVRG Q+FD++PL A+P A+K ++L ++ 
Sbjct  632   PAYWLWFHYLSLVKYPFEGVLQNEFGRGGECFVRGAQIFDNSPLGALPEAVKARVLASIS  691

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
               L V I   TCV  G  +L    VT L KW CL +T AWGFLFR+LFYFSL+LGS+NKR
Sbjct  692   AALGVAIGPETCVANGRSVLVQAAVTQLGKWECLLVTAAWGFLFRLLFYFSLVLGSKNKR  751

Query  204   R  202
             R
Sbjct  752   R  752



>ref|XP_010504354.1| PREDICTED: ABC transporter G family member 17-like [Camelina 
sativa]
Length=662

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/473 (60%), Positives = 367/473 (78%), Gaps = 11/473 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VL+RIA+SGSIVI+SIHQPS RI+  LDR+I+LS G++V+
Sbjct  197   LFLDEPTSGLDSTSAFMVVQVLKRIARSGSIVIMSIHQPSCRIMEYLDRIIVLSSGQSVF  256

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR---N  1264
             + SP  LP F S+FG+ +P+ +N  EF LDLI+ELEGS EGT+ LVEF+R W   +   +
Sbjct  257   SDSPATLPLFFSEFGYPIPDKENNAEFTLDLIKELEGSSEGTRGLVEFNRFWQQKKLRVS  316

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
              EP    ++ SL+EAI+AS+S+GKLVS         SS+P+Y N  W E  +L+KR   N
Sbjct  317   QEPHR--NSSSLREAINASISRGKLVS------TSFSSIPSYVNPWWIETVILAKRYLIN  368

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
               R PE++GTR+ IV +TGF+LAT++W++D+SP+G+QERL FF+FAM+T FY+CAD LP 
Sbjct  369   WTRTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAMATMFYSCADGLPA  428

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             FIQERYIFLRETAHNAYRRSSY +SH+LV+ P L +L++ F+ATTFW  GL GG AGF +
Sbjct  429   FIQERYIFLRETAHNAYRRSSYVISHSLVTLPHLFVLSIGFAATTFWFVGLNGGLAGFIY  488

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y  II ASFW+G SFVTF+S V+P+VM++Y++    L+Y LLFSGF++NR RI LYWIW 
Sbjct  489   YLLIIFASFWSGCSFVTFVSGVIPNVMISYMVTFGYLSYCLLFSGFYINRDRIHLYWIWI  548

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HYISL+KYPYEAVL NEF+DP++CFVRG Q+FDDT +  V  + K KLL  M   L + +
Sbjct  549   HYISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDDTLMEGVSESTKAKLLDTMSSYLGMEL  608

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             T STC+ TG+D+L   G+  L KW CLW+T+AWGF FRILFYFSLLLGS+NKR
Sbjct  609   TESTCLRTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLLGSKNKR  661



>gb|EAY96335.1| hypothetical protein OsI_18238 [Oryza sativa Indica Group]
Length=699

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/476 (63%), Positives = 368/476 (77%), Gaps = 5/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+RIAQSGS+VI++IHQPS+RI+ +LDRL+LLSRG TVY
Sbjct  224   LFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSARILNILDRLLLLSRGRTVY  283

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G+P  L  F S+FG  +P+ +N  EFALD IRELE  P+G   L +F+ +W     + P
Sbjct  284   AGTPAGLKPFFSEFGDPIPDNENPAEFALDTIRELEHQPDGAAPLADFNVKWQSMHAALP  343

Query  1254  ATAVHN-----LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSF  1090
             A    +     + L+ AI+ SVS+GKLV+G+ +     +SVP +AN L  E+ VL KRSF
Sbjct  344   AADSKDSKRCTMPLELAITESVSRGKLVAGSGSGTASSTSVPTFANPLSVEVWVLMKRSF  403

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN  RMPE+   RLG + VTGFILAT+FWR+D++PKG+QERLGFFA AMST FY CAD L
Sbjct  404   TNTGRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGVQERLGFFAMAMSTMFYVCADAL  463

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QER+I+LRETAHNAYRR SY  ++A+V+FP LV L+L F+ TTF+A GL GG   F
Sbjct  464   PVFVQERHIYLRETAHNAYRRLSYVFANAVVAFPPLVFLSLAFAVTTFFAVGLAGGGGSF  523

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              F+  IILASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  524   LFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPSYWI  583

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPY+AVLQNEF D T+CF RG +MFD TP+ A+  A+K K+L A+ +TL  
Sbjct  584   WFHYLSLVKYPYQAVLQNEFRDATRCFSRGVEMFDGTPIGAMSRAVKLKVLDAISKTLGT  643

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              +T++TCVTTGAD+LA Q VTD+ KW CL +TVAWGF FR LFY  LL+GS+NKRR
Sbjct  644   NMTANTCVTTGADVLAQQAVTDIGKWKCLLVTVAWGFFFRALFYVVLLVGSKNKRR  699



>ref|XP_010427258.1| PREDICTED: ABC transporter G family member 17 [Camelina sativa]
Length=662

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/471 (60%), Positives = 365/471 (77%), Gaps = 7/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VL+RIA+SGSIVI+SIHQPS RI+  LDR+I+LS G++V+
Sbjct  197   LFLDEPTSGLDSTSAFMVVQVLKRIARSGSIVIMSIHQPSCRIMEFLDRIIVLSSGQSVF  256

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             + SP  LP F S+FG+ +P+ +N  EF LDLI+ELEGS EGT++LVEF++ W   +    
Sbjct  257   SDSPATLPLFFSEFGYPIPDKENNAEFTLDLIKELEGSSEGTRALVEFNKNWQQKKLRVR  316

Query  1254  ATAVHNLS-LKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                 HN S L+EAI+AS+S+GKLVS +       SS+P+Y N  W E  +L+KR   N  
Sbjct  317   QEPHHNSSSLREAINASISRGKLVSTS------FSSIPSYVNPWWIETVILAKRYMINWT  370

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE++GTR+ IV +TGF+LAT++W++D+SP+G+QERL FF+FAM+T FY+CAD LP FI
Sbjct  371   RTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAMATMFYSCADGLPAFI  430

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIFLRETAHNAYRRSSY +SH+LV+ P L +L++ F+ATTFW  GL GG +GF +Y 
Sbjct  431   QERYIFLRETAHNAYRRSSYVISHSLVTLPHLFVLSIGFAATTFWFVGLNGGLSGFIYYL  490

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              II ASFW+G SFVTF+S V+P+VM++Y++    L+Y LLFSGF++NR RI LYWIW HY
Sbjct  491   LIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYINRDRIHLYWIWIHY  550

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             ISL+KYPYEAVL NEF+DP++CFVRG Q+FDDT +  V    K KLL  +   L + +T 
Sbjct  551   ISLLKYPYEAVLHNEFDDPSRCFVRGNQIFDDTLMEGVSETTKGKLLDTVSSYLGMELTE  610

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             STC+ TG+D+L   G+  L KW CLW+T+AWGF FRILFYFSLLLGS+NKR
Sbjct  611   STCLRTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLLGSKNKR  661



>ref|XP_010516068.1| PREDICTED: ABC transporter G family member 19-like isoform X2 
[Camelina sativa]
Length=712

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/479 (61%), Positives = 369/479 (77%), Gaps = 9/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI+SIHQPS+RIV LLDRLI+LSRG++V+
Sbjct  233   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVF  292

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP F +DFG  +PE +N  EFALDL+RELEGS E T+SLV+F+ +W   + S  
Sbjct  293   NGSPASLPGFFADFGRPIPEKENITEFALDLVRELEGSTERTRSLVDFNEKWQQNKLSFS  352

Query  1254  ATAVHN--------LSLKEAISASVSQGKLVSGATNDA-NPVSSVPAYANSLWTEMAVLS  1102
              +A H         L+LKEAI+ASVS+GKLVSG++      + +V +YAN    E  +L+
Sbjct  353   QSAPHTNMFELDSPLTLKEAINASVSRGKLVSGSSRGTLVSMETVSSYANPSLFETFILA  412

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
             KR   N  RMPE++GTR+  V VTGF+LAT++W++D++P+G QERL  FAF + T FY C
Sbjct  413   KRYMKNWMRMPELVGTRIASVMVTGFLLATVYWKLDHTPRGAQERLTLFAFVVPTMFYCC  472

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
              D +PVFIQERYIFLRET HNAYR SSY +SH+LVS P L+  +LVFS  TFW  GL GG
Sbjct  473   LDNVPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLIAPSLVFSTITFWTVGLSGG  532

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
               GF+FY  +I ASFW+G+S VTF+S VVP++ML+Y++ ++ LAY LL SGF++NR RIP
Sbjct  533   LEGFYFYCLLIYASFWSGSSVVTFISGVVPNIMLSYMVAISYLAYCLLLSGFYVNRDRIP  592

Query  561   LYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
             +YW WFHYISL+KYPYEAVL NEF+DP++CFV+G Q+FD T L  V A+ K KLL  +G 
Sbjct  593   VYWTWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDSTLLGGVSASGKVKLLETLGN  652

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             +L  RIT STC+ TG+D+LA QG+T+LSKW CLWIT A G  FRILFYF+LL GSRNKR
Sbjct  653   SLKTRITESTCLRTGSDLLAQQGITELSKWECLWITFASGLFFRILFYFALLFGSRNKR  711



>ref|XP_004960311.1| PREDICTED: ABC transporter G family member 16-like [Setaria italica]
Length=694

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/473 (63%), Positives = 372/473 (79%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+RIAQSGS+VI++IHQPS+RI+G+LDRL+LLSRG TVY
Sbjct  222   LFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSARILGILDRLLLLSRGRTVY  281

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW--SGGRNS  1261
              G+P  L  F ++FG  +P+ +N  EFALD IRE E  P+G  +L +F+ +W  +G    
Sbjct  282   AGTPAGLKPFFAEFGAPIPDNENPAEFALDTIREYERQPDGAAALADFNAKWQNNGSSTD  341

Query  1260  EPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
             + +  +  + L+ AI+ SVS+GKLV+G+ + +    +VP +AN  WTE+ VL KRSFTN 
Sbjct  342   KDSKLMSTMPLELAIAESVSRGKLVAGSGSGSAVSGTVPTFANPPWTEVWVLIKRSFTNT  401

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              RMPE+   RLG + VTGFILAT+FWR+D++PKG+QERLGFFA AMST FY CAD LPVF
Sbjct  402   ARMPELFAMRLGTIMVTGFILATIFWRLDDTPKGVQERLGFFAMAMSTMFYVCADALPVF  461

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QER+I+LRETAHNAYRR SY L++A V+FP LV+L+L F+ TTFWA GL GG + F F+
Sbjct  462   VQERHIYLRETAHNAYRRISYVLANAAVAFPPLVLLSLAFAVTTFWAVGLAGGASSFLFF  521

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
               IILASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIWFH
Sbjct  522   VLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPDYWIWFH  581

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPY+AVLQNEF D ++CF RG +MFD TP+  +  A+K K+L A+ +TL   +T
Sbjct  582   YLSLVKYPYQAVLQNEFRDASRCFSRGIEMFDGTPVGRMSEAVKLKVLDAISKTLGSNMT  641

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             +STCVTTGAD+L  Q VTD+SKW CL +TVAWGF FR LFY  LL+GS+NKR+
Sbjct  642   ASTCVTTGADVLVQQAVTDISKWKCLLVTVAWGFFFRALFYVVLLVGSKNKRK  694



>ref|XP_010427269.1| PREDICTED: ABC transporter G family member 19-like isoform X1 
[Camelina sativa]
Length=713

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/481 (60%), Positives = 373/481 (78%), Gaps = 12/481 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI+SIHQPS+RIV LLDRLI+LSRG++V+
Sbjct  233   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVF  292

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP F +DFG  +PE +N  EFALDL+RELEGS E T+SLV+F+ +W   + S  
Sbjct  293   NGSPASLPGFFADFGRPIPEKENITEFALDLVRELEGSTERTRSLVDFNEKWQQNKLSFS  352

Query  1254  ATAVHN--------LSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVL  1105
              +A H         L+LKEAI+ASVS+GKLVSG++ D N +S  +V +YAN    E  +L
Sbjct  353   QSAPHTNMFELDSPLTLKEAINASVSRGKLVSGSSRD-NVISMETVSSYANPSLFETFIL  411

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             +KR   N  RMPE++GTR+  V VTGF+LAT++W++D++P+G  ERL  FAF + T FY 
Sbjct  412   AKRYMKNWMRMPELVGTRIATVMVTGFLLATVYWKLDHTPRGALERLTLFAFVVPTMFYC  471

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             C D +PVFIQERYIFLRET HNAYR SSY +SH+LV+ P L++ +LVFS  TFW  GL G
Sbjct  472   CLDNVPVFIQERYIFLRETTHNAYRTSSYVISHSLVTLPQLIVPSLVFSTITFWTVGLSG  531

Query  744   gtagffFYYAIIL-ASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRAR  568
             G    F++Y +I+ ASFW+G+S VTF+S VVP++ML+Y++ ++ LAY LL SGF++NR R
Sbjct  532   GGLEGFYFYCLIIYASFWSGSSVVTFISGVVPNIMLSYMVAISYLAYCLLLSGFYVNRDR  591

Query  567   IPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAM  388
             IP+YW WFHYISL+KYPYEAVL NEF+DP++CFV G Q+FD+T L  V  + K KLL  +
Sbjct  592   IPVYWTWFHYISLLKYPYEAVLINEFDDPSRCFVTGVQVFDNTLLGGVSDSGKIKLLETL  651

Query  387   GETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNK  208
             G++LN RIT STC+ TG+D+LA QG+T+LSKW CLWIT A G  FRILFYF+LL GSRNK
Sbjct  652   GKSLNTRITESTCLRTGSDLLAQQGITELSKWECLWITFASGLFFRILFYFALLFGSRNK  711

Query  207   R  205
             R
Sbjct  712   R  712



>ref|XP_003569021.1| PREDICTED: ABC transporter G family member 1 [Brachypodium distachyon]
Length=705

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/480 (61%), Positives = 368/480 (77%), Gaps = 9/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VL+ IAQSGS+V+++IHQPS+RI+ +LD+L+LLSRG TVY
Sbjct  226   LFLDEPTSGLDSTSAFMVVQVLRNIAQSGSVVVMTIHQPSARILAILDKLMLLSRGRTVY  285

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELE-GSPEGTKSLVEFSRRWSGGRNS-  1261
              GSP  L  F S++G  +P+ +N  EFALD IRELE   P G+  L EF+  W    +S 
Sbjct  286   AGSPAGLKPFFSEYGEPIPDNENPAEFALDTIRELERQEPHGSSPLAEFNATWQAAHSSL  345

Query  1260  -EPAT-AVHNLSLKEAISASVSQGKLVSGATNDANPVSS-----VPAYANSLWTEMAVLS  1102
               PA  A   +SL++AI+ SV +GKLV+G+T+ ++  +S     VP YAN L  E+ VL 
Sbjct  346   VVPANKAATPMSLEQAIAESVFRGKLVAGSTSSSSTTTSSPSSSVPTYANPLAIEVWVLI  405

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
             KRSFTN RR+PE+   RL  + VTGFILAT+F+R+D++PKG+QER+GFFA  MST FY C
Sbjct  406   KRSFTNTRRLPELFWMRLATIMVTGFILATIFFRLDDTPKGVQERMGFFAMGMSTMFYVC  465

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
             AD LPVF+QER+I+LRETAHNAYR +SY L++A+VSFP LV+LAL F+ TTF+A GL GG
Sbjct  466   ADALPVFVQERHIYLRETAHNAYRSASYVLANAVVSFPPLVVLALAFAVTTFFAVGLSGG  525

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIP  562
                F F+  IILAS WAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP
Sbjct  526   APSFGFFALIILASLWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIP  585

Query  561   LYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGE  382
              YWIWFHYISL+KYPY+AVLQNEF D  +CF RG QMFD TP+  +P ++K K+L A+G 
Sbjct  586   DYWIWFHYISLVKYPYQAVLQNEFGDAARCFARGVQMFDGTPIGGLPESVKMKVLGAIGN  645

Query  381   TLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TL  ++T+ TCVTTGAD+LA Q VTD+ KW  L +T  +GF FR LFY  LLLGS+NKR+
Sbjct  646   TLGTKLTAHTCVTTGADVLAHQAVTDIGKWMSLLVTAGFGFFFRALFYVVLLLGSKNKRK  705



>ref|XP_010516066.1| PREDICTED: ABC transporter G family member 17-like [Camelina 
sativa]
Length=662

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/471 (60%), Positives = 363/471 (77%), Gaps = 7/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VL+RIA+SGSIVI+SIHQPS R++  LDR+I+LS G++V+
Sbjct  197   LFLDEPTSGLDSTSAFMVVQVLKRIARSGSIVIMSIHQPSCRVMEYLDRIIVLSSGQSVF  256

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             + SP  LP F S+FG+ +P  +N  EF LDLI+ELEGS EGT+ LVEF++ W   +    
Sbjct  257   SDSPATLPLFFSEFGYPIPVKENNAEFTLDLIKELEGSSEGTRGLVEFNKNWQQKKLRVR  316

Query  1254  ATAVHNLS-LKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                 HN S L+EAI+AS+S+GKLVS         SS+P+Y N  W E  +L+KR   N  
Sbjct  317   QEPHHNSSTLREAINASISRGKLVS------TSFSSIPSYVNPWWIETVILAKRYMINWT  370

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE++GTR+ IV +TGF+LAT++W++D+SP+G+QERL FF+FAM+T FY+CAD LP FI
Sbjct  371   RTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAMATMFYSCADGLPAFI  430

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIFLRETAHNAYRRSSY +SH+LV+ P L +L++ F+ATTFW  GL GG AGF +Y 
Sbjct  431   QERYIFLRETAHNAYRRSSYVISHSLVTLPHLFVLSIGFAATTFWFVGLNGGLAGFIYYL  490

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              II ASFW+G SFVTF+S V+P+VM++Y++    L+Y LLFSGF++NR RI LYWIW HY
Sbjct  491   LIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYINRDRIHLYWIWIHY  550

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             ISL+KYPYEAVL NEF+DP++CFVRG Q+FDDT +  V  + K KLL  M   L + +T 
Sbjct  551   ISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDDTLMEGVSESTKAKLLDTMSSYLGMELTE  610

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             STC+ TG+D+L   G+  L KW CLW+T+AWGF FRILFYFSLLLGS+NKR
Sbjct  611   STCLRTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLLGSKNKR  661



>ref|NP_001054490.2| Os05g0120200 [Oryza sativa Japonica Group]
 dbj|BAF16404.2| Os05g0120200 [Oryza sativa Japonica Group]
Length=745

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/476 (63%), Positives = 369/476 (78%), Gaps = 5/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+RIAQSGS+VI++IHQPS+RI+ +LDRL+LLSRG TVY
Sbjct  224   LFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSARILNILDRLLLLSRGRTVY  283

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G+PV L  F S+FG  +P+ +N  EFALD IRELE  P+G   L +F+ +W     + P
Sbjct  284   AGTPVGLKPFFSEFGDPIPDNENPAEFALDTIRELEHQPDGAAPLADFNVKWQSMHAALP  343

Query  1254  ATAVHN-----LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSF  1090
             A    +     + L+ AI+ SVS+GKLV+G+ +     +SVP +AN L  E+ VL KRSF
Sbjct  344   AADSKDSKRCTMPLELAITESVSRGKLVAGSGSGTASSTSVPTFANPLSVEVWVLMKRSF  403

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN  RMPE+   RLG + VTGFILAT+FWR+D++PKG+QERLGFFA AMST FY CAD L
Sbjct  404   TNTGRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGVQERLGFFAMAMSTMFYVCADAL  463

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QER+I+LRETAHNAYRR SY  ++A+V+FP LV L+L F+ TTF+A GL GG   F
Sbjct  464   PVFVQERHIYLRETAHNAYRRLSYVFANAVVAFPPLVFLSLAFAVTTFFAVGLAGGGGSF  523

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              F+  IILASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  524   LFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPSYWI  583

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPY+AVLQNEF D T+CF RG +MFD TP+ A+  A+K K+L A+ +TL  
Sbjct  584   WFHYLSLVKYPYQAVLQNEFRDATRCFSRGVEMFDGTPIGAMSRAVKLKVLDAISKTLGT  643

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              +T++TCVTTGAD+LA Q VTD+ KW CL +TVAWGF FR LFY  LL+GS+NKRR
Sbjct  644   NMTANTCVTTGADVLAQQAVTDIGKWKCLLVTVAWGFFFRALFYVVLLVGSKNKRR  699



>ref|XP_002878020.1| hypothetical protein ARALYDRAFT_906929 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54279.1| hypothetical protein ARALYDRAFT_906929 [Arabidopsis lyrata subsp. 
lyrata]
Length=728

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/480 (62%), Positives = 367/480 (76%), Gaps = 11/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI+SIHQPS+RIV LLDRLI+LSRG++V+
Sbjct  249   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVF  308

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR----  1267
              GSP  LP F SDFG  +PE +N  EFALDL+RELEGS EGTK+LV+F+ +W   +    
Sbjct  309   NGSPAILPGFFSDFGRPIPEKENITEFALDLVRELEGSKEGTKALVDFNEKWQQNKISLI  368

Query  1266  NSEPATAV----HNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVL  1105
              S P T        LSLKEAI+ASVS+GKLVSG++  +NP S  +V +YAN    E  +L
Sbjct  369   QSAPQTNELEPDRALSLKEAINASVSRGKLVSGSSR-SNPTSMETVSSYANPSLFETFIL  427

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             +KR   N  RMPE++GTR+  V VTG +LAT++W++D++P+G QERL  FAF + T FY 
Sbjct  428   AKRYMKNWIRMPELVGTRIATVMVTGSLLATVYWKLDHTPRGAQERLTLFAFVVPTMFYC  487

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             C D +PVFIQERYIFLRET HNAYR SSY +SH+LVS P L+  +LVFSA TFW  GL G
Sbjct  488   CLDNVPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLIAPSLVFSAITFWTVGLSG  547

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G  GFFFY  +I ASFW+G+S VTF+S VVPH+ML Y++ +  LAY LL SGF++NR RI
Sbjct  548   GLEGFFFYCLLIYASFWSGSSVVTFISGVVPHIMLCYMVAITYLAYCLLLSGFYVNRDRI  607

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             P YW WFHYISL+KYPYEAVL NEF+DP++CFV+G Q+FD T L  V  + K KLL  + 
Sbjct  608   PFYWTWFHYISLLKYPYEAVLINEFDDPSRCFVKGVQVFDSTLLGGVSHSGKVKLLETLS  667

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             ++L  RIT STC+ TG+D+LA QG+T LSKW+CLWIT A G  FRILFYF+LL GSRNKR
Sbjct  668   DSLRTRITESTCLRTGSDLLAQQGITQLSKWDCLWITFASGLFFRILFYFALLFGSRNKR  727



>gb|EMT08074.1| ABC transporter G family member 16 [Aegilops tauschii]
Length=699

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/487 (63%), Positives = 371/487 (76%), Gaps = 26/487 (5%)
 Frame = -2

Query  1602  EPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVYTGSP  1423
             +PTSGLDSTSAF VVKVLQRIAQSGS+V++ IHQPS RI+GLLDRL+ LSRG+TVY G P
Sbjct  219   KPTSGLDSTSAFMVVKVLQRIAQSGSVVVMPIHQPSYRILGLLDRLLFLSRGQTVYYGPP  278

Query  1422  VNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW-----------S  1276
              +L  F SDFG  + + +N  EFALDL+RELE  P G   LVE ++ W            
Sbjct  279   GSLSSFFSDFGKPIHDNENPTEFALDLVRELETMPNGACDLVEHNKSWQKRMGPKMKHAD  338

Query  1275  GGRNSEPATAVHNLSLKEAISASVSQGKLVSGATNDAN---------PVSSVPAYANSLW  1123
              G   +P+     LSL+EAISAS+S+GKLVSG T D N         P S+V  +AN  W
Sbjct  339   DGNGGKPS-----LSLQEAISASISRGKLVSGET-DGNVTVPSPSSAPASAVAKFANPFW  392

Query  1122  TEMAVLSKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAM  943
              EM VL++R+F N +R PEI   RLG V +TGFILAT+FWR+D+SPKG++ERLGFFA AM
Sbjct  393   IEMGVLTRRAFLNTKRTPEIFVIRLGAVLITGFILATIFWRLDDSPKGVEERLGFFAIAM  452

Query  942   STTFYTCADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfw  763
             ST FYTC+D LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP L++L+L F+ TTF+
Sbjct  453   STMFYTCSDALPVFLNERYIFLRETAYNAYRRSSYVLSHTIVGFPSLIVLSLAFAVTTFF  512

Query  762   aaglgggtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFF  583
             A GL GG  GFFF+ AI+LASFWAG+ F TFLS VV +V L + +VV+ LAYFLLFSGFF
Sbjct  513   AVGLAGGAEGFFFFVAIVLASFWAGSGFATFLSGVVTNVQLGFPVVVSTLAYFLLFSGFF  572

Query  582   MNRARIPLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEK  403
             +NR RIP YW+WFHY SL+KYPYEAV+ NEF DP +CFVRG QMFD+TPLS +PAA+K +
Sbjct  573   INRDRIPKYWLWFHYASLVKYPYEAVMINEFSDPGRCFVRGVQMFDNTPLSVLPAAIKVR  632

Query  402   LLTAMGETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLL  223
             +L AM  +L + I ++TC+TTG D L  Q VTDL+KW+CLWITVAWGFLFRILFY SLLL
Sbjct  633   VLRAMSSSLGINIGTATCITTGPDFLKQQAVTDLTKWDCLWITVAWGFLFRILFYISLLL  692

Query  222   GSRNKRR  202
             GSRNKRR
Sbjct  693   GSRNKRR  699



>ref|XP_007027151.1| ABC transporter G family member 2 [Theobroma cacao]
 gb|EOY07653.1| ABC transporter G family member 2 [Theobroma cacao]
Length=709

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/474 (60%), Positives = 363/474 (77%), Gaps = 4/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIVI+S+HQPSSRI+GLLD LI LS G+T+Y
Sbjct  235   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVIMSVHQPSSRIIGLLDSLIFLSHGQTLY  294

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NLP+F ++FGH  PE  N  EFALD IRELE +P GT+ LVEF++ W    NS  
Sbjct  295   SGSPANLPRFFNEFGHPFPENGNPSEFALDFIRELEETPFGTQKLVEFNKSWQASMNSNS  354

Query  1254  ATAVH-NLSLKEAISASVSQGKLVSGA--TNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
               +   NL+L++AI  S+S+GKLV+GA  T D N  S VP++AN  W E+ VL KR  TN
Sbjct  355   NASNKPNLALRDAIKRSISRGKLVTGAVATIDVNLTSLVPSFANPFWVEVLVLFKRLVTN  414

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RR+PE+ G RLG + +TG ILATMFW+IDNSP+G+QERLG  A ++ST  YTC    P 
Sbjct  415   SRRIPEVFGVRLGAIIITGIILATMFWQIDNSPRGVQERLGCIAISISTIVYTCTTEAPE  474

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             FI+ERYIF+RETA+NAYRRSSY L+ + +S P L+IL+LVFS  TFWA G  GG +GFFF
Sbjct  475   FIKERYIFMRETAYNAYRRSSYVLARSFISIPSLIILSLVFSTITFWAIGFSGGLSGFFF  534

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y+   LA+FWAG+SFV FL+ + P   +++++ +A  +YFL F GF ++R R+P YWIWF
Sbjct  535   YFLTTLATFWAGSSFVAFLAGLFPDFFISFVIAIATTSYFLFFCGFLVSRDRLPKYWIWF  594

Query  543   HYISLIKYPYEAVLQNEF-EDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             HY SL+KYPYEA+LQNEF +DP+KCF RG Q+F+ T L A+P +LK  LLT+MG  L + 
Sbjct  595   HYTSLVKYPYEALLQNEFLQDPSKCFARGAQIFEQTTLGALPTSLKNDLLTSMGNVLGMN  654

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             +T STC+  G DI+ LQG+TDL+KWNC+WIT+AWGF +RILF  +LL GS+NKR
Sbjct  655   VTGSTCILMGKDIVKLQGLTDLNKWNCVWITMAWGFFYRILFNLTLLFGSKNKR  708



>dbj|BAA90508.1| unnamed protein product [Oryza sativa]
Length=705

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/475 (63%), Positives = 368/475 (77%), Gaps = 5/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+RIAQSGS+VI++IHQPS+RI+ +LDRL+LLSRG TVY
Sbjct  224   LFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSARILNILDRLLLLSRGRTVY  283

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G+PV L  F S+FG  +P+ +N  EFALD IRELE  P+G   L +F+ +W     + P
Sbjct  284   AGTPVGLKPFFSEFGDPIPDNENPAEFALDTIRELEHQPDGAAPLADFNVKWQSMHAALP  343

Query  1254  ATAVHN-----LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSF  1090
             A    +     + L+ AI+ SVS+GKLV+G+ +     +SVP +AN L  E+ VL KRSF
Sbjct  344   AADSKDSKRCTMPLELAITESVSRGKLVAGSGSGTASSTSVPTFANPLSVEVWVLMKRSF  403

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN  RMPE+   RLG + VTGFILAT+FWR+D++PKG+QERLGFFA AMST FY CAD L
Sbjct  404   TNTGRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGVQERLGFFAMAMSTMFYVCADAL  463

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QER+I+LRETAHNAYRR SY  ++A+V+FP LV L+L F+ TTF+A GL GG   F
Sbjct  464   PVFVQERHIYLRETAHNAYRRLSYVFANAVVAFPPLVFLSLAFAVTTFFAVGLAGGGGSF  523

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              F+  IILASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  524   LFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPSYWI  583

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYPY+AVLQNEF D T+CF RG +MFD TP+ A+  A+K K+L A+ +TL  
Sbjct  584   WFHYLSLVKYPYQAVLQNEFRDATRCFSRGVEMFDGTPIGAMSRAVKLKVLDAISKTLGT  643

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              +T++TCVTTGAD+LA Q VTD+ KW CL +TVAWGF FR LFY  LL+GS+NKR
Sbjct  644   NMTANTCVTTGADVLAQQAVTDIGKWKCLLVTVAWGFFFRALFYVVLLVGSKNKR  698



>ref|NP_191070.1| ABC transporter G family member 17 [Arabidopsis thaliana]
 sp|Q9M2V6.1|AB17G_ARATH RecName: Full=ABC transporter G family member 17; Short=ABC transporter 
ABCG.17; Short=AtABCG17; AltName: Full=Probable white-brown 
complex homolog protein 17; Short=AtWBC17 [Arabidopsis 
thaliana]
 emb|CAB82705.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AEE79340.1| ABC transporter G family member 17 [Arabidopsis thaliana]
Length=662

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/471 (61%), Positives = 361/471 (77%), Gaps = 7/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VL++IA+SGSIVI+SIHQPS RI+  LDR+I+LS G+ V+
Sbjct  197   LFLDEPTSGLDSTSAFMVVQVLKKIARSGSIVIMSIHQPSGRIMEFLDRVIVLSSGQIVF  256

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             + SP  LP F S+FG  +PE +N  EF LDLI++LEGSPEGT+ LVEF+R W   +    
Sbjct  257   SDSPATLPLFFSEFGSPIPEKENIAEFTLDLIKDLEGSPEGTRGLVEFNRNWQHRKLRVS  316

Query  1254  ATAVHNLS-LKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                 HN S L EAI+AS+S+GKLVS +        S+P+Y N  W E  +L+KR   N  
Sbjct  317   QEPHHNSSSLGEAINASISRGKLVSTSYR------SIPSYVNPWWVETVILAKRYMINWT  370

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE++GTR+ IV +TGF+LAT++W++D+SP+G+QERL FF+FAM+T FY+CAD LP FI
Sbjct  371   RTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAMATMFYSCADGLPAFI  430

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIFLRETAHNAYRRSSY +SH+LV+ P L  L++ F+ATTFW  GL GG AGF +Y 
Sbjct  431   QERYIFLRETAHNAYRRSSYVISHSLVTLPHLFALSIGFAATTFWFVGLNGGLAGFIYYL  490

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              II ASFW+G SFVTF+S V+P+VM++Y++    L+Y LLFSGF++NR RI LYWIW HY
Sbjct  491   MIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYVNRDRIHLYWIWIHY  550

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             ISL+KYPYEAVL NEF+DP++CFVRG Q+FD+T +  V    K KLL  M   L + +T 
Sbjct  551   ISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDNTIMEGVSETTKAKLLETMSGYLGMELTE  610

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             STC+TTG+D+L   G+  L KW CLW+T+AWGF FRILFYFSLLLGS+NKR
Sbjct  611   STCLTTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLLGSKNKR  661



>emb|CDX73404.1| BnaC08g25990D [Brassica napus]
Length=789

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/475 (61%), Positives = 375/475 (79%), Gaps = 6/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIA+SGSIVI++IHQPS+R++ LLDRLI+LSRG+ V+
Sbjct  315   LFLDEPTSGLDSTNAFMVVQVLKRIARSGSIVIMTIHQPSARVLDLLDRLIILSRGKNVF  374

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS---GGRN  1264
             +GSP +LPQFLSDFGH +PE +N  EFALDL+R+LEGS EGT+ LV+F+ +W      R 
Sbjct  375   SGSPTSLPQFLSDFGHPIPEKENITEFALDLVRQLEGSSEGTRELVKFNEKWQQNQSARA  434

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSF  1090
             +   T    LSLKE+I+ASVS+GKLVSG+T+ +NP+S  SV +YAN    E  +L+KR  
Sbjct  435   TPMTTPYQALSLKESITASVSRGKLVSGSTS-SNPISMDSVSSYANPPLVETFILAKRYM  493

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  R PE+LGTR+  V VTG +LAT++WR+DN+P+G QER+ FFAF MST FY CAD +
Sbjct  494   KNWIRTPELLGTRIATVMVTGLLLATIYWRLDNTPRGAQERMAFFAFGMSTMFYVCADNV  553

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QER+IFLRET  NAYR SSY +SH+LVS P L+ L++ F+ATTFW  GL GG   F
Sbjct  554   PVFLQERFIFLRETTRNAYRTSSYVISHSLVSLPQLLALSIAFAATTFWTVGLSGGLESF  613

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              +Y  II A FW+G+SFVTF+S +VP+VM+++++ +A L+Y LL  GF++NR RIP+YWI
Sbjct  614   LYYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLSYCLLLGGFYINRDRIPVYWI  673

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF+DP++CFVRG Q+FD T L+ VP A+K KLL  +  +L  
Sbjct  674   WFHYISLLKYPYEAVLINEFDDPSRCFVRGVQVFDGTLLAKVPDAMKVKLLDTLSSSLGT  733

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              IT STC+ TG D+L  QG++ LSKW+CLWIT+AWG  FRILFYFSLL GS+NKR
Sbjct  734   TITESTCLRTGPDLLMQQGISQLSKWDCLWITLAWGLFFRILFYFSLLFGSKNKR  788



>ref|XP_009116211.1| PREDICTED: ABC transporter G family member 18-like [Brassica 
rapa]
 ref|XP_009116212.1| PREDICTED: ABC transporter G family member 18-like [Brassica 
rapa]
Length=708

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/475 (61%), Positives = 375/475 (79%), Gaps = 6/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIA+SGSIVI++IHQPS+R++ LLDRLI+LSRGE V+
Sbjct  234   LFLDEPTSGLDSTNAFMVVQVLKRIARSGSIVIMTIHQPSARVLDLLDRLIILSRGENVF  293

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS---GGRN  1264
             +GSP +LPQFLSDFGH +PE +N  EFALDL+R+LEGS EGT+ LVEF+ +W      R 
Sbjct  294   SGSPTSLPQFLSDFGHPIPEKENITEFALDLVRQLEGSSEGTRELVEFNEKWQQNHSARA  353

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSF  1090
             +   T    LSLKE+I+ASVS+GKLVSG+T+ ++P+S  SV +YAN    E  +L+KR  
Sbjct  354   TPMTTPYQALSLKESITASVSRGKLVSGSTS-SDPISMDSVSSYANPPLVETFILAKRYM  412

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  R PE++GTR+  V VTG +LAT++WR+DN+P+G QER+ FFAF MST FY CAD +
Sbjct  413   KNWIRTPELIGTRIATVMVTGLLLATIYWRLDNTPRGAQERMAFFAFGMSTMFYVCADNV  472

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF++ER+IFLRE+  NAYR SSY +SH+LVS P L+ L++ F+ATTFW  GL GG   F
Sbjct  473   PVFLKERFIFLRESTRNAYRISSYVISHSLVSLPQLLALSIAFAATTFWTVGLSGGLESF  532

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              +Y  II A FW+G+SFVTF+S +VP+VM+++++ +A L+Y LL  GF++NR RIP+YWI
Sbjct  533   LYYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLSYCLLLGGFYINRDRIPVYWI  592

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF+DP++CFVRG Q+FD T L+ VP A+K KLL  +  +L  
Sbjct  593   WFHYISLLKYPYEAVLINEFDDPSRCFVRGVQVFDGTLLAKVPDAMKVKLLDTLSSSLGT  652

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              IT STC+ TG D+L  QG++ LSKW+CLWIT+AWG  FRILFYFSLL GS+NKR
Sbjct  653   TITESTCLRTGPDLLMQQGISQLSKWDCLWITLAWGLFFRILFYFSLLFGSKNKR  707



>ref|NP_191073.1| ABC transporter G family member 19 [Arabidopsis thaliana]
 sp|Q9M3D6.1|AB19G_ARATH RecName: Full=ABC transporter G family member 19; Short=ABC transporter 
ABCG.19; Short=AtABCG19; AltName: Full=White-brown 
complex homolog protein 19; Short=AtWBC19 [Arabidopsis thaliana]
 emb|CAB75747.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AAK76606.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AAL85118.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AEE79343.1| ABC transporter G family member 19 [Arabidopsis thaliana]
Length=725

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/480 (61%), Positives = 368/480 (77%), Gaps = 11/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI+SIHQPS+RIV LLDRLI+LSRG++V+
Sbjct  246   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVF  305

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR----  1267
              GSP +LP F SDFG  +PE +N  EFALDL+RELEGS EGTK+LV+F+ +W   +    
Sbjct  306   NGSPASLPGFFSDFGRPIPEKENISEFALDLVRELEGSNEGTKALVDFNEKWQQNKISLI  365

Query  1266  NSEPAT----AVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVL  1105
              S P T       +LSLKEAI+ASVS+GKLVSG++  +NP S  +V +YAN    E  +L
Sbjct  366   QSAPQTNKLDQDRSLSLKEAINASVSRGKLVSGSSR-SNPTSMETVSSYANPSLFETFIL  424

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             +KR   N  RMPE++GTR+  V VTG +LAT++W++D++P+G QERL  FAF + T FY 
Sbjct  425   AKRYMKNWIRMPELVGTRIATVMVTGCLLATVYWKLDHTPRGAQERLTLFAFVVPTMFYC  484

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             C D +PVFIQERYIFLRET HNAYR SSY +SH+LVS P L+  +LVFSA TFW  GL G
Sbjct  485   CLDNVPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLLAPSLVFSAITFWTVGLSG  544

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G  GF FY  +I ASFW+G+S VTF+S VVP++ML Y++ +  LAY LL SGF++NR RI
Sbjct  545   GLEGFVFYCLLIYASFWSGSSVVTFISGVVPNIMLCYMVSITYLAYCLLLSGFYVNRDRI  604

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             P YW WFHYIS++KYPYEAVL NEF+DP++CFVRG Q+FD T L  V  + K KLL  + 
Sbjct  605   PFYWTWFHYISILKYPYEAVLINEFDDPSRCFVRGVQVFDSTLLGGVSDSGKVKLLETLS  664

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             ++L  +IT STC+ TG+D+LA QG+T LSKW+CLWIT A G  FRILFYF+LL GSRNKR
Sbjct  665   KSLRTKITESTCLRTGSDLLAQQGITQLSKWDCLWITFASGLFFRILFYFALLFGSRNKR  724



>ref|XP_010503151.1| PREDICTED: ABC transporter G family member 19-like [Camelina 
sativa]
Length=715

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/480 (61%), Positives = 369/480 (77%), Gaps = 11/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIA+SGSIVI+SIHQPS+RIV LLDRLI+LSRG++V+
Sbjct  236   LFLDEPTSGLDSTNAFMVVQVLKRIAKSGSIVIMSIHQPSARIVELLDRLIILSRGKSVF  295

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR----  1267
              GSP +L +F SDFGH +PE +N  EFALDLIR+LE S EGTK LVEF+++W   +    
Sbjct  296   NGSPESLSRFFSDFGHPIPEKENITEFALDLIRQLEVSTEGTKELVEFNKKWEQNKLKLS  355

Query  1266  ---NSEPATAVHN-LSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVL  1105
                 + P T  H  LSLKEAI+ASVS+GKLVSG T+  NP++  S+ +YAN  + E  +L
Sbjct  356   QSARATPQTTPHQGLSLKEAINASVSRGKLVSG-TSAVNPIAMESISSYANPSFFETLIL  414

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             +KR   N  RMPE++GTR+ +V VT  +LAT++W +DN+P+G QER  FFAF + T FY 
Sbjct  415   AKRYMKNWIRMPELMGTRIAMVMVTAILLATVYWNLDNTPRGAQERSTFFAFVVPTMFYC  474

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             C D +PVFIQERYIFLRET HNAYR SSY +SH+LVS P L+  +LVF++ TFW  GL G
Sbjct  475   CLDNIPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLIAPSLVFASITFWTVGLSG  534

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G  GF FY  II ASFW+G+S VTF+S VVP++M++Y++ +A +AY LL SGF++NR RI
Sbjct  535   GLEGFLFYSLIIYASFWSGSSIVTFISGVVPNIMISYMVTIAYVAYCLLLSGFYVNRDRI  594

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             P+YWIWFHYIS +KYPYEAVL NEF+DP +CFV+G Q+FD T L  V  + K KLL  + 
Sbjct  595   PVYWIWFHYISPLKYPYEAVLINEFDDPLRCFVKGVQVFDGTLLGGVSYSRKIKLLETLS  654

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              +L  +IT STC+ TG+ +LA QG+T LSKW+CLWIT+A G  FRILFYF+LL GSRNKR
Sbjct  655   RSLKTKITESTCLKTGSKLLAQQGITQLSKWDCLWITLASGLFFRILFYFALLFGSRNKR  714



>emb|CDY40201.1| BnaA09g34830D [Brassica napus]
Length=708

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/475 (61%), Positives = 375/475 (79%), Gaps = 6/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIA+SGSIVI++IHQPS+R++ LLDRLI+LSRGE V+
Sbjct  234   LFLDEPTSGLDSTNAFMVVQVLKRIARSGSIVIMTIHQPSARVLDLLDRLIILSRGENVF  293

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS---GGRN  1264
             +GSP +LPQFLSDFGH +PE +N  EFALDL+R+LEGS EGT+ LVEF+ +W      R 
Sbjct  294   SGSPTSLPQFLSDFGHPIPEKENITEFALDLVRQLEGSSEGTRELVEFNEKWQQNHSARA  353

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSF  1090
             +   T    LSLKE+I+ASVS+GKLVSG+T+ ++P+S  SV +YAN    E  +L+KR  
Sbjct  354   TPMTTPYQALSLKESITASVSRGKLVSGSTS-SDPISMDSVSSYANPPLVETFILAKRYM  412

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  R PE++GTR+  V VTG +LAT++WR+DN+P+G QER+ FFAF MST FY CAD +
Sbjct  413   KNWIRTPELIGTRIATVMVTGLLLATIYWRLDNTPRGAQERMAFFAFGMSTMFYVCADNV  472

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF++ER+IFLRE+  NAYR SSY +SH+LVS P L+ L++ F+ATTFW  GL GG   F
Sbjct  473   PVFLKERFIFLRESTRNAYRISSYVISHSLVSLPQLLALSIAFAATTFWTVGLSGGLESF  532

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              +Y  II A FW+G+SFVTF+S +VP+VM+++++ +A L+Y LL  GF++NR RIP+YWI
Sbjct  533   LYYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLSYCLLLGGFYINRDRIPVYWI  592

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF+DP++CFVRG Q+FD T L+ +P A+K KLL  +  +L  
Sbjct  593   WFHYISLLKYPYEAVLINEFDDPSRCFVRGVQVFDGTLLAKMPDAMKVKLLDTLSNSLGT  652

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              IT STC+ TG D+L  QG++ LSKW+CLWIT+AWG  FRILFYFSLL GS+NKR
Sbjct  653   TITESTCLRTGPDLLMQQGISQLSKWDCLWITLAWGLFFRILFYFSLLFGSKNKR  707



>gb|ABB97036.1| ABC transporter-like protein [Brassica rapa]
Length=708

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/475 (61%), Positives = 374/475 (79%), Gaps = 6/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIA+SGSIVI++IHQPS R++ LLDRLI+LSRGE V+
Sbjct  234   LFLDEPTSGLDSTNAFMVVQVLKRIARSGSIVIMTIHQPSGRVLDLLDRLIILSRGENVF  293

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS---GGRN  1264
             +GSP +LPQFLSDFGH +PE +N  EFALDL+R+LEG+ EGT+ LVEF+ +W      R 
Sbjct  294   SGSPTSLPQFLSDFGHPIPEKENITEFALDLVRQLEGAGEGTRELVEFNEKWQQNQSARA  353

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVLSKRSF  1090
             +   T    LSLKE+I+ASVS+GKLVSG+T+ ++P+S  SV +YAN    E  +L+KR  
Sbjct  354   TPMTTPYQALSLKESITASVSRGKLVSGSTS-SDPISMDSVSSYANPPLVETFILAKRYM  412

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  R PE++GTR+  V VTG +LAT++WR+DN+P+G QER+ FFAF MST FY CAD +
Sbjct  413   KNWIRTPELIGTRIATVMVTGLLLATIYWRLDNTPRGAQERMAFFAFGMSTMFYVCADNV  472

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF++ER+IFLRE+  NAYR SSY +SH+LVS P L+ L++ F+ATTFW  GL GG   F
Sbjct  473   PVFLKERFIFLRESTRNAYRISSYVISHSLVSLPQLLALSIAFAATTFWTVGLSGGLESF  532

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              +Y  II A FW+G+SFVTF+S +VP+VM+++++ +A L+Y LL  GF++NR RIP+YWI
Sbjct  533   LYYCLIIYAGFWSGSSFVTFVSGLVPNVMISFMITIAYLSYCLLLGGFYINRDRIPVYWI  592

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+KYPYEAVL NEF+DP++CFVRG Q+FD T L+ VP A+K KLL  +  +L  
Sbjct  593   WFHYISLLKYPYEAVLINEFDDPSRCFVRGVQVFDGTLLAKVPDAMKVKLLDTLSSSLGT  652

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              IT STC+ TG D+L  QG++ LSKW+CLWIT+AWG  FRILFYFSLL GS+NKR
Sbjct  653   TITESTCLRTGPDLLLQQGISQLSKWDCLWITLAWGLFFRILFYFSLLFGSKNKR  707



>ref|XP_006292545.1| hypothetical protein CARUB_v10018780mg [Capsella rubella]
 gb|EOA25443.1| hypothetical protein CARUB_v10018780mg [Capsella rubella]
Length=664

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/471 (59%), Positives = 364/471 (77%), Gaps = 5/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VL+RIA+SGSIVI+SIHQPS RI+  LDR+I+LS G++V+
Sbjct  197   LFLDEPTSGLDSTSAFMVVQVLKRIARSGSIVIMSIHQPSGRIMDFLDRIIVLSSGQSVF  256

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             + SP  LP F S+FG+ +P+ +N  EF LDLI+ELEGS EGT+ LV+F++ W        
Sbjct  257   SDSPAALPLFFSEFGYPIPDKENNAEFTLDLIKELEGSSEGTRGLVQFNQNWQQKIFRVS  316

Query  1254  ATAVHNLS-LKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                 HN S L+EAI+ S+S+GKLVS +T+     SS+P+Y N  W E  +L++R   N  
Sbjct  317   QEPHHNSSSLREAINKSISRGKLVSTSTS----YSSIPSYVNPWWVETIILARRYMINWT  372

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE++GTR+ IV +TGF+LAT++W++D+SP+G+QERL FF+FAM+T FY+CAD LP FI
Sbjct  373   RTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAMATMFYSCADGLPAFI  432

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETAHNAYRRSSY +SH+LV+ P L  L++ F+ATTFW  GL GG AGF +Y 
Sbjct  433   QERYIFMRETAHNAYRRSSYVISHSLVTLPHLFALSIGFAATTFWFVGLNGGLAGFIYYL  492

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              II ASFW+G SFVTF+S V+P+VM++Y++    L+Y LLFSGF++NR RI LYWIW HY
Sbjct  493   LIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYINRDRIHLYWIWIHY  552

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             ISL+KYPYEAVL NEF+DP++CFVRG Q+FD+T +  V    K+KLL  +   L + +T 
Sbjct  553   ISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDNTLMEGVSETTKDKLLDTLSSYLGMELTE  612

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             STC+ TG+D+L   G+  L KW CLW+T+AWGF FRILFYFSLLLGS+NKR
Sbjct  613   STCLRTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLLGSKNKR  663



>emb|CDY65003.1| BnaAnng19960D [Brassica napus]
Length=714

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/475 (60%), Positives = 364/475 (77%), Gaps = 5/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS++AF VV+VL+RIAQSGSIV++SIHQPS+RI+ LLDRLI+LSRG+ V+
Sbjct  239   LFLDEPTSGLDSSNAFMVVQVLKRIAQSGSIVVMSIHQPSTRIIDLLDRLIILSRGKNVF  298

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG---GRN  1264
             +GSP +LP F S+ GH +PE +N  EFALD++R+LEGS EGT+ LVEF+ +W     G +
Sbjct  299   SGSPASLPNFFSNLGHTIPEKENITEFALDVVRKLEGSTEGTRELVEFNEKWQQSNLGLS  358

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDAN--PVSSVPAYANSLWTEMAVLSKRSF  1090
                    H LSLKEAI  SVS+GKLVSG++  AN   + +V +Y N    E  +L+KR  
Sbjct  359   QSARPTPHGLSLKEAIIESVSRGKLVSGSSGAANFTSMETVSSYTNPSLFETFILAKRYM  418

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  RMPE+LGTR+ IV VT F+LAT++W++DN+P+G QERL FFAF + TTFY C D +
Sbjct  419   RNWIRMPELLGTRIAIVMVTAFLLATVYWKLDNTPRGAQERLTFFAFVVPTTFYLCLDNV  478

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVFIQERYIFLRET  NAYR SSY +SH+LVS P L+  +LVFS+ TFW  GL GG  GF
Sbjct  479   PVFIQERYIFLRETTRNAYRTSSYVISHSLVSLPQLIAPSLVFSSITFWTVGLRGGLEGF  538

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY  II ASFW+G+S VTF+S +VPH+ML+Y++ +A +AY LL SGF++ R RIP YWI
Sbjct  539   VFYCLIIYASFWSGSSVVTFISGLVPHIMLSYMVTIAYVAYCLLLSGFYVVRDRIPSYWI  598

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYIS IKYPYEAVL NEF+DP++CFV+G Q+F+ T L  V    K +LL  +  +L+ 
Sbjct  599   WFHYISPIKYPYEAVLINEFDDPSRCFVKGVQVFEGTLLGGVSDKKKVELLETLSRSLST  658

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             RIT STC+ TG+D+L+ QG+T LSKW+CLWIT+A G  FRILFYF+LL GS+NKR
Sbjct  659   RITQSTCLRTGSDLLSQQGITQLSKWDCLWITLASGLFFRILFYFALLFGSKNKR  713



>ref|XP_004960315.1| PREDICTED: ABC transporter G family member 16-like [Setaria italica]
Length=690

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/473 (61%), Positives = 367/473 (78%), Gaps = 2/473 (0%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+RIAQSGS+ I++IHQPS+RI+G+LD L+LLSRG TVY
Sbjct  218   LFLDEPTSGLDSASAFMVVQVLRRIAQSGSVAIMTIHQPSARILGILDHLLLLSRGRTVY  277

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNS--  1261
              G+P  L  F ++FG  +P+ +N  EFALD IRE E  P+G  +L +F+ +W    +S  
Sbjct  278   AGTPAGLKPFFAEFGAPIPDNENPAEFALDTIREYERQPDGAAALADFNAKWQNNASSTD  337

Query  1260  EPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNL  1081
             + +  +  + L+ AI+ SVS+GKLV+G+ + +    +VP +AN LWTE+ VL KRSFTN 
Sbjct  338   KDSKLMSTMPLELAIAESVSRGKLVAGSGSGSPVSGTVPTFANPLWTEVWVLIKRSFTNT  397

Query  1080  RRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVF  901
              RMPE+   RLG + VTGFILAT+FWR+D++PKG+QERLGFFA AMST FY CAD LPVF
Sbjct  398   ARMPELFAMRLGTIMVTGFILATIFWRLDDTPKGVQERLGFFAMAMSTMFYVCADALPVF  457

Query  900   IQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFY  721
             +QER+I+LRETAHNAYRR SY L++A V+FP LV+L+L F+ TTFWA GL GG + F F+
Sbjct  458   VQERHIYLRETAHNAYRRISYVLANAAVAFPPLVLLSLAFAVTTFWAVGLAGGASSFLFF  517

Query  720   YAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFH  541
                ILASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP YWIWFH
Sbjct  518   VLTILASFWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFITRDRIPGYWIWFH  577

Query  540   YISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRIT  361
             Y+SL+KYPY+AVLQNEF    +CF RG ++FD +P+  +P A+K K+L A+  TL   +T
Sbjct  578   YLSLVKYPYQAVLQNEFGGAARCFSRGVELFDGSPIGRLPEAVKLKVLEAISATLGTNVT  637

Query  360   SSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             ++TCVTTGAD+LALQ VTD+ KW CL +TVA GFLFR LFY  LL+ S+NKR+
Sbjct  638   ANTCVTTGADVLALQAVTDIGKWKCLLVTVACGFLFRALFYVVLLVSSKNKRK  690



>ref|XP_010430990.1| PREDICTED: ABC transporter G family member 19-like [Camelina 
sativa]
Length=941

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/480 (61%), Positives = 371/480 (77%), Gaps = 11/480 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIA+SGSIVI+SIHQPS+RIV LLDRLI+LSRG++V+
Sbjct  462   LFLDEPTSGLDSTNAFMVVQVLKRIAKSGSIVIMSIHQPSARIVDLLDRLIILSRGKSVF  521

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR----  1267
             +GSP +LP+F SDFGH +PE +N  EFALDLIR+ EGS EGTK LVEF+++W   +    
Sbjct  522   SGSPTSLPRFFSDFGHPIPEKENITEFALDLIRQFEGSTEGTKELVEFNKKWEQNKLKLS  581

Query  1266  ---NSEPATAVHN-LSLKEAISASVSQGKLVSGATNDANPVS--SVPAYANSLWTEMAVL  1105
                 + P T  H  LSLKEAI ASVS+GKLVSG T+  NP++  S+ +YAN  + E  +L
Sbjct  582   QSARATPQTTPHQGLSLKEAIKASVSRGKLVSG-TSGFNPIAIESIASYANPSFFETLIL  640

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
             +KR   N  RMPE++GTR+ +V VT  +LAT++W +DN+P+G QER  FFAF + T FY 
Sbjct  641   AKRYIKNWIRMPELMGTRIAMVMVTAILLATVYWNLDNTPRGAQERSTFFAFVVPTMFYC  700

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             C D +PVFIQERYIFLRET HNAYR SSY +SH+LVS P L+  +LVF++ TFW  GL G
Sbjct  701   CLDNIPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLIAPSLVFASITFWTVGLSG  760

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G  GFFFY  II ASFW+G+S VTF+S VVP++M++Y++ +A +AY LL SGF++NR RI
Sbjct  761   GLEGFFFYSLIIYASFWSGSSVVTFISGVVPNIMISYMVTIAYVAYCLLLSGFYVNRDRI  820

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             P YWIWFHYIS +KYPYEAVL NEF+DP +CFV+G Q+FD T L  V  + K KLL  + 
Sbjct  821   PFYWIWFHYISPLKYPYEAVLINEFDDPLRCFVKGVQVFDGTLLGGVSYSRKIKLLETLS  880

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              +L  +IT STC+ TG+++LA QG+T LSKW+CLWIT+A G  FRILFYF+LL GSRNKR
Sbjct  881   RSLKTKITESTCLKTGSNLLAQQGITQLSKWDCLWITLASGLFFRILFYFALLFGSRNKR  940



>ref|NP_001044732.1| Os01g0836600 [Oryza sativa Japonica Group]
 dbj|BAB89748.1| putative ATP-binding cassette transporter ABCG2 [Oryza sativa 
Japonica Group]
 dbj|BAF06646.1| Os01g0836600 [Oryza sativa Japonica Group]
 gb|EAZ14071.1| hypothetical protein OsJ_03996 [Oryza sativa Japonica Group]
Length=749

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/475 (63%), Positives = 367/475 (77%), Gaps = 5/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VL+ IA+SGSIVI SIHQPS RI+GLLDRLILLS G TV+
Sbjct  276   LFLDEPTSGLDSTSAFMVVQVLRNIAESGSIVITSIHQPSQRILGLLDRLILLSGGRTVF  335

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW----SGGR  1267
             +G P  +P + ++FG+ VP+ +NR EFALDLIRE E  P GT  LV F++ W    +   
Sbjct  336   SGPPSAIPAYFAEFGYPVPDDENRAEFALDLIREFESLPAGTGQLVSFNKTWQVMHAARH  395

Query  1266  NSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFT  1087
             N         +SLKEAISAS+S+GKLVSG ++ A   +S+  YAN  W EM VL+KRS  
Sbjct  396   NPNDDPWAPTMSLKEAISASISRGKLVSG-SDVAGEAASMHTYANPFWVEMKVLTKRSAI  454

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RRMPE+   RLG V +TG ILAT+F+++D SPKG QERLGFFAFAMST FYTCAD LP
Sbjct  455   NTRRMPELFLIRLGAVVITGAILATVFYKLDQSPKGAQERLGFFAFAMSTMFYTCADALP  514

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+ ERYIFLRETA+ AYRR+SY LS+A+VSFP LV+L+L F+ TTF+A GL GG +GF 
Sbjct  515   VFLHERYIFLRETAYGAYRRTSYVLSNAIVSFPPLVVLSLAFAFTTFFAVGLAGGVSGFA  574

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             FY   ILASFWAG+ FVTFLS V+PHVM+ Y +VVAILAYFLLFSGFF+NR RIP YWIW
Sbjct  575   FYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFFINRDRIPDYWIW  634

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FHY+SL+KYP+E VLQNEF    +C+VRGTQMFD++PL+ +P  +K ++L ++G  L V+
Sbjct  635   FHYLSLVKYPFEGVLQNEFGRGGECYVRGTQMFDNSPLAVLPDTVKTRVLASIGTALGVK  694

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             I  +TCV TG ++L    VT L KW CL +T AWGF FR+LFYFSL+LGS+NKRR
Sbjct  695   IGPNTCVMTGHNVLREAAVTQLGKWECLLVTAAWGFFFRLLFYFSLVLGSKNKRR  749



>gb|EAY76412.1| hypothetical protein OsI_04343 [Oryza sativa Indica Group]
Length=749

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/475 (63%), Positives = 367/475 (77%), Gaps = 5/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VL+ IA+SGSIVI SIHQPS RI+GLLDRLILLS G TV+
Sbjct  276   LFLDEPTSGLDSTSAFMVVQVLRNIAESGSIVITSIHQPSQRILGLLDRLILLSGGRTVF  335

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW----SGGR  1267
             +G P  +P + ++FG+ VP+ +NR EFALDLIRE E  P GT  LV F++ W    +   
Sbjct  336   SGPPSAIPAYFAEFGYPVPDDENRAEFALDLIREFESLPAGTGQLVSFNKTWQVMHAARH  395

Query  1266  NSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFT  1087
             N         +SLKEAISAS+S+GKLVSG ++ A   +S+  YAN  W EM VL+KRS  
Sbjct  396   NPNDDPWAPTMSLKEAISASISRGKLVSG-SDVAGEAASMHTYANPFWVEMKVLAKRSAI  454

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RRMPE+   RLG V +TG ILAT+F+++D SPKG QERLGFFAFAMST FYTCAD LP
Sbjct  455   NTRRMPELFLIRLGAVVITGAILATVFYKLDQSPKGAQERLGFFAFAMSTMFYTCADALP  514

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+ ERYIFLRETA+ AYRR+SY LS+A+VSFP LV+L+L F+ TTF+A GL GG +GF 
Sbjct  515   VFLHERYIFLRETAYGAYRRTSYVLSNAIVSFPPLVVLSLAFAFTTFFAVGLAGGVSGFA  574

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             FY   ILASFWAG+ FVTFLS V+PHVM+ Y +VVAILAYFLLFSGFF+NR RIP YWIW
Sbjct  575   FYTLAILASFWAGSGFVTFLSGVIPHVMIGYTVVVAILAYFLLFSGFFINRDRIPDYWIW  634

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
             FHY+SL+KYP+E VLQNEF    +C+VRGTQMFD++PL+ +P  +K ++L ++G  L V+
Sbjct  635   FHYLSLVKYPFEGVLQNEFGRGGECYVRGTQMFDNSPLAVLPDTVKTRVLASIGTALGVK  694

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             I  +TCV TG ++L    VT L KW CL +T AWGF FR+LFYFSL+LGS+NKRR
Sbjct  695   IGPNTCVMTGHNVLREAAVTQLGKWECLLVTAAWGFFFRLLFYFSLVLGSKNKRR  749



>ref|NP_001145981.1| uncharacterized protein LOC100279509 [Zea mays]
 gb|ACF79516.1| unknown [Zea mays]
 gb|ACF86381.1| unknown [Zea mays]
 gb|ACL52975.1| unknown [Zea mays]
 gb|ACL53194.1| unknown [Zea mays]
 gb|ACR35947.1| unknown [Zea mays]
 gb|ACR36444.1| unknown [Zea mays]
 gb|AFW82807.1| hypothetical protein ZEAMMB73_743489 [Zea mays]
 gb|AFW82808.1| hypothetical protein ZEAMMB73_743489 [Zea mays]
Length=712

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/481 (61%), Positives = 367/481 (76%), Gaps = 13/481 (3%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+RIA+SGS+VI+++HQPS+RI+ +LDRL+LLSRG TVY
Sbjct  235   LFLDEPTSGLDSASAFMVVQVLRRIARSGSVVIMTVHQPSARILAILDRLLLLSRGRTVY  294

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G+P  L  F +DFG  +P+ +N  EFALD IRE E  P+G   L +F+ +W  G +S  
Sbjct  295   AGTPAGLKPFFADFGAPIPDNENPAEFALDTIREYERCPDGAAPLADFNVKWQNGSSSTS  354

Query  1254  A----------TAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVL  1105
                        ++   + L+ AI+ SVS+GKLV+G+   A   SSVP +AN  WTE+ VL
Sbjct  355   TFDNNNDDDNDSSSKLMPLELAIAESVSRGKLVAGSAVTA---SSVPTFANPPWTEVWVL  411

Query  1104  SKRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYT  925
              KRSFTN  RMPE+   RLG + VTGFILAT+FWR+D++PKG+QERLGFFA AMST FY 
Sbjct  412   IKRSFTNTGRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGVQERLGFFAMAMSTMFYV  471

Query  924   CADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgg  745
             CAD LPVF+QER+I+LRETAHNAYRR SY L++A+V+FP LV L+L F+ TTFWA GL G
Sbjct  472   CADALPVFVQERHIYLRETAHNAYRRISYVLANAVVAFPPLVFLSLAFAVTTFWAVGLAG  531

Query  744   gtagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARI  565
             G   F F+  IILASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RI
Sbjct  532   GAPSFLFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRI  591

Query  564   PLYWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMG  385
             P YWIWFHY+SL+KYPY+AVLQNEF D ++CF RG +MF+ TP+  +   +K K+L A+ 
Sbjct  592   PDYWIWFHYLSLVKYPYQAVLQNEFRDASRCFSRGVEMFEGTPIGHMTEPVKLKVLQAIS  651

Query  384   ETLNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              TL   +T++TCVTTGAD+LA Q VTD+ KW CL +TVAWGF FR LFY  LL+GS+NKR
Sbjct  652   RTLGSNMTATTCVTTGADVLAQQAVTDIGKWKCLLVTVAWGFFFRALFYVVLLVGSKNKR  711

Query  204   R  202
             +
Sbjct  712   K  712



>ref|XP_002440493.1| hypothetical protein SORBIDRAFT_09g001900 [Sorghum bicolor]
 gb|EES18923.1| hypothetical protein SORBIDRAFT_09g001900 [Sorghum bicolor]
Length=714

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/479 (62%), Positives = 365/479 (76%), Gaps = 8/479 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+RIAQSGS+VI++IHQPS+RI+G+LDRL+LLSRG TVY
Sbjct  236   LFLDEPTSGLDSASAFMVVQVLRRIAQSGSVVIMTIHQPSARILGILDRLLLLSRGRTVY  295

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G+P  L  F S+FG  +P+ +N  EFALD IRE E SP+G   L +F+ +W  G ++  
Sbjct  296   AGTPAGLKPFFSEFGTPIPDNENPAEFALDTIREYERSPDGAAPLADFNVKWQHGSSASS  355

Query  1254  ATAVHN-------LSLKEAISASVSQGKLVSGATNDANPVSS-VPAYANSLWTEMAVLSK  1099
                V         + L+ AI+ SVS+GKLV+G+       +  VP +AN  WTE+ VL K
Sbjct  356   GAGVDKDNNNNKLMPLELAIAESVSRGKLVAGSGGTGGGSAVTVPTFANPPWTEVWVLIK  415

Query  1098  RSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCA  919
             RSFTN  RMPE+   RLG + VTGFILAT+FWR+D++PKG+QERLGFFA  MST FY CA
Sbjct  416   RSFTNTGRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGVQERLGFFAMGMSTMFYVCA  475

Query  918   DTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggt  739
             D LPVF+QER+I+LRETAHNAYRR SY L++A+V+FP LV L+L F+ TTFWA GL GG 
Sbjct  476   DALPVFVQERHIYLRETAHNAYRRISYVLANAVVAFPPLVFLSLAFAVTTFWAVGLAGGA  535

Query  738   agffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPL  559
               F F+  IILASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP 
Sbjct  536   PSFLFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPD  595

Query  558   YWIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET  379
             YWIWFHY+SL+KYPY+AVLQNEF D ++CF RG QMFD TP+  +   +K K+L A+  T
Sbjct  596   YWIWFHYLSLVKYPYQAVLQNEFSDASRCFSRGVQMFDGTPIGHMAEGVKLKVLEAISRT  655

Query  378   LNVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             L   +T++TCVTTGAD+LA Q VTD+ KW CL +TVAWGF FR LFY  LL+GS+NKR+
Sbjct  656   LGTNMTATTCVTTGADVLASQAVTDIGKWKCLLVTVAWGFFFRALFYVVLLVGSKNKRK  714



>ref|XP_002878017.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54276.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=662

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/473 (59%), Positives = 360/473 (76%), Gaps = 11/473 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LF DEPTSGLDSTSAF VV+VL+RIA+SGSIVI+SIHQPS RI+  LD +I+LS G++V+
Sbjct  197   LFFDEPTSGLDSTSAFMVVQVLKRIARSGSIVIMSIHQPSGRIMEFLDHIIVLSSGQSVF  256

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR---N  1264
             + SP  +P F S+FG  +P+ +N  EF LDLI+ELE S EGT+ LVEF++ W   +   N
Sbjct  257   SDSPATIPLFFSEFGSPIPDKENNAEFTLDLIKELEESSEGTRGLVEFNKNWQQKKLRVN  316

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
              EP  +  + SL EAI+AS+S+GKLV+         SS+P+Y N  W E  +L+KR   N
Sbjct  317   QEPHHS--SSSLGEAINASISRGKLVT------TSYSSIPSYVNPWWVETVILAKRYMIN  368

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
               R PE++GTR+ IV +TGF+LAT++W++D+SP+G+QERL FF+FAM+T FY+CAD LP 
Sbjct  369   WTRTPELIGTRVFIVMMTGFLLATVYWKVDDSPRGVQERLSFFSFAMATMFYSCADGLPA  428

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             FIQERYIFLRETAHNAYRRSSY +SH+LV+ P L  L++ F+ATTFW  GL GG AGF +
Sbjct  429   FIQERYIFLRETAHNAYRRSSYVISHSLVTLPHLFALSIGFAATTFWFVGLNGGLAGFIY  488

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y  II ASFW+G SFVTF+S V+P+VM++Y++    L+Y LLFSGF++NR RI LYWIW 
Sbjct  489   YLLIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYINRDRIHLYWIWI  548

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HYISL+KYPYEAVL NEF+DP++CFVRG Q+FD+T +  V    K KLL  M   L + +
Sbjct  549   HYISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDNTIIEGVSETTKAKLLETMSSYLGMEL  608

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             T STC+ TG+D+L   G+  L KW CLW+T+AWGF FRILFYFSLLLGS+NKR
Sbjct  609   TESTCLRTGSDLLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLLLGSKNKR  661



>ref|XP_008648601.1| PREDICTED: ABC transporter G family member 16 [Zea mays]
 gb|AFW74829.1| hypothetical protein ZEAMMB73_134485 [Zea mays]
Length=714

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/478 (62%), Positives = 368/478 (77%), Gaps = 9/478 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+RIA+SGS+VI+++HQPS+RI+G+LDRL+LLSRG TVY
Sbjct  239   LFLDEPTSGLDSASAFMVVQVLRRIARSGSVVIMTVHQPSARILGILDRLLLLSRGRTVY  298

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G+P  L  F + FG  +P+ +N  EFALD IRE E SP G   L +F+ +W  G ++  
Sbjct  299   AGTPAGLKPFFAAFGAPIPDNENPAEFALDTIREYESSPGGAAPLADFNVKWQRGGDAPA  358

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSS-------VPAYANSLWTEMAVLSKR  1096
                +  L L  AI+ SVS+GKLV+G+                VP +AN  WTE+ VL KR
Sbjct  359   EGKLMPLEL--AIAESVSRGKLVAGSGRPGGGGGGGAATGSSVPTFANPPWTEVWVLIKR  416

Query  1095  SFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCAD  916
             SFTN  RMPE+   RLG + VTGFILAT+FWR+D+SPKG+QERLGFFA AMSTTFY CAD
Sbjct  417   SFTNTGRMPELFLMRLGTIMVTGFILATIFWRLDDSPKGVQERLGFFAMAMSTTFYVCAD  476

Query  915   TLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggta  736
              LPVF+QER+I+LRETAHNAYRR+SY L++A+V+FP LV+L+L F+ TTFWA GL GG  
Sbjct  477   ALPVFVQERHIYLRETAHNAYRRASYVLANAVVAFPPLVLLSLAFAVTTFWAVGLAGGGP  536

Query  735   gffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLY  556
              F F+  IILASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP Y
Sbjct  537   SFLFFVLIILASFWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPDY  596

Query  555   WIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETL  376
             WIWFHY+SL+KYPY+AVLQNEF D ++CF RG +MF+ TP++ +  A+K K++ A+ +TL
Sbjct  597   WIWFHYLSLVKYPYQAVLQNEFSDASRCFTRGVEMFEGTPIAHMTEAVKLKVMQAISDTL  656

Query  375   NVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
                +T++TCVTTGAD+LA Q VTD+ KWNCL +TVAWGF FR LFY  LL+ S+NKR+
Sbjct  657   GSNLTANTCVTTGADVLAQQAVTDIGKWNCLLVTVAWGFFFRALFYVVLLVSSKNKRK  714



>ref|XP_006480523.1| PREDICTED: ABC transporter G family member 20-like [Citrus sinensis]
Length=679

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/476 (60%), Positives = 356/476 (75%), Gaps = 5/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             L LDEPTSGLDSTSAF VV VLQRIA+SGSIVI+SIHQPS RI+ LLDRLI+LS G++VY
Sbjct  204   LLLDEPTSGLDSTSAFMVVNVLQRIAKSGSIVIMSIHQPSYRILSLLDRLIILSHGQSVY  263

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELE-GSPEGTKSLVEFSRRWS-GGRNS  1261
               +P NL QF ++FGH VPE +N++EFALDL+RELE  S +G  SLVEF+  W    +N 
Sbjct  264   NETPSNLAQFFAEFGHPVPENENKIEFALDLMRELEESSSDGITSLVEFNESWQVTKKNG  323

Query  1260  EPATAVHNLSLKEAISASVSQGKLVSGA---TNDANPVSSVPAYANSLWTEMAVLSKRSF  1090
                    N+SLK+AI AS+S+GKLVS     ++ +N  SSV  +AN  W E  V+SKR  
Sbjct  324   NKVPENANVSLKDAIKASISKGKLVSAGETISDGSNLTSSVQTFANPFWIETIVISKRLL  383

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN RRMPE+ G R G V VTGFILAT+FW++ +SPKG  +RLGFFAFAM+T FY CA  +
Sbjct  384   TNSRRMPELFGIRFGSVLVTGFILATLFWKLQDSPKGALKRLGFFAFAMTTIFYICAREI  443

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             P  +QER IF+RET++N YR SSY  +H+LVS P +  L++ F+ TTFWA GL GG +GF
Sbjct  444   PALLQERDIFIRETSYNTYRHSSYVFAHSLVSMPPITTLSITFAVTTFWAVGLSGGFSGF  503

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              F++  I ASFWAG+SF+ F++ +V H+++ + +VVAIL YFLLF GF++ R  IP YWI
Sbjct  504   LFFFITIFASFWAGSSFMAFIAGLVSHIIIGFTIVVAILGYFLLFCGFYIPRDEIPPYWI  563

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYP++ VLQNEF DP+KCFV G Q+FDDTP   +P   K KLL  M   L  
Sbjct  564   WFHYVSLVKYPFQGVLQNEFGDPSKCFVSGVQVFDDTPFEGLPFDTKIKLLENMSNVLGH  623

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              ITSSTCVTTG  +L  +GVTD+SKW C WITVA+GFLFR+LFYF+LL GS+NKRR
Sbjct  624   NITSSTCVTTGMKLLEQKGVTDISKWKCFWITVAFGFLFRVLFYFTLLFGSKNKRR  679



>ref|XP_010068854.1| PREDICTED: ABC transporter G family member 6-like [Eucalyptus 
grandis]
Length=657

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/475 (65%), Positives = 358/475 (75%), Gaps = 54/475 (11%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSA+ VVKVLQRIAQSGSIV++++HQPS RI+GL DRL+ LSRG+TVY
Sbjct  233   LFLDEPTSGLDSTSAYMVVKVLQRIAQSGSIVVMTVHQPSYRILGLFDRLLFLSRGQTVY  292

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWS----GGR  1267
             +GSP++LP F S+FGH +PE +NR EFALDLIRELEGSP GT+SLVEF++ W     G R
Sbjct  293   SGSPMSLPLFFSEFGHPIPENENRTEFALDLIRELEGSPGGTRSLVEFNKSWQSMKQGAR  352

Query  1266  NSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFT  1087
             NSEP    + LSLKEAI AS+S+GKLVSGATNDA+P S VP +AN  W EMAVLSKRS T
Sbjct  353   NSEPDR--NGLSLKEAIGASISRGKLVSGATNDASPASMVPTFANPFWIEMAVLSKRSIT  410

Query  1086  NLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLP  907
             N RRMP   G RLG V VTGFILATMFW++DNSPKG+QERLGFFAF+MST FYTCAD L 
Sbjct  411   NSRRMPGHFGIRLGAVLVTGFILATMFWQLDNSPKGVQERLGFFAFSMSTIFYTCADALS  470

Query  906   VFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagff  727
             VF+QERYIF+RETA+NAYRR SY LSH+L + P LV+LAL FSATTF+A GL GG +GF 
Sbjct  471   VFLQERYIFMRETAYNAYRRWSYVLSHSLTALPALVLLALAFSATTFFAVGLDGGLSGFL  530

Query  726   FYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIW  547
             FY+ II ASFWAG+SFV FLS VVPHVML Y +VV ILAYFLLF                
Sbjct  531   FYFLIIFASFWAGSSFVIFLSGVVPHVMLGYTIVVGILAYFLLF----------------  574

Query  546   FHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVR  367
                                     C        D+TPL  VP ALK KLL+ +  TL ++
Sbjct  575   ------------------------C--------DNTPLGVVPDALKLKLLSTISSTLGMK  602

Query  366   ITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             IT+STC+TTG  IL  QGVTDLSKW+CLW+TVAWGFLFRILFYFSLLLGS+NKRR
Sbjct  603   ITASTCLTTGTGILQQQGVTDLSKWSCLWVTVAWGFLFRILFYFSLLLGSKNKRR  657



>ref|XP_006428968.1| hypothetical protein CICLE_v10011234mg [Citrus clementina]
 gb|ESR42208.1| hypothetical protein CICLE_v10011234mg [Citrus clementina]
Length=674

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/476 (60%), Positives = 356/476 (75%), Gaps = 5/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             L LDEPTSGLDSTSAF VV VLQRIA+SGSIVI+SIHQPS RI+ LLDRLI+LS G++VY
Sbjct  199   LLLDEPTSGLDSTSAFMVVNVLQRIAKSGSIVIMSIHQPSYRILSLLDRLIILSHGQSVY  258

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELE-GSPEGTKSLVEFSRRWS-GGRNS  1261
               +P NL QF ++FGH VPE +N++EFALDL+RELE  S +G  SLVEF+  W    +N 
Sbjct  259   NETPSNLAQFFAEFGHPVPENENKIEFALDLMRELEESSSDGITSLVEFNESWQVTKKNG  318

Query  1260  EPATAVHNLSLKEAISASVSQGKLVSGA---TNDANPVSSVPAYANSLWTEMAVLSKRSF  1090
                    N+SLK+AI AS+S+GKLVS     ++ +N  SSV  +AN  W E  V+SKR  
Sbjct  319   NKVPENANVSLKDAIKASISKGKLVSAGETISDGSNLTSSVQTFANPFWIETIVISKRLL  378

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
             TN RRMPE+ G R G V VTGFILAT+FW++ +SPKG  +RLGFFAFAM+T FY CA  +
Sbjct  379   TNSRRMPELFGIRFGSVLVTGFILATLFWKLQDSPKGALKRLGFFAFAMTTIFYICAREI  438

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             P  +QER IF+RET++N YR SSY  +H+LVS P +  L++ F+ TTFWA GL GG +GF
Sbjct  439   PALLQERDIFIRETSYNTYRHSSYVFAHSLVSMPPITTLSITFAVTTFWAVGLSGGFSGF  498

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              F++  I ASFWAG+SF+ F++ +V H+++ + +VVAIL YFLLF GF++ R  IP YWI
Sbjct  499   LFFFITIFASFWAGSSFMAFIAGLVSHIIIGFTIVVAILGYFLLFCGFYIPRDEIPPYWI  558

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHY+SL+KYP++ VLQNEF DP+KCFV G Q+FDDTP   +P   K KLL  M   L  
Sbjct  559   WFHYVSLVKYPFQGVLQNEFGDPSKCFVSGVQVFDDTPFEGLPFDTKIKLLENMSNVLGN  618

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              ITSSTCVTTG  +L  +GVTD+SKW C WITVA+GFLFR+LFYF+LL GS+NKRR
Sbjct  619   NITSSTCVTTGMKLLEQKGVTDISKWKCFWITVAFGFLFRVLFYFTLLFGSKNKRR  674



>ref|XP_006403492.1| hypothetical protein EUTSA_v10010176mg [Eutrema salsugineum]
 gb|ESQ44945.1| hypothetical protein EUTSA_v10010176mg [Eutrema salsugineum]
Length=662

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/473 (60%), Positives = 361/473 (76%), Gaps = 11/473 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+ IA SGSIVI+SIHQPS RI+  LDR+I+LS G++V+
Sbjct  197   LFLDEPTSGLDSTNAFMVVQVLKSIASSGSIVIMSIHQPSCRIMEFLDRIIVLSSGQSVF  256

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR---N  1264
             + SP  LP F  +FG  +P  +N  EF LDLI+ELEGS +GT+ LVEF+R W   +   +
Sbjct  257   SDSPATLPFFFLEFGRPIPYKENNAEFTLDLIKELEGSSQGTRGLVEFNRNWQQKKLRVS  316

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
              EP    ++ SLKEAI+AS+S+GKLVS +       SS+P+Y N  W E  +L+KR   N
Sbjct  317   QEPHR--NSSSLKEAINASISRGKLVSTS------YSSIPSYVNPWWIETILLAKRYMIN  368

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
               R PE++GTR+ IV +TGF+LAT++W++DNSP+G+QERL FF+FAM+T FY+CAD LP 
Sbjct  369   WTRTPELIGTRVFIVMMTGFLLATVYWKVDNSPRGVQERLSFFSFAMATMFYSCADGLPA  428

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             FIQERYIFLRETAHNAYRRSSY +SH+LV+ P L  L++ F+ATTFW  GL GG AGF +
Sbjct  429   FIQERYIFLRETAHNAYRRSSYVISHSLVTLPHLFALSIGFAATTFWFVGLNGGVAGFIY  488

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y  II ASFW+G SFVTF+S V+P+VM++Y++    L+Y LLFSGF++NR RI  YWIW 
Sbjct  489   YLLIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYINRDRIHPYWIWI  548

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HYISL+KYPYEAVL NEF+DP++CFVRG Q+FD T +  V A  KEK+L  M   L + +
Sbjct  549   HYISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDGTLMEGVSATTKEKILETMSSYLGMEL  608

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             T S C+ TG+++L  QG+  L KW CLW+T+AWGF FRILFYFSLLLGS+NKR
Sbjct  609   TESRCLRTGSELLKQQGIQQLDKWGCLWVTLAWGFFFRILFYFSLLLGSKNKR  661



>ref|XP_006651261.1| PREDICTED: ABC transporter G family member 16-like [Oryza brachyantha]
Length=836

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/477 (62%), Positives = 356/477 (75%), Gaps = 9/477 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV+VL+ IAQSGS+VI+SIHQPS RI+GLLDRL+ LSRG+TVY
Sbjct  302   LFLDEPTSGLDSTSAFMVVRVLKSIAQSGSVVIMSIHQPSYRILGLLDRLLFLSRGKTVY  361

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW------SG  1273
              G P  LP F  DFGH +P+ +N  EFALDLI+E+E   EGTK L + +  W      +G
Sbjct  362   YGPPSQLPPFFIDFGHPIPDNENPTEFALDLIKEMETQTEGTKRLADHNTAWQKHHAMAG  421

Query  1272  GRNSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRS  1093
             G    P              A+   G +   + + A P  SV  + N  W EM VL++R+
Sbjct  422   GPIPPPXXXXXXXXXXXXXXAT--DGTVSVASDHSARP-PSVSKFVNPFWIEMGVLTRRA  478

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
             F N +R PE+   RL  V VTGFILAT+FWR+D SPKG+QERLGFFA AMST +YTC+D 
Sbjct  479   FINTKRTPEVFIIRLAAVLVTGFILATIFWRLDESPKGVQERLGFFAIAMSTMYYTCSDA  538

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVF+ ERYIFLRETA+NAYRRSSY LSH +V FP LV+L+  F+ TTF++ GL GG  G
Sbjct  539   LPVFLSERYIFLRETAYNAYRRSSYVLSHTIVGFPSLVVLSFAFALTTFFSVGLAGGVDG  598

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             FFF+ AI+LASFWAG+ F TFLS VV HVML + +V++ LAYFLLFSGFF+NR RIP YW
Sbjct  599   FFFFVAIVLASFWAGSGFATFLSGVVTHVMLGFPVVLSTLAYFLLFSGFFINRDRIPRYW  658

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             +WFHYISL+KYPYEAV+QNEF DPT+CFVRG QMFD+TPL+A+P A+K ++L +M  +L 
Sbjct  659   LWFHYISLVKYPYEAVMQNEFGDPTRCFVRGVQMFDNTPLAALPGAVKVRVLQSMSSSLG  718

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             V I + TC+TTG D L  Q +TD  KW CLWITVAWGFLFRILFY SLLLGSRNKRR
Sbjct  719   VDIGTGTCITTGPDFLKQQAITDFGKWECLWITVAWGFLFRILFYISLLLGSRNKRR  775



>ref|XP_009124228.1| PREDICTED: ABC transporter G family member 19-like [Brassica 
rapa]
Length=757

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/476 (60%), Positives = 364/476 (76%), Gaps = 6/476 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS++AF VV+VL+RIAQSGSIV++SIHQPS+RI+ LLDRLI+LSRG+ V+
Sbjct  281   LFLDEPTSGLDSSNAFMVVQVLKRIAQSGSIVVMSIHQPSTRIIDLLDRLIILSRGKNVF  340

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG---GRN  1264
             +GSP +LP F S+ GH +PE +N  EFALD++R+LEGS EGT+ LVEF+ +W     G +
Sbjct  341   SGSPASLPNFFSNLGHTIPEKENITEFALDVVRKLEGSTEGTRELVEFNEKWQQSNLGLS  400

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSS---VPAYANSLWTEMAVLSKRS  1093
                    H LSLKEAI  SVS+GKLVSG+++ A  ++S   V +Y N    E  +L+KR 
Sbjct  401   QSARPTPHGLSLKEAIIESVSRGKLVSGSSSGATYLTSMETVSSYTNPSLFETFILAKRY  460

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
               N  RMPE+LGTR+ IV VT F+LAT++W++DN+P+G QE+L FFAF + TTFY C D 
Sbjct  461   MRNWIRMPELLGTRIAIVMVTAFLLATVYWKLDNTPRGAQEKLTFFAFVVPTTFYLCLDN  520

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             +PVFIQERYIFLRET  NAYR SSY +SH+LVS P L+  +LVFS+ TFW  GL GG  G
Sbjct  521   VPVFIQERYIFLRETTRNAYRTSSYVISHSLVSLPQLIAPSLVFSSITFWTVGLHGGLEG  580

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F FY  II ASFW+G+S VTF+S +VPH+ML+Y++ +A +AY LL SGF++ R RIP YW
Sbjct  581   FVFYCLIIYASFWSGSSVVTFISGLVPHIMLSYMVTIAYVAYCLLLSGFYVVRDRIPSYW  640

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHYIS IKYPYEAVL NEF+D ++CFV+G Q+F+ T L  V    K +LL  +  +L+
Sbjct  641   IWFHYISPIKYPYEAVLINEFDDKSRCFVKGVQVFEGTLLGGVSDMKKVELLETLSRSLS  700

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
              RIT STC+ TG+D+L+ QG+T LSKW+CLWIT+A G  FRILFYF+LL GS+NKR
Sbjct  701   TRITQSTCLRTGSDLLSQQGITQLSKWDCLWITLASGLFFRILFYFALLFGSKNKR  756



>dbj|BAJ94806.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=692

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/474 (61%), Positives = 363/474 (77%), Gaps = 4/474 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+ IA+SGS+V+++IHQPS+RI+G+L RL+LLSRG TVY
Sbjct  220   LFLDEPTSGLDSASAFMVVQVLRTIARSGSVVVMTIHQPSARILGILGRLLLLSRGRTVY  279

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR---N  1264
              G+P  L  FL++FG  +P+ +N  EFALD IRE EG P+GT  L +F+ +W       +
Sbjct  280   AGTPAGLKPFLAEFGTPIPDNENPAEFALDTIREREGQPDGTAVLADFNAKWQATHKLMD  339

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
                A  V  ++L+ AI+ SV++GKLV+G+      +  +P YAN +  E+ VL KR+FTN
Sbjct  340   GNGAKRVSPMTLEYAIAESVARGKLVAGSGTGTVSLQ-MPTYANPMPVEVWVLIKRAFTN  398

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RRMPE+ G RLG + VTG ILAT+F R+D++PKG+QERLGFFA  MST FY CAD LPV
Sbjct  399   TRRMPELFGMRLGTIMVTGLILATIFLRLDDTPKGVQERLGFFAMGMSTMFYVCADALPV  458

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QER+I+LRETAHNAYRR SY L++A+VSFP LV L+L F+ TTF+A GL GG + F +
Sbjct  459   FVQERHIYLRETAHNAYRRISYVLANAVVSFPPLVALSLAFAVTTFFAVGLAGGASSFLY  518

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             +  IILAS WAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP YWIWF
Sbjct  519   FSLIILASLWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPDYWIWF  578

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRI  364
             HYISL+KYPY+AVLQNEF D T+CF RG QMFD TP+  +P A+K K+L A+G  L  R+
Sbjct  579   HYISLVKYPYQAVLQNEFGDATRCFARGVQMFDGTPIGGMPEAIKTKVLGAIGNALGTRM  638

Query  363   TSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TS TCV TGAD+LA Q VTDL KW CL +T  +GF FR LFY  LL+GS+NKR+
Sbjct  639   TSHTCVLTGADVLAQQAVTDLGKWMCLLVTAGFGFFFRALFYVVLLVGSKNKRK  692



>ref|XP_009139199.1| PREDICTED: ABC transporter G family member 17 [Brassica rapa]
Length=662

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/471 (59%), Positives = 358/471 (76%), Gaps = 7/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST AF VV+VL++IA SGSIV++SIHQPS RI+ LLDRL++LS G+ V+
Sbjct  197   LFLDEPTSGLDSTCAFMVVQVLKQIACSGSIVVMSIHQPSCRIMELLDRLLVLSSGQCVF  256

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             + SP  LP F S+FG  +P+ +N  EF LDLI++LEG+  GT  LVEF+R W   +    
Sbjct  257   SDSPATLPLFFSEFGRPIPDKENNAEFTLDLIKDLEGTSGGTSRLVEFNRSWQQKKLRVS  316

Query  1254  ATAVHNLS-LKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLR  1078
                 HN S L+E I+AS+++GKLV+ + N      S  +Y N  W E  +L+KR   N  
Sbjct  317   QEPHHNSSPLRETINASITRGKLVTTSYN------SKASYVNPWWVETLILAKRYMINWT  370

Query  1077  RMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFI  898
             R PE++GTR+ IV +TGF+LAT++WR+D+SP+G+QERL FF+FAM+T FY+CAD LP FI
Sbjct  371   RTPELIGTRVFIVMMTGFLLATVYWRVDDSPRGVQERLSFFSFAMATMFYSCADGLPTFI  430

Query  897   QERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYY  718
             QERYIF+RETAHNAYRRSSY +SH+LV+ P L  L++ F+ATTFW  GL GG AGF +Y 
Sbjct  431   QERYIFMRETAHNAYRRSSYVISHSLVTLPHLFALSVGFAATTFWFVGLNGGLAGFIYYL  490

Query  717   AIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHY  538
              II ASFW+G SFVTF+S V+P+VM++Y++    L+Y LLFSGF++NR RI LYWIW HY
Sbjct  491   LIIFASFWSGCSFVTFVSGVIPNVMMSYMVTFGYLSYCLLFSGFYINRDRIHLYWIWIHY  550

Query  537   ISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITS  358
             ISL+KYPYEAVL NEF+DP++CFVRG Q+FD+T +  VP ++KEKLL  MG  L + +T 
Sbjct  551   ISLLKYPYEAVLHNEFDDPSRCFVRGNQVFDNTFMEGVPESMKEKLLETMGSYLGMELTE  610

Query  357   STCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             STC+ TG+++L   G+  L KW CLW+T+AWGF FRILFYFSL  GS+NKR
Sbjct  611   STCLRTGSELLKQHGIEQLDKWGCLWVTLAWGFFFRILFYFSLSFGSKNKR  661



>emb|CDY37656.1| BnaC04g29980D [Brassica napus]
Length=713

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/475 (59%), Positives = 359/475 (76%), Gaps = 5/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS++AF VV+VL+RIAQSGS+V++SIHQPS+RI+ LLDRLI+LSRG+ V+
Sbjct  238   LFLDEPTSGLDSSNAFMVVQVLKRIAQSGSVVVMSIHQPSTRIIDLLDRLIILSRGKNVF  297

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRW---SGGRN  1264
             +GSP +LP+F S+ GH +PE +N  EFALDL+R+LEGS EGT+ LVEF+ +W   S G +
Sbjct  298   SGSPASLPRFFSNLGHTIPEKENITEFALDLVRKLEGSTEGTRELVEFNEKWQQDSCGLS  357

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDAN--PVSSVPAYANSLWTEMAVLSKRSF  1090
                      LSLKEAI  SVS+GKLVSG++   N   + +V +Y N    E  +L+KR  
Sbjct  358   QSARPTPQGLSLKEAIIESVSRGKLVSGSSGATNFTSMETVSSYTNPSLFETFILAKRYM  417

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  RMPE+LGTR+ IV VT F+LAT++W++DN+P+G QERL FFAF + TTFY C D +
Sbjct  418   RNWIRMPELLGTRIAIVMVTAFLLATVYWKLDNTPRGAQERLTFFAFVVPTTFYLCLDNV  477

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVFIQERYIFLRET  NAYR SSY +SH+LVS P L+  +LVFS  TFW  GL GG  G+
Sbjct  478   PVFIQERYIFLRETTRNAYRTSSYVISHSLVSLPQLIAPSLVFSTITFWTVGLRGGLEGY  537

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY  II ASFW+G+S VTF+S +VPH+ML+Y++ +A +AY LL SGF++ R RIP YWI
Sbjct  538   VFYCLIIYASFWSGSSVVTFISGLVPHIMLSYMVTIAYVAYCLLLSGFYVVRDRIPSYWI  597

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYIS IKYPYEAVL NEF+DP++CFV+G Q+F+ T L  V    K +LL  +  +L+ 
Sbjct  598   WFHYISPIKYPYEAVLINEFDDPSRCFVKGVQVFEGTLLGGVSDMKKVELLETLSRSLST  657

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             RIT STC+ TG   L+ QG+  LSKW+CLWIT+A G  FRILFYF+LL GS+NKR
Sbjct  658   RITQSTCLRTGPGFLSQQGIPQLSKWDCLWITLASGLFFRILFYFALLFGSKNKR  712



>ref|XP_006403489.1| hypothetical protein EUTSA_v10010975mg [Eutrema salsugineum]
 gb|ESQ44942.1| hypothetical protein EUTSA_v10010975mg [Eutrema salsugineum]
Length=727

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/475 (59%), Positives = 362/475 (76%), Gaps = 5/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIV++SIHQPS+RI+  LDRLI+LSRG++V+
Sbjct  252   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVMMSIHQPSARILDFLDRLIILSRGKSVF  311

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGR---N  1264
              G P +LP F SDFG  +PE +N  EFALDLIRELE S EGT  LVEF+ +W   +    
Sbjct  312   NGCPASLPSFFSDFGRPIPERENITEFALDLIRELEKSNEGTSQLVEFNEKWQKKQLLAR  371

Query  1263  SEPATAVHN-LSLKEAISASVSQGKLVSGAT-NDANPVSSVPAYANSLWTEMAVLSKRSF  1090
             +   TA H  LSLKEAI ASVS+GKLVSG++ ++   + +V +YAN    E  +L+KR  
Sbjct  372   ATTQTASHQGLSLKEAIDASVSRGKLVSGSSKSNLMSMETVSSYANPSLFETFILAKRYM  431

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  R PE++GTR+  V VTGF+LAT++W++DN+P+G  ERL FFAF   T FY C D +
Sbjct  432   KNWIRTPELVGTRIATVMVTGFLLATVYWKLDNTPRGAHERLTFFAFVTPTMFYCCLDNV  491

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVFIQERYIFLRET HNAYR SSY +SH+L+S P L+  ++VF++ TFW   L GG  GF
Sbjct  492   PVFIQERYIFLRETMHNAYRTSSYVISHSLMSLPQLIAPSIVFASITFWTVDLSGGLQGF  551

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
             FFY  II ASFW+G+S VTF+S V+P++ML Y++ ++ LAY LL SGF++NR RIP YW+
Sbjct  552   FFYCLIIFASFWSGSSVVTFISGVLPNIMLCYMVAISYLAYCLLLSGFYVNRDRIPSYWM  611

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYIS++KYPYEAVL NEF+D ++CFV+G Q+FD T +  V  + K KLL  +G +L  
Sbjct  612   WFHYISVLKYPYEAVLINEFDDSSRCFVKGVQVFDGTLIGGVSDSGKVKLLETLGRSLRT  671

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             RIT STC+TTG+D+L+ QG+T LSKW+CLWIT+A G  FRILFY +LL GS+NKR
Sbjct  672   RITESTCLTTGSDLLSQQGITQLSKWDCLWITLACGLFFRILFYIALLFGSKNKR  726



>ref|XP_002439184.1| hypothetical protein SORBIDRAFT_09g001940 [Sorghum bicolor]
 gb|EES17614.1| hypothetical protein SORBIDRAFT_09g001940 [Sorghum bicolor]
Length=710

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/477 (61%), Positives = 365/477 (77%), Gaps = 6/477 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+R+AQSGS+V+++IHQPS+RI+G+LD L+LLSRG TVY
Sbjct  234   LFLDEPTSGLDSASAFMVVQVLRRVAQSGSVVVMTIHQPSTRILGILDSLLLLSRGRTVY  293

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G+P  L  F ++FG  VP+ +N  EFALD IRE E  P+G   + +F+ +W    ++  
Sbjct  294   AGTPAGLKPFFAEFGAPVPDNENPAEFALDTIREYEHQPDGAAPIADFNVKWQHSSSASF  353

Query  1254  ATAVHN-----LSLKEAISASVSQGKLVSGATNDANPVSS-VPAYANSLWTEMAVLSKRS  1093
             A   +N     + L+ AI+ SVS+GKLV+G+       +  VP +AN  WTE+ VL KRS
Sbjct  354   AAVDNNNNNKLMPLELAIAESVSRGKLVAGSGGTGGGSAVTVPTFANPPWTEVWVLIKRS  413

Query  1092  FTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADT  913
             FTN  RMPE+   RLG + VTGFILAT+FWR+D++PKG+QERLGFFA AMST FY CAD 
Sbjct  414   FTNTGRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGVQERLGFFAMAMSTMFYVCADA  473

Query  912   LPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtag  733
             LPVF+QER+I+LRETAHNAYRR SY L++A+V+FP LV+L+L F+ TTFWA GL GG + 
Sbjct  474   LPVFVQERHIYLRETAHNAYRRISYVLANAVVAFPPLVLLSLAFAVTTFWAVGLAGGASS  533

Query  732   ffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYW  553
             F F+  I+LAS WAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+ R RIP YW
Sbjct  534   FLFFVLIVLASLWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFITRDRIPDYW  593

Query  552   IWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLN  373
             IWFHY+SL+KYPY+AVLQNEF   ++CF RG +MFD TP+  +P A+K K+L A+  TL 
Sbjct  594   IWFHYLSLVKYPYQAVLQNEFGAASRCFSRGVEMFDGTPIGRMPEAMKMKVLEAISATLG  653

Query  372   VRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
               +T+ TCV TGAD+LA Q V D+SKW CL +TVAWGF FR+LFY  LL+GS+NKR+
Sbjct  654   TNVTADTCVVTGADVLAQQAVMDISKWKCLLVTVAWGFFFRVLFYVVLLVGSKNKRK  710



>ref|XP_010516067.1| PREDICTED: ABC transporter G family member 19-like isoform X1 
[Camelina sativa]
Length=744

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/511 (57%), Positives = 370/511 (72%), Gaps = 41/511 (8%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI+SIHQPS+RIV LLDRLI+LSRG++V+
Sbjct  233   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARIVELLDRLIILSRGKSVF  292

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP +LP F +DFG  +PE +N  EFALDL+RELEGS E T+SLV+F+ +W   + S  
Sbjct  293   NGSPASLPGFFADFGRPIPEKENITEFALDLVRELEGSTERTRSLVDFNEKWQQNKLSFS  352

Query  1254  ATAVHN--------LSLKEAISASVSQGKLVSGATNDA-NPVSSVPAYANSLWTEMAVLS  1102
              +A H         L+LKEAI+ASVS+GKLVSG++      + +V +YAN    E  +L+
Sbjct  353   QSAPHTNMFELDSPLTLKEAINASVSRGKLVSGSSRGTLVSMETVSSYANPSLFETFILA  412

Query  1101  KRSFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTC  922
             KR   N  RMPE++GTR+  V VTGF+LAT++W++D++P+G QERL  FAF + T FY C
Sbjct  413   KRYMKNWMRMPELVGTRIASVMVTGFLLATVYWKLDHTPRGAQERLTLFAFVVPTMFYCC  472

Query  921   ADTLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglggg  742
              D +PVFIQERYIFLRET HNAYR SSY +SH+LVS P L+  +LVFS  TFW  GL GG
Sbjct  473   LDNVPVFIQERYIFLRETTHNAYRTSSYVISHSLVSLPQLIAPSLVFSTITFWTVGLSGG  532

Query  741   tagffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRA---  571
               GF+FY  +I ASFW+G+S VTF+S VVP++ML+Y++ ++ LAY LL SGF++NR    
Sbjct  533   LEGFYFYCLLIYASFWSGSSVVTFISGVVPNIMLSYMVAISYLAYCLLLSGFYVNRDRIP  592

Query  570   -----------------------------RIPLYWIWFHYISLIKYPYEAVLQNEFEDPT  478
                                          RIP+YW WFHYISL+KYPYEAVL NEF+DP+
Sbjct  593   VYWTWFHYMVAISYLGYCLLLSGFYANRYRIPVYWTWFHYISLLKYPYEAVLINEFDDPS  652

Query  477   KCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSSTCVTTGADILALQGVTDLS  298
             +CFV G Q+FD+T L  V  + K KLL  +G++L +RIT STC+ TG+D+LA QG+T+LS
Sbjct  653   RCFVTGVQVFDNTLLGGVSDSGKIKLLEILGKSLKMRITESTCLRTGSDLLAQQGITELS  712

Query  297   KWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             KW CLWITVA G   RILFYF+LL GSRNKR
Sbjct  713   KWECLWITVASGLFLRILFYFALLFGSRNKR  743



>ref|XP_002312057.2| hypothetical protein POPTR_0008s04780g [Populus trichocarpa]
 gb|EEE89424.2| hypothetical protein POPTR_0008s04780g [Populus trichocarpa]
Length=679

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/394 (72%), Positives = 328/394 (83%), Gaps = 6/394 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLI LSRG+TVY
Sbjct  287   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVY  346

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG---GRN  1264
             +GSP++LP + SDFGH +P+ +NR E+ALDLIRELEGSP GTKSLVEF++ W      RN
Sbjct  347   SGSPMSLPVYFSDFGHPIPDSENRTEYALDLIRELEGSPGGTKSLVEFNKSWHDLKLSRN  406

Query  1263  SEPATAVHNLSLKEAISASVSQGKLVSGATNDA--NPVSSVPAYANSLWTEMAVLSKRSF  1090
                      LSLKEAISA++S+GKLVSGATN+   +P S VP +AN +W EMAVLS+RSF
Sbjct  407   GRGEPDGGGLSLKEAISAAISKGKLVSGATNNDAISPNSMVPTFANPVWKEMAVLSRRSF  466

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N RR+PE+ G RLG V VTGFILAT+FW++D+SPKG+QERLGFFAFAMSTTFYTCAD L
Sbjct  467   MNSRRVPELFGVRLGAVVVTGFILATVFWQLDSSPKGVQERLGFFAFAMSTTFYTCADAL  526

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVF+QERYIF+RETA+NAYRRSSY LSH LV  P L+ L+  F+ATTFWA GL GG +GF
Sbjct  527   PVFLQERYIFMRETAYNAYRRSSYVLSHGLVVLPSLIFLSFAFAATTFWAVGLDGGFSGF  586

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
              FY+ II ASFWAG+SFVTFLS VVPHVML YI+VVAILAYFLLFSGFF+NR RIP YWI
Sbjct  587   LFYFLIIFASFWAGSSFVTFLSGVVPHVMLGYIIVVAILAYFLLFSGFFINRDRIPSYWI  646

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMF  448
             WFHY+SL+KYPYEAVLQNEF D  + F +G   F
Sbjct  647   WFHYLSLVKYPYEAVLQNEFSD-AQVFRKGCPDF  679



>ref|XP_006379565.1| hypothetical protein POPTR_0008s047701g, partial [Populus trichocarpa]
 gb|ERP57362.1| hypothetical protein POPTR_0008s047701g, partial [Populus trichocarpa]
Length=379

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/379 (73%), Positives = 320/379 (84%), Gaps = 5/379 (1%)
 Frame = -2

Query  1599  PTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVYTGSPV  1420
             PTSGLDSTSAF VVKVLQRIAQSGSIVI+S+HQPS RI+GLLDRLI LSRG+TVY+GSP+
Sbjct  1     PTSGLDSTSAFMVVKVLQRIAQSGSIVIMSVHQPSYRILGLLDRLIFLSRGQTVYSGSPM  60

Query  1419  NLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSG---GRNSEPAT  1249
             +LP + SDFGH +P+ +NR E+ALDLIRELEGSP GTKSLVEF++ W      RN     
Sbjct  61    SLPVYFSDFGHPIPDSENRTEYALDLIRELEGSPGGTKSLVEFNKSWHDLKLSRNGRGEP  120

Query  1248  AVHNLSLKEAISASVSQGKLVSGATND--ANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
                 LSLKEAISA++S+GKLVSGATN+   +P S VP +AN +W EMAVLS+RSF N RR
Sbjct  121   DGGGLSLKEAISAAISKGKLVSGATNNDAISPNSMVPTFANPVWKEMAVLSRRSFMNSRR  180

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
             +PE+ G RLG V VTGFILAT+FW++D+SPKG+QERLGFFAFAMSTTFYTCAD LPVF+Q
Sbjct  181   VPELFGVRLGAVVVTGFILATVFWQLDSSPKGVQERLGFFAFAMSTTFYTCADALPVFLQ  240

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ERYIF+RETA+NAYRRSSY LSH LV  P L+ L+  F+ATTFWA GL GG +GF FY+ 
Sbjct  241   ERYIFMRETAYNAYRRSSYVLSHGLVVLPSLIFLSFAFAATTFWAVGLDGGFSGFLFYFL  300

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
             II ASFWAG+SFVTFLS VVPHVML YI+VVAILAYFLLFSGFF+NR RIP YWIWFHY+
Sbjct  301   IIFASFWAGSSFVTFLSGVVPHVMLGYIIVVAILAYFLLFSGFFINRDRIPSYWIWFHYL  360

Query  534   SLIKYPYEAVLQNEFEDPT  478
             SL+KYPYEAVLQNEF+D T
Sbjct  361   SLVKYPYEAVLQNEFQDAT  379



>gb|EMT27092.1| ABC transporter G family member 1 [Aegilops tauschii]
Length=541

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/471 (62%), Positives = 358/471 (76%), Gaps = 4/471 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL  IA+SGS+V+++IHQPS+RI+G+L RL+LLSRG TVY
Sbjct  75    LFLDEPTSGLDSASAFMVVQVLLDIARSGSVVVMTIHQPSARILGILGRLLLLSRGRTVY  134

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              G+P  L  F  +FG  +PE +N  EFALD IRELE  P+G   L +F+ RW    +   
Sbjct  135   AGTPAGLMPFFHEFGKPIPENENPAEFALDTIRELERQPDGAAQLADFNARWQA--DHRI  192

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
                V+ + L+ AIS SV +GKLV+G        SSVP YAN L  E+ VL KRSFTN RR
Sbjct  193   IETVNAMPLEVAISESVCRGKLVAGTVT--GTASSVPTYANPLTVEVWVLIKRSFTNTRR  250

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
             MPE+ G RLG + +TG ILAT+F R+D++PKG+QERLGFFA  MST FY CAD LPVF+Q
Sbjct  251   MPELFGMRLGTIMLTGLILATIFLRLDDTPKGVQERLGFFAMGMSTMFYVCADALPVFVQ  310

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ER+I+LRETAHN+YRR SY L++++VSFP LVIL+L F+ TTF+A GL GG A F F+  
Sbjct  311   ERHIYLRETAHNSYRRLSYVLANSVVSFPPLVILSLAFAVTTFFAVGLAGGGASFAFFAL  370

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
             IILAS WAG+ FVTFLS VVPHVM+ Y +VVAILAYFLLFSGFF+NR RIP YWIWFHYI
Sbjct  371   IILASLWAGSGFVTFLSAVVPHVMVGYTVVVAILAYFLLFSGFFINRDRIPNYWIWFHYI  430

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             SL+KYPY+AVLQNEF D ++CF RG QMF+ TP++ +  A+K K+L A+  TL   +T++
Sbjct  431   SLVKYPYQAVLQNEFGDASRCFARGVQMFEGTPIAGMTEAVKLKVLGAISATLGTNMTAA  490

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TCV TGAD+L  Q VTDL KW CL +T A+GF FR LFY  LL+GS+NKR+
Sbjct  491   TCVVTGADVLRQQAVTDLGKWMCLLVTAAFGFFFRALFYVVLLVGSKNKRK  541



>gb|EAY96333.1| hypothetical protein OsI_18236 [Oryza sativa Indica Group]
Length=680

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/478 (61%), Positives = 365/478 (76%), Gaps = 7/478 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+RIAQSGS+++++IHQPS+RI+ +LDRL+LLSRG TVY
Sbjct  203   LFLDEPTSGLDSASAFMVVQVLRRIAQSGSVIVMTIHQPSARILNILDRLLLLSRGRTVY  262

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGG-----  1270
              GSP  L  F S FG+ +P+ +N VEFALD IRELE  P+G   LV+FS RW        
Sbjct  263   AGSPSGLKPFFSVFGYPIPDNENLVEFALDTIRELEHQPDGAAMLVKFSSRWQSSLGALL  322

Query  1269  --RNSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKR  1096
               ++ +  +    + L+ AI+ SVS+GKLV+G+ +     +SVP YAN  + E+ VL KR
Sbjct  323   DTKDDKDRSQRCTMPLELAIAESVSRGKLVAGSGSGTLSSTSVPTYANPWYVEVWVLMKR  382

Query  1095  SFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCAD  916
             +FTN RRMPE+   RLG + VTGFILAT+FWR+D++PKG+QERLGFFA AMST FY CAD
Sbjct  383   AFTNTRRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGVQERLGFFAMAMSTMFYVCAD  442

Query  915   TLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggta  736
              LPVF+QER+I+LRETAHNAYRR SY +++  V+FP LV+L+L F+ TTF+A  L GG A
Sbjct  443   ALPVFVQERHIYLRETAHNAYRRLSYVVANTAVAFPPLVVLSLAFAVTTFFAVRLSGGGA  502

Query  735   gffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLY  556
              F F+   +LASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP Y
Sbjct  503   SFAFFALTVLASFWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPSY  562

Query  555   WIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETL  376
             WIWFHY+SL+KYPY+AVLQNEF D  +CF RG +MFD TP+ A+  A+K K+L A+G TL
Sbjct  563   WIWFHYLSLVKYPYQAVLQNEFRDAARCFSRGVEMFDGTPIGAMSKAVKLKVLDAIGATL  622

Query  375   NVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
                +T+ TCV TGAD+LA Q VTD+ +W CL +TVA+GF FR LFY  L  GS+NKRR
Sbjct  623   GAPLTAETCVVTGADVLAQQAVTDIGRWKCLLVTVAFGFFFRFLFYIVLHFGSKNKRR  680



>ref|NP_001054488.2| Os05g0120000 [Oryza sativa Japonica Group]
 gb|EEE62136.1| hypothetical protein OsJ_16923 [Oryza sativa Japonica Group]
 dbj|BAF16402.2| Os05g0120000 [Oryza sativa Japonica Group]
Length=680

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/478 (61%), Positives = 365/478 (76%), Gaps = 7/478 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDS SAF VV+VL+RIAQSGS+++++IHQPS+RI+ +LDRL+LLSRG TVY
Sbjct  203   LFLDEPTSGLDSASAFMVVQVLRRIAQSGSVIVMTIHQPSARILNILDRLLLLSRGRTVY  262

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGG-----  1270
              GSP  L  F S FG+ +P+ +N VEFALD IRELE  P+G   LV+FS RW        
Sbjct  263   AGSPSGLKPFFSVFGYPIPDNENLVEFALDTIRELEHQPDGAAMLVKFSSRWQSSLGALL  322

Query  1269  --RNSEPATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKR  1096
               ++ +  +    + L+ AI+ SVS+GKLV+G+ +     +SVP YAN  + E+ VL KR
Sbjct  323   DTKDDKDRSQRCTMPLELAIAESVSRGKLVAGSGSGTLSSTSVPTYANPWYVEVWVLMKR  382

Query  1095  SFTNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCAD  916
             +FTN RRMPE+   RLG + VTGFILAT+FWR+D++PKG+QERLGFFA AMST FY CAD
Sbjct  383   AFTNTRRMPELFVMRLGTIMVTGFILATIFWRLDDTPKGVQERLGFFAMAMSTMFYVCAD  442

Query  915   TLPVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggta  736
              LPVF+QER+I+LRETAHNAYRR SY +++  V+FP LV+L+L F+ TTF+A  L GG A
Sbjct  443   ALPVFVQERHIYLRETAHNAYRRLSYVVANTAVAFPPLVVLSLAFAVTTFFAVRLSGGGA  502

Query  735   gffFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLY  556
              F F+   +LASFWAG+ FVTFLS VVPHVML Y +VVAILAYFLLFSGFF+NR RIP Y
Sbjct  503   SFAFFALTVLASFWAGSGFVTFLSAVVPHVMLGYTVVVAILAYFLLFSGFFINRDRIPSY  562

Query  555   WIWFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETL  376
             WIWFHY+SL+KYPY+AVLQNEF D  +CF RG +MFD TP+ A+  A+K K+L A+G TL
Sbjct  563   WIWFHYLSLVKYPYQAVLQNEFRDAARCFSRGVEMFDGTPIGAMSKAVKLKVLDAIGATL  622

Query  375   NVRITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
                +T+ TCV TGAD+LA Q VTD+ +W CL +TVA+GF FR LFY  L  GS+NKRR
Sbjct  623   GAPLTAETCVVTGADVLAQQAVTDIGRWKCLLVTVAFGFFFRFLFYIVLHFGSKNKRR  680



>ref|XP_010096686.1| ABC transporter G family member 6 [Morus notabilis]
 gb|EXB65354.1| ABC transporter G family member 6 [Morus notabilis]
Length=689

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/476 (59%), Positives = 358/476 (75%), Gaps = 11/476 (2%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VV VL+ IA+ GS+V++S+HQPS RI+GLLD+LI LS+G+ VY
Sbjct  220   LFLDEPTSGLDSTSAFTVVNVLKNIARGGSVVVMSVHQPSYRIIGLLDKLIFLSKGQVVY  279

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
              GSP+NLP F S FG  +P+  N VEF LDLI ELE S  G  +LV+ +   + G++SE 
Sbjct  280   RGSPINLPLFCSKFGRPIPDNANPVEFMLDLISELEDSTNGISTLVDLN---NTGKSSER  336

Query  1254  ATAVHN---LSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTN  1084
             A A  +    SL EA++  +S+GKLVS   N +N   +   +AN  WTEM VL KRS TN
Sbjct  337   ADAEKSDVVSSLTEALNLGISKGKLVSDNINTSNVKKT---FANPFWTEMLVLYKRSMTN  393

Query  1083  LRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPV  904
              RR PEI   RL  +  TGF+LAT++W++D+SPKGI+ERLGFFAFA+S+T+++    LPV
Sbjct  394   SRRTPEIFAARLITILTTGFLLATIYWQLDDSPKGIRERLGFFAFAISSTYFSSCQYLPV  453

Query  903   FIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffF  724
             F+QER+IF+RETA+NAYRRSSY LSHA      L IL+L FS TTFWA GL GG +GF F
Sbjct  454   FLQERFIFMRETAYNAYRRSSYVLSHAFAVLLPLFILSLAFSMTTFWAVGLTGGISGFLF  513

Query  723   YYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWF  544
             Y+ II ASFWAGNSF  F+S +VPH++L Y +V+A+ AYFLL SGFF+NR RIP YWIWF
Sbjct  514   YFLIIYASFWAGNSFAVFVSGLVPHILLGYTVVIAVSAYFLLLSGFFINRNRIPPYWIWF  573

Query  543   HYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGET--LNV  370
             HY+SLIKYPYEA++++EF+DPTKCF RG++MFDDTP   +    KE++L ++  +   N 
Sbjct  574   HYVSLIKYPYEALMRSEFDDPTKCFRRGSEMFDDTPFRNISGDTKERMLGSLSASSGTNY  633

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
              +TSSTC+TTG D+L  QG+TDL+KW  L I VAWGF +R LFY SLLLGS+NKR+
Sbjct  634   NVTSSTCLTTGLDVLKEQGITDLNKWMYLLIIVAWGFFYRFLFYLSLLLGSKNKRK  689



>ref|XP_009139197.1| PREDICTED: ABC transporter G family member 19 [Brassica rapa]
Length=722

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/475 (61%), Positives = 368/475 (77%), Gaps = 5/475 (1%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDST+AF VV+VL+RIAQSGSIVI+SIHQPS+RI+ LLDRLI+LSRG++V+
Sbjct  247   LFLDEPTSGLDSTNAFMVVQVLKRIAQSGSIVIMSIHQPSARILDLLDRLIILSRGKSVF  306

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSP-EGTKSLVEFSRRWSG---GR  1267
              GSP NLP F SDFGH +PE +N  EFALDL+RELE  P EGT+ LVEF+ +W      R
Sbjct  307   NGSPANLPSFFSDFGHPIPERENITEFALDLVRELEREPNEGTRELVEFNEKWQKTIFAR  366

Query  1266  NSEPATAVHNLSLKEAISASVSQGKLVSGATNDANP-VSSVPAYANSLWTEMAVLSKRSF  1090
             ++    +  +LSLKEAI ASVS+GKLVSG++      + +V +YAN    E  +L+KR  
Sbjct  367   DTTQTGSDQSLSLKEAIDASVSRGKLVSGSSGSNLLSMETVSSYANPSLFETFILAKRYM  426

Query  1089  TNLRRMPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTL  910
              N  RMPE++GTR+  V VTGF+LAT++W++DN+P+G QERL FFAF + T FY C D +
Sbjct  427   KNWIRMPELVGTRIATVMVTGFLLATVYWKLDNTPRGAQERLTFFAFVVPTMFYCCLDNV  486

Query  909   PVFIQERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagf  730
             PVFIQERYIFLRETAHNAYR SSY +SH+LV+ P L+  ++VF++ TFW  GL GG  GF
Sbjct  487   PVFIQERYIFLRETAHNAYRTSSYVISHSLVTMPQLIAPSIVFASITFWTVGLNGGLQGF  546

Query  729   fFYYAIILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWI  550
             FFY  II ASFW+G S VTF+S V+P++ML+Y++ ++ LAY LL SGF++NR RIP+YW+
Sbjct  547   FFYVLIIYASFWSGASVVTFISGVLPNIMLSYMVAISYLAYCLLLSGFYVNRDRIPIYWM  606

Query  549   WFHYISLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNV  370
             WFHYISL+K+PYEAVL NEF+DP++CFV+G Q+FD T +  V  + K KLL  +G +L  
Sbjct  607   WFHYISLLKFPYEAVLINEFDDPSRCFVKGVQVFDGTLIGGVSDSGKVKLLRTLGMSLRK  666

Query  369   RITSSTCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKR  205
             RIT STC+ TG+D+LA Q +T LSKW+CLWIT A G  FRILFYF+LL G +NKR
Sbjct  667   RITESTCLRTGSDLLAQQSITQLSKWDCLWITFACGLFFRILFYFALLFGRKNKR  721



>ref|XP_007027152.1| ABC transporter G family member 2 [Theobroma cacao]
 gb|EOY07654.1| ABC transporter G family member 2 [Theobroma cacao]
Length=664

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/471 (59%), Positives = 344/471 (73%), Gaps = 31/471 (7%)
 Frame = -2

Query  1614  LFLDEPTSGLDSTSAFNVVKVLQRIAQSGSIVILSIHQPSSRIVGLLDRLILLSRGETVY  1435
             LFLDEPTSGLDSTSAF VVKVLQRIAQSGSIV++S+HQPS RI+ LLDRLI LS+G+T+Y
Sbjct  225   LFLDEPTSGLDSTSAFMVVKVLQRIAQSGSIVLMSVHQPSYRILCLLDRLIFLSQGQTLY  284

Query  1434  TGSPVNLPQFLSDFGHQVPEGDNRVEFALDLIRELEGSPEGTKSLVEFSRRWSGGRNSEP  1255
             +GSP NL +F  DFGH +PE +N  EFALD IRELE +P                     
Sbjct  285   SGSPANLSEFFRDFGHPIPENENPAEFALDFIRELEETP---------------------  323

Query  1254  ATAVHNLSLKEAISASVSQGKLVSGATNDANPVSSVPAYANSLWTEMAVLSKRSFTNLRR  1075
                        AI+ S+S+GKLVS ATND NP SSV ++AN  W E+ VL KR   N RR
Sbjct  324   ----------YAINRSISRGKLVSQATNDLNPTSSVSSFANPFWIELLVLLKRLSINSRR  373

Query  1074  MPEILGTRLGIVSVTGFILATMFWRIDNSPKGIQERLGFFAFAMSTTFYTCADTLPVFIQ  895
             MPE+ G +L  + +TG I+A+MFW++D+SP+G+QERLG FAF +STTFYTCA  +P FIQ
Sbjct  374   MPEVFGIQLAAIVITGIIVASMFWQLDDSPRGMQERLGCFAFVVSTTFYTCAHEVPEFIQ  433

Query  894   ERYIFLRETAHNAYRRSSYCLSHALVSFPMLVILALVFSattfwaaglgggtagffFYYA  715
             ER+IF+RETA+N YR SSY L+ +L+S P L+ L++ F   TFW  GL GG  GF F   
Sbjct  434   ERFIFMRETAYNTYRCSSYVLARSLISIPSLITLSIAFVTITFWTVGLAGGFPGFVFLLL  493

Query  714   IILASFWAGNSFVTFLSCVVPHVMLAYILVVAILAYFLLFSGFFMNRARIPLYWIWFHYI  535
              I ASFWAG+SFV FLS +V  V++++++VVA LAYF LFSGFF++R R+P YW+WFHY+
Sbjct  494   TIFASFWAGSSFVAFLSALVSDVLVSFVVVVATLAYFTLFSGFFVSRNRLPGYWLWFHYL  553

Query  534   SLIKYPYEAVLQNEFEDPTKCFVRGTQMFDDTPLSAVPAALKEKLLTAMGETLNVRITSS  355
             S++KYPYEAVL NEF DPTKCF RG Q+FDDTPL  +P +L+  LL  +G  L   IT S
Sbjct  554   SIVKYPYEAVLLNEFRDPTKCFTRGVQIFDDTPLGKLPVSLQIDLLKTVGNALGTNITGS  613

Query  354   TCVTTGADILALQGVTDLSKWNCLWITVAWGFLFRILFYFSLLLGSRNKRR  202
             TC+TTG DIL  QGVT+L+KWNC WI + WGF FRILFY +LL GS+NKR+
Sbjct  614   TCLTTGRDILLQQGVTELNKWNCFWIAIGWGFFFRILFYLTLLFGSKNKRK  664



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4838741935674