BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c102489_g1_i1 len=470 path=[448:0-469]

Length=470
                                                                      Score     E

ref|NP_001275153.1|  plastid-dividing ring protein                      105   6e-24   
ref|NP_001233950.1|  plastid-dividing ring protein                      102   9e-23   
ref|XP_009591422.1|  PREDICTED: cell division protein FtsZ homolo...  99.4    1e-21   
ref|XP_009765068.1|  PREDICTED: cell division protein FtsZ homolo...  89.4    5e-18   
emb|CAB89287.1|  chloroplast FtsZ-like protein                        89.0    6e-18   Nicotiana tabacum [American tobacco]
ref|XP_010675824.1|  PREDICTED: cell division protein FtsZ homolo...  87.4    2e-17   
ref|XP_006344879.1|  PREDICTED: cell division protein FtsZ homolo...  85.5    1e-16   
ref|XP_004294407.1|  PREDICTED: cell division protein FtsZ homolo...  84.3    3e-16   
ref|XP_006452476.1|  hypothetical protein CICLE_v10008445mg           84.0    4e-16   
ref|XP_009343640.1|  PREDICTED: cell division protein FtsZ homolo...  83.2    9e-16   
ref|XP_009334175.1|  PREDICTED: cell division protein FtsZ homolo...  83.2    1e-15   
ref|XP_009334174.1|  PREDICTED: cell division protein FtsZ homolo...  82.8    1e-15   
ref|XP_009343639.1|  PREDICTED: cell division protein FtsZ homolo...  82.8    1e-15   
ref|XP_010270112.1|  PREDICTED: cell division protein FtsZ homolo...  81.6    5e-15   
ref|XP_007146538.1|  hypothetical protein PHAVU_006G049100g           80.9    7e-15   
ref|XP_003551732.1|  PREDICTED: cell division protein FtsZ homolo...  80.1    9e-15   
gb|AAF81220.1|  FtsZ1                                                 80.1    1e-14   Tagetes erecta [big marigold]
ref|XP_004149587.1|  PREDICTED: cell division protein FtsZ homolo...  80.1    1e-14   
ref|XP_004166970.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...  80.1    1e-14   
ref|XP_004251908.1|  PREDICTED: cell division protein FtsZ homolo...  79.7    1e-14   
emb|CDY19897.1|  BnaC09g31630D                                        79.7    1e-14   
gb|KHN30883.1|  Cell division protein FtsZ like 1, chloroplastic      79.7    2e-14   
ref|XP_010313930.1|  PREDICTED: cell division protein FtsZ homolo...  79.7    2e-14   
ref|XP_010313931.1|  PREDICTED: cell division protein FtsZ homolo...  79.3    2e-14   
emb|CDY17316.1|  BnaA10g09500D                                        79.3    2e-14   
ref|XP_003600215.1|  Cell division protein FtsZ                       79.3    2e-14   
gb|AFK39538.1|  unknown                                               78.2    5e-14   
ref|XP_009361066.1|  PREDICTED: cell division protein FtsZ homolo...  78.2    6e-14   
gb|EYU27393.1|  hypothetical protein MIMGU_mgv1a007772mg              77.8    7e-14   
ref|XP_009625657.1|  PREDICTED: cell division protein FtsZ homolo...  77.8    7e-14   
ref|XP_010099992.1|  Cell division protein FtsZ-1-like protein        77.8    8e-14   
gb|KHM99513.1|  Cell division protein FtsZ like 1, chloroplastic      77.8    8e-14   
ref|XP_006586107.1|  PREDICTED: cell division protein FtsZ homolo...  77.8    8e-14   
gb|EYU33680.1|  hypothetical protein MIMGU_mgv1a008311mg              77.0    9e-14   
ref|XP_009765135.1|  PREDICTED: cell division protein FtsZ homolo...  77.4    1e-13   
ref|XP_008449114.1|  PREDICTED: cell division protein FtsZ homolo...  77.4    1e-13   
ref|XP_009120048.1|  PREDICTED: cell division protein FtsZ homolo...  77.4    1e-13   
gb|EPS68972.1|  plastid-dividing ring protein                         76.3    1e-13   
ref|XP_008366436.1|  PREDICTED: cell division protein FtsZ homolo...  77.0    2e-13   
gb|KDP39208.1|  hypothetical protein JCGZ_00965                       77.0    2e-13   
ref|XP_011097822.1|  PREDICTED: cell division protein FtsZ homolo...  75.9    2e-13   
ref|XP_008366435.1|  PREDICTED: cell division protein FtsZ homolo...  76.6    2e-13   
ref|XP_007211741.1|  hypothetical protein PRUPE_ppa006258mg           75.9    3e-13   
ref|XP_002276623.1|  PREDICTED: cell division protein FtsZ homolo...  75.9    3e-13   Vitis vinifera
gb|AFC37491.1|  FtsZ1 protein                                         75.9    4e-13   
emb|CDP13769.1|  unnamed protein product                              73.2    4e-13   
ref|XP_010482963.1|  PREDICTED: cell division protein FtsZ homolo...  75.9    4e-13   
ref|XP_011097821.1|  PREDICTED: cell division protein FtsZ homolo...  75.9    4e-13   
ref|XP_008227026.1|  PREDICTED: cell division protein FtsZ homolo...  75.5    5e-13   
ref|NP_200339.1|  cell division protein ftsZ-like protein 1           75.5    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866084.1|  ftsz1-1                                          75.5    5e-13   
gb|AAF23770.1|AF205858_1  FtsZ-like protein 2                         75.1    6e-13   Nicotiana tabacum [American tobacco]
emb|CAB89286.1|  chloroplast FtsZ-like protein                        75.1    6e-13   Nicotiana tabacum [American tobacco]
ref|XP_007020677.1|  Bacterial cytokinesis Z-ring protein FTSZ 1-...  75.1    7e-13   
gb|KHG27532.1|  Cell division FtsZ, chloroplastic -like protein       74.7    7e-13   
ref|XP_007020676.1|  Bacterial cytokinesis Z-ring protein FTSZ 1-...  75.1    8e-13   
ref|XP_004500118.1|  PREDICTED: cell division protein FtsZ homolo...  74.7    8e-13   
ref|XP_002300342.2|  cell division family protein                     74.3    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_003544739.1|  PREDICTED: cell division protein FtsZ homolo...  74.3    1e-12   
ref|XP_009127013.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...  74.3    1e-12   
gb|KHN43855.1|  Cell division protein FtsZ like 1, chloroplastic      74.3    1e-12   
gb|ACU24263.1|  unknown                                               72.8    1e-12   Glycine max [soybeans]
gb|KHN23882.1|  Cell division protein FtsZ like 1, chloroplastic      73.9    2e-12   
gb|ACG70179.1|  chloroplast FtsZ1-1                                   73.9    2e-12   Brassica oleracea var. botrytis [cauliflower]
ref|XP_011047540.1|  PREDICTED: cell division protein FtsZ homolo...  73.9    2e-12   
ref|XP_008364389.1|  PREDICTED: LOW QUALITY PROTEIN: cell divisio...  73.6    2e-12   
ref|XP_002531210.1|  Cell division protein ftsZ, putative             73.6    2e-12   Ricinus communis
ref|XP_010449352.1|  PREDICTED: cell division protein FtsZ homolo...  73.6    2e-12   
ref|XP_006401472.1|  hypothetical protein EUTSA_v10013612mg           73.6    2e-12   
ref|XP_006280511.1|  hypothetical protein CARUB_v10026448mg           73.6    2e-12   
ref|XP_008798743.1|  PREDICTED: cell division protein FtsZ homolo...  73.2    3e-12   
ref|XP_010536696.1|  PREDICTED: cell division protein FtsZ homolo...  73.2    3e-12   
gb|KFK27127.1|  hypothetical protein AALP_AA8G338300                  73.2    3e-12   
ref|XP_006839100.1|  hypothetical protein AMTR_s00090p00136440        72.8    4e-12   
emb|CDY20776.1|  BnaA02g09160D                                        72.8    5e-12   
ref|XP_003519603.1|  PREDICTED: cell division protein FtsZ homolo...  72.8    5e-12   
gb|AAA82068.1|  cpFtsZ                                                72.4    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010443150.1|  PREDICTED: cell division protein FtsZ homolo...  72.4    5e-12   
gb|KHG00460.1|  Cell division FtsZ, chloroplastic -like protein       72.0    6e-12   
emb|CAA75603.1|  FtsZ protein                                         71.6    1e-11   Pisum sativum [garden pea]
ref|XP_004491442.1|  PREDICTED: cell division protein FtsZ homolo...  71.2    1e-11   
emb|CAI44667.1|  plastid division protein                             71.2    2e-11   Medicago truncatula
ref|XP_003617666.1|  FtsZ protein                                     71.2    2e-11   
emb|CBI26709.3|  unnamed protein product                              70.5    2e-11   
ref|XP_010063064.1|  PREDICTED: cell division protein FtsZ homolo...  70.5    3e-11   
ref|XP_010913967.1|  PREDICTED: cell division protein FtsZ homolo...  69.7    4e-11   
gb|ACF85277.1|  unknown                                               68.6    1e-10   Zea mays [maize]
ref|NP_001149695.1|  LOC100283321                                     68.6    1e-10   Zea mays [maize]
ref|XP_011095476.1|  PREDICTED: cell division protein FtsZ homolo...  68.2    1e-10   
ref|XP_002448714.1|  hypothetical protein SORBIDRAFT_06g031950        67.8    2e-10   Sorghum bicolor [broomcorn]
ref|XP_010928879.1|  PREDICTED: cell division protein FtsZ homolo...  67.4    2e-10   
ref|XP_010928878.1|  PREDICTED: cell division protein FtsZ homolo...  67.4    2e-10   
gb|ADX77916.1|  FtsZ                                                  64.7    4e-10   
gb|ABK24653.1|  unknown                                               67.0    4e-10   Picea sitchensis
ref|XP_004960200.1|  PREDICTED: cell division protein FtsZ homolo...  66.6    5e-10   
ref|XP_009407904.1|  PREDICTED: cell division protein FtsZ homolo...  66.6    6e-10   
gb|ACN40898.1|  unknown                                               65.5    2e-09   Picea sitchensis
ref|XP_008782917.1|  PREDICTED: cell division protein FtsZ homolo...  64.7    2e-09   
dbj|BAG97403.1|  unnamed protein product                              64.7    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054176.1|  Os04g0665400                                     64.3    3e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEC78198.1|  hypothetical protein OsI_17816                        64.3    3e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006846633.1|  hypothetical protein AMTR_s00156p00058400        63.9    4e-09   
ref|XP_002985903.1|  hypothetical protein SELMODRAFT_123081           63.2    7e-09   
ref|XP_002984848.1|  hypothetical protein SELMODRAFT_156840           63.2    7e-09   
dbj|BAJ85582.1|  predicted protein                                    62.8    1e-08   
gb|AEV40986.1|  putative tubulin/FtsZ domain-containing protein       62.0    1e-08   
gb|AEV40936.1|  putative tubulin/FtsZ domain-containing protein       62.4    1e-08   
ref|XP_003580765.1|  PREDICTED: cell division protein FtsZ homolo...  62.4    1e-08   
ref|XP_006652974.1|  PREDICTED: cell division protein FtsZ homolo...  62.4    2e-08   
ref|XP_007020678.1|  Bacterial cytokinesis Z-ring protein FTSZ 1-...  60.8    3e-08   
ref|XP_002501749.1|  predicted protein                                61.2    3e-08   Micromonas commoda
ref|XP_003080788.1|  ftsZ1 (ISS)                                      60.5    6e-08   
dbj|BAC57986.1|  ftsZ1                                                60.5    7e-08   Marchantia polymorpha
gb|EMS66227.1|  Cell division protein ftsZ-like protein 1, chloro...  60.1    7e-08   
emb|CEG01485.1|  Cell division protein FtsZ, C-terminal               60.1    8e-08   
ref|WP_015956956.1|  cell division protein FtsZ                       59.3    2e-07   
ref|XP_010249043.1|  PREDICTED: cell division protein FtsZ homolo...  58.5    3e-07   
ref|WP_005582518.1|  hypothetical protein                             55.1    5e-07   
gb|EOS57895.1|  cell division protein ftsZ                            57.0    8e-07   
ref|WP_027889761.1|  cell division protein FtsZ                       57.0    9e-07   
ref|XP_001780238.1|  ftsZ1-1 plastid division protein                 57.0    9e-07   
ref|WP_011640258.1|  cell division protein FtsZ                       56.6    1e-06   
ref|WP_013778216.1|  cell division protein FtsZ                       56.6    1e-06   
ref|WP_013174987.1|  cell division protein FtsZ                       56.6    1e-06   
dbj|BAD12165.1|  plastid division protein FtsZ                        56.6    1e-06   Nannochloris bacillaris
ref|WP_013322397.1|  cell division protein FtsZ                       56.6    1e-06   
ref|WP_012094996.1|  cell division protein FtsZ                       55.8    2e-06   
ref|XP_003058549.1|  predicted protein                                55.8    2e-06   
ref|WP_033405533.1|  cell division protein FtsZ                       55.5    2e-06   
ref|WP_013075835.1|  cell division protein FtsZ                       55.5    2e-06   
ref|WP_022227972.1|  cell division protein FtsZ 1                     55.5    3e-06   
ref|WP_008538349.1|  cell division protein FtsZ                       55.5    3e-06   
ref|WP_003867934.1|  MULTISPECIES: cell division protein FtsZ         55.5    3e-06   
ref|WP_014063046.1|  cell division protein FtsZ                       55.5    3e-06   
ref|WP_012995467.1|  cell division protein FtsZ                       55.5    3e-06   
gb|KHO62804.1|  cell division protein FtsZ                            55.1    3e-06   
ref|XP_001769058.1|  ftsZ1-2 plastid division protein                 55.5    3e-06   
ref|WP_013150470.1|  MULTISPECIES: cell division protein FtsZ         55.1    3e-06   
ref|WP_021295404.1|  cell division protein FtsZ                       55.1    3e-06   
ref|WP_007289296.1|  cell division protein FtsZ                       55.1    3e-06   
ref|WP_036125233.1|  cell division protein FtsZ                       52.4    3e-06   
ref|WP_012810654.1|  cell division protein FtsZ                       55.1    3e-06   
gb|AAF87239.1|AF275720_1  FtsZ                                        53.5    4e-06   
ref|WP_008339618.1|  cell division protein FtsZ                       55.1    4e-06   
ref|WP_007287886.1|  cell division protein FtsZ                       55.1    4e-06   
ref|WP_038681737.1|  cell division protein FtsZ                       55.1    4e-06   
ref|WP_025027694.1|  cell division protein FtsZ                       55.1    4e-06   
ref|WP_022072126.1|  cell division protein FtsZ                       55.1    4e-06   
ref|WP_034422748.1|  cell division protein FtsZ                       54.7    4e-06   
ref|WP_019175265.1|  cell division protein FtsZ                       54.7    4e-06   
ref|WP_022076980.1|  cell division protein FtsZ                       52.4    5e-06   
ref|WP_021717426.1|  cell division protein FtsZ                       54.7    5e-06   
gb|EUJ32082.1|  cell division protein FtsZ                            51.2    5e-06   
ref|WP_027308716.1|  cell division protein FtsZ                       54.3    6e-06   
ref|WP_022090093.1|  cell division protein ftsZ                       52.0    6e-06   
ref|WP_013275763.1|  cell division protein FtsZ                       54.3    6e-06   
ref|WP_038087826.1|  cell division protein FtsZ                       54.3    6e-06   
ref|WP_006446859.1|  cell division protein FtsZ                       54.3    7e-06   
ref|WP_004402383.1|  MULTISPECIES: cell division protein FtsZ         54.3    7e-06   
ref|WP_003871212.1|  cell division protein FtsZ                       54.3    7e-06   
ref|WP_011247196.1|  cell division protein FtsZ                       54.3    7e-06   
ref|WP_006570252.1|  cell division protein FtsZ                       53.9    7e-06   
ref|WP_012063991.1|  cell division protein FtsZ                       53.9    7e-06   
gb|KEI67555.1|  FtsZ                                                  54.3    7e-06   
ref|WP_012159241.1|  cell division protein FtsZ                       53.9    8e-06   
ref|WP_007505648.1|  cell division protein FtsZ                       53.9    8e-06   
ref|WP_009765590.1|  cell division protein FtsZ                       53.9    8e-06   
ref|WP_010898709.1|  cell division protein FtsZ                       53.9    9e-06   
emb|CDZ74743.1|  Cell division protein FtsZ                           53.9    9e-06   
ref|WP_011564468.1|  cell division protein FtsZ                       53.9    9e-06   
ref|WP_029052369.1|  cell division protein FtsZ                       53.9    9e-06   
ref|WP_029982211.1|  cell division protein FtsZ                       50.4    1e-05   
gb|AIS52701.1|  cell division protein FtsZ                            53.5    1e-05   
ref|XP_007515227.1|  cell division protein FtsZ                       53.9    1e-05   
ref|WP_026476379.1|  cell division protein FtsZ                       53.5    1e-05   
ref|WP_009345078.1|  cell division protein FtsZ                       53.5    1e-05   
ref|WP_013489176.1|  cell division protein FtsZ                       53.5    1e-05   
ref|WP_019554726.1|  cell division protein FtsZ                       53.5    1e-05   
gb|ADZ39767.1|  cell division protein FtsZ                            51.2    1e-05   
ref|WP_034575506.1|  hypothetical protein                             53.5    1e-05   
ref|WP_004627003.1|  cell division protein FtsZ [                     53.5    1e-05   
ref|WP_014464040.1|  cell division protein FtsZ                       53.1    1e-05   
ref|WP_000888975.1|  hypothetical protein                             52.8    1e-05   
dbj|GAE04268.1|  cell division protein FtsZ                           52.8    1e-05   
ref|WP_018886787.1|  MULTISPECIES: cell division protein FtsZ         53.1    1e-05   
ref|WP_033672172.1|  cell division protein FtsZ                       53.1    1e-05   
ref|WP_027094786.1|  cell division protein FtsZ [                     53.1    1e-05   
ref|WP_026674366.1|  cell division protein FtsZ                       53.1    1e-05   
gb|ACL35745.1|  cell division protein                                 50.4    1e-05   Bartonella sp. EYL-2008
ref|XP_001419359.1|  predicted protein                                53.1    1e-05   Ostreococcus lucimarinus CCE9901
ref|WP_017727216.1|  cell division protein FtsZ                       53.1    1e-05   
ref|WP_027629563.1|  cell division protein FtsZ [                     53.1    1e-05   
ref|WP_006598481.1|  cell division protein FtsZ                       53.1    2e-05   
gb|ADE58435.1|  cell devision protein                                 50.8    2e-05   
ref|WP_008297313.1|  Cell division protein FtsZ                       53.1    2e-05   
gb|ACR43977.1|  cell division protein FtsZ                            51.2    2e-05   Candidatus Bartonella thailandensis
gb|KGA97006.1|  cell division protein FtsZ                            53.1    2e-05   
gb|ABY64535.1|  cell division protein                                 50.1    2e-05   Candidatus Bartonella eldjazairii
ref|WP_022190998.1|  cell division protein FtsZ                       53.1    2e-05   
ref|WP_035662468.1|  cell division protein FtsZ                       53.1    2e-05   
ref|WP_014758451.1|  MULTISPECIES: cell division protein FtsZ         52.8    2e-05   
ref|WP_013787845.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_015311907.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_021978524.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_013485914.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_001972547.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_037289880.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_039725564.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_019120692.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_011025862.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_003199787.1|  MULTISPECIES: cell division protein FtsZ         52.8    2e-05   
ref|WP_031548434.1|  cell division protein FtsZ                       52.8    2e-05   
gb|KHF33090.1|  Cell division protein FtsZ                            52.4    2e-05   
ref|WP_018975671.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_021856949.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_036946165.1|  cell division protein FtsZ                       52.8    2e-05   
gb|KIH71107.1|  cell division protein FtsZ                            52.8    2e-05   
ref|WP_013277739.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_026799689.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_002165146.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_036624324.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_000888988.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_028537941.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_000888989.1|  cell division protein FtsZ                       52.8    2e-05   
gb|KFM23856.1|  Cell division protein FtsZ-like protein 1, chloro...  52.8    2e-05   
ref|WP_000888992.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_000888983.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_017548457.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_006574902.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_013298223.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_026590251.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_016106026.1|  cell division protein ftsZ                       52.8    2e-05   
ref|WP_000888982.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_026788004.1|  MULTISPECIES: cell division protein FtsZ         52.8    2e-05   
ref|WP_002160704.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_017811789.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_025147788.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_000888991.1|  MULTISPECIES: cell division protein FtsZ         52.8    2e-05   
ref|WP_000888978.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_002121892.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_003758246.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_000888976.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_000888979.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_017186040.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_034635783.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_000888985.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_000888981.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_000888977.1|  MULTISPECIES: cell division protein FtsZ         52.8    2e-05   
ref|WP_034106842.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_018661364.1|  Cell division protein FtsZ                       52.8    2e-05   
gb|KFN03038.1|  cell division protein FtsZ                            52.8    2e-05   
ref|WP_000888987.1|  MULTISPECIES: cell division protein FtsZ         52.8    2e-05   
ref|WP_002066873.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_000888984.1|  MULTISPECIES: cell division protein FtsZ         52.8    2e-05   
ref|WP_016135259.1|  cell division protein ftsZ                       52.8    2e-05   
ref|WP_000888980.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_016116029.1|  cell division protein ftsZ                       52.8    2e-05   
ref|WP_002014730.1|  MULTISPECIES: cell division protein FtsZ         52.8    2e-05   
ref|WP_017687306.1|  MULTISPECIES: cell division protein FtsZ         52.8    2e-05   
ref|WP_007129473.1|  MULTISPECIES: cell division protein FtsZ         52.8    2e-05   
gb|EES72495.1|  cell division protein FtsZ                            52.8    2e-05   Paenibacillus sp. oral taxon 786 str. D14
ref|WP_017151182.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_000888990.1|  cell division protein FtsZ                       52.8    2e-05   
ref|WP_012293164.1|  cell division protein                            50.1    2e-05   
ref|WP_018753246.1|  cell division protein FtsZ                       52.4    2e-05   
ref|WP_020008727.1|  cell division protein FtsZ                       52.4    2e-05   
ref|WP_000888986.1|  MULTISPECIES: cell division protein FtsZ         52.4    2e-05   
ref|WP_022792698.1|  cell division protein FtsZ                       52.4    2e-05   
ref|WP_036645617.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_036621409.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_035996963.1|  cell division protein FtsZ                       52.8    3e-05   
ref|WP_024628412.1|  MULTISPECIES: cell division protein FtsZ         52.4    3e-05   
ref|WP_006209084.1|  MULTISPECIES: cell division protein FtsZ         52.4    3e-05   
dbj|GAK04047.1|  cell division protein FtsZ                           52.4    3e-05   
dbj|GAK14519.1|  cell division protein FtsZ                           52.4    3e-05   
ref|WP_018921335.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_028398924.1|  cell division protein FtsZ                       52.4    3e-05   
emb|CBI28268.3|  unnamed protein product                              50.8    3e-05   
ref|WP_027963109.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_009589569.1|  MULTISPECIES: cell division protein FtsZ         52.4    3e-05   
ref|WP_023058897.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_025715634.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_010345423.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_008902036.1|  cell division protein FtsZ                       52.4    3e-05   
dbj|BAD99307.1|  plastid division protein FtsZ                        52.8    3e-05   
ref|WP_026961672.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_013172594.1|  cell division protein FtsZ [                     52.4    3e-05   
ref|WP_007431185.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_013311084.1|  MULTISPECIES: cell division protein FtsZ         52.4    3e-05   
ref|WP_023989443.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_035429136.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_026485538.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_029985976.1|  cell division protein FtsZ                       49.7    3e-05   
ref|WP_019688024.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_025684642.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_013372084.1|  MULTISPECIES: cell division protein FtsZ         52.4    3e-05   
ref|WP_029284998.1|  MULTISPECIES: cell division protein FtsZ         52.4    3e-05   
ref|WP_026700151.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_021167421.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_005882365.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_014282434.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_031474109.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_012993936.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_015132799.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_036181769.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_020059246.1|  cell division protein FtsZ                       52.4    3e-05   
ref|WP_029976805.1|  cell division protein FtsZ                       49.7    3e-05   
ref|WP_034416711.1|  cell division protein FtsZ                       52.0    3e-05   
dbj|GAK07430.1|  cell division protein FtsZ                           52.0    3e-05   
ref|WP_021919010.1|  cell division protein FtsZ                       52.0    3e-05   
ref|WP_028597011.1|  cell division protein FtsZ                       52.0    3e-05   
ref|WP_035421783.1|  cell division protein FtsZ                       52.0    3e-05   
dbj|GAF16470.1|  LOW QUALITY PROTEIN: cell division protein FtsZ      52.0    4e-05   
ref|WP_023054810.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_022628243.1|  cell division protein FtsZ                       52.0    4e-05   
gb|AHV98374.1|  cell division protein FtsZ                            52.0    4e-05   
ref|WP_006286419.1|  GTPase                                           52.0    4e-05   
ref|WP_018392271.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_012959479.1|  cell division protein FtsZ                       52.0    4e-05   
gb|AIQ54176.1|  cell division protein FtsZ                            52.0    4e-05   
ref|WP_038291315.1|  cell division protein FtsZ, partial [            50.1    4e-05   
dbj|GAJ99636.1|  cell division protein FtsZ                           52.0    4e-05   
ref|WP_034285630.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_022334019.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_036690196.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_025909243.1|  cell division protein FtsZ                       51.6    4e-05   
dbj|GAK39701.1|  cell division protein FtsZ                           52.0    4e-05   
ref|WP_036683633.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_036646713.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_036724269.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_019909324.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_012953910.1|  cell division protein FtsZ                       52.0    4e-05   
gb|AIQ48718.1|  cell division protein FtsZ                            52.0    4e-05   
gb|AIQ31689.1|  cell division protein FtsZ                            52.0    4e-05   
emb|CDN46091.1|  Cell division protein FtsZ                           52.0    4e-05   
ref|WP_038697626.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_025701508.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_025707238.1|  cell division protein FtsZ                       52.0    4e-05   
gb|AIQ60212.1|  cell division protein FtsZ                            52.0    4e-05   
ref|WP_021882365.1|  Cell division protein FtsZ                       52.0    4e-05   
gb|AIQ37250.1|  cell division protein FtsZ                            52.0    4e-05   
gb|ABB02660.1|  cell division protein FtsZ                            51.2    4e-05   
ref|WP_036598772.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_036657855.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_039304277.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_038595356.1|  cell division protein FtsZ                       52.0    4e-05   
ref|WP_019159774.1|  cell division protein FtsZ                       52.0    4e-05   
gb|AIQ13897.1|  cell division protein FtsZ                            51.6    4e-05   
ref|WP_039837031.1|  cell division protein FtsZ                       51.6    4e-05   
gb|AHN20814.1|  cell division protein FtsZ                            52.0    4e-05   
ref|WP_015359817.1|  MULTISPECIES: cell division protein FtsZ         51.6    4e-05   
ref|WP_025699186.1|  cell division protein FtsZ                       51.6    4e-05   
ref|WP_034299168.1|  cell division protein FtsZ                       51.6    4e-05   
ref|WP_024362135.1|  cell division protein FtsZ                       51.6    4e-05   
dbj|BAL73012.1|  cell division protein                                51.2    4e-05   
ref|WP_022113666.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_025692149.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_010858339.1|  cell division protein FtsZ                       51.6    5e-05   
dbj|GAF22208.1|  LOW QUALITY PROTEIN: cell division protein FtsZ      51.6    5e-05   
ref|WP_031572554.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_019242396.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_039716790.1|  cell division protein FtsZ                       52.0    5e-05   
ref|WP_024831392.1|  cell division protein FtsZ [                     51.6    5e-05   
ref|WP_038407660.1|  cell division protein FtsZ                       51.6    5e-05   
dbj|BAK96198.1|  cell division protein                                51.2    5e-05   
ref|WP_038480951.1|  cell division protein FtsZ                       51.6    5e-05   
gb|ABA39711.1|  cell division protein FtsZ-like protein               51.2    5e-05   
gb|AHN19914.1|  cell division protein                                 51.2    5e-05   
ref|WP_015845455.1|  cell division protein FtsZ                       51.6    5e-05   
gb|ABW93768.1|  cell division protein                                 51.2    5e-05   
gb|AAN37696.1|AF467755_1  cell division protein FtsZ-like protein     51.2    5e-05   
ref|WP_003739407.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_014093366.1|  cell division protein FtsZ                       51.6    5e-05   
dbj|BAL73016.1|  cell division protein                                51.2    5e-05   
ref|WP_003728336.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_003731982.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_034287212.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_036085908.1|  cell division protein FtsZ                       51.6    5e-05   
gb|EFR87152.1|  cell division protein FtsZ                            51.6    5e-05   
ref|WP_015154609.1|  cell division protein FtsZ                       51.6    5e-05   
dbj|BAL73013.1|  cell division protein                                51.2    5e-05   
ref|XP_005647947.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_021996294.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_003728828.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_033116221.1|  cell division protein FtsZ                       51.6    5e-05   
dbj|BAK96197.1|  cell division protein                                51.2    5e-05   
gb|ABW93758.1|  cell division protein                                 51.2    5e-05   
ref|WP_034813655.1|  cell division protein FtsZ [                     51.6    5e-05   
gb|AEO86706.1|  cell division protein                                 51.2    5e-05   
ref|WP_036100978.1|  cell division protein FtsZ                       51.6    5e-05   
gb|ABA39713.1|  cell division protein FtsZ-like protein               51.2    5e-05   
gb|AAN37701.1|AF467760_1  cell division protein FtsZ-like protein     51.2    5e-05   
dbj|BAG48881.1|  cell division protein                                51.2    5e-05   
gb|AFY07454.1|  cell division protein                                 51.2    5e-05   
gb|AFY07447.1|  cell division protein                                 51.2    5e-05   
dbj|BAK96204.1|  cell division protein                                51.2    5e-05   
dbj|BAK96201.1|  cell division protein                                51.2    5e-05   
dbj|BAK96195.1|  cell division protein                                51.2    5e-05   
dbj|BAK96193.1|  cell division protein                                51.2    5e-05   
dbj|BAI23106.1|  cell division protein                                51.2    5e-05   
dbj|BAF46396.1|  cell division protein                                51.2    5e-05   
gb|ABA39714.1|  cell division protein FtsZ-like protein               51.2    5e-05   
gb|AAN37700.1|AF467759_1  cell division protein FtsZ-like protein     51.2    5e-05   
ref|WP_015925512.1|  cell division protein FtsZ [                     51.6    5e-05   
ref|WP_004622044.1|  cell division protein FtsZ [                     51.6    5e-05   
gb|AHN19921.1|  cell division protein                                 51.2    5e-05   
gb|AHN19920.1|  cell division protein                                 51.2    5e-05   
ref|WP_015084977.1|  Cell division protein FtsZ                       51.6    5e-05   
ref|WP_009925665.1|  cell division protein FtsZ                       51.6    5e-05   
gb|AHN19952.1|  cell division protein                                 51.2    5e-05   
ref|WP_012986131.1|  cell division protein FtsZ                       51.6    5e-05   
gb|AEX08598.1|  cell division protein                                 51.2    5e-05   
ref|WP_002483541.1|  cell division protein FtsZ                       51.6    5e-05   
gb|AFY07471.1|  cell division protein                                 51.2    5e-05   
ref|WP_011702809.1|  cell division protein FtsZ                       51.6    5e-05   
gb|AHN19919.1|  cell division protein                                 51.2    5e-05   
gb|ADU60338.1|  FtsZ                                                  51.2    5e-05   
dbj|BAL73015.1|  cell division protein                                51.2    5e-05   
dbj|BAI23115.1|  cell division protein                                51.2    5e-05   
dbj|BAG12687.1|  cell division protein                                51.2    5e-05   
dbj|BAG12683.1|  cell division protein                                51.2    5e-05   
gb|AAN37698.1|AF467757_1  cell division protein FtsZ-like protein     51.2    5e-05   
ref|WP_003769589.1|  cell division protein FtsZ                       51.6    5e-05   
gb|EFS02600.1|  cell division protein FtsZ                            51.6    5e-05   
gb|AHN19916.1|  cell division protein                                 51.2    5e-05   
ref|WP_004825376.1|  cell division protein FtsZ                       51.6    5e-05   
ref|WP_019034797.1|  cell division protein FtsZ                       51.6    5e-05   
gb|ADP06539.1|  FtsZ                                                  51.2    5e-05   
gb|AAN77130.1|  cell division protein FtsZ                            51.2    5e-05   
dbj|BAL46527.1|  cell division protein                                51.2    5e-05   
dbj|BAG12675.1|  cell division protein                                51.2    5e-05   
ref|WP_034132050.1|  cell division protein FtsZ                       51.6    5e-05   
gb|AFY07497.1|  cell division protein                                 51.2    5e-05   
ref|WP_018132753.1|  cell division protein FtsZ                       51.6    5e-05   
gb|ABG81107.1|  cell division protein                                 51.2    5e-05   
dbj|BAF46402.1|  cell division protein                                51.2    5e-05   
gb|AHN19951.1|  cell division protein                                 51.2    5e-05   
gb|AHN19933.1|  cell division protein                                 51.2    5e-05   
gb|AHN19927.1|  cell division protein                                 51.2    5e-05   
gb|ADP06535.1|  FtsZ                                                  51.2    5e-05   
gb|AIN41164.1|  cell division protein                                 51.2    5e-05   
ref|WP_006361790.1|  cell division protein FtsZ                       51.6    5e-05   
gb|ADP06537.1|  FtsZ                                                  51.2    5e-05   
gb|AAN37694.1|AF467753_1  cell division protein FtsZ-like protein     51.2    5e-05   
gb|ADX31246.1|  cell division protein                                 51.2    5e-05   
ref|WP_009139303.1|  cell division protein FtsZ                       51.6    5e-05   
gb|ACC44141.1|  FtsZ                                                  51.2    5e-05   
dbj|BAI47756.1|  cell division protein                                51.2    5e-05   
gb|KDD77168.1|  tubulin/FtsZ GTPase                                   51.6    6e-05   
gb|ADP06538.1|  FtsZ                                                  51.2    6e-05   
dbj|BAF46400.1|  cell division protein                                51.2    6e-05   
gb|AAS89956.1|  FtsZ                                                  51.2    6e-05   
dbj|BAL73019.1|  cell division protein                                51.2    6e-05   
dbj|BAK96203.1|  cell division protein                                51.2    6e-05   
gb|AAN37703.1|AF467762_1  cell division protein FtsZ-like protein     51.2    6e-05   
gb|ADW66604.1|  cell division protein                                 51.2    6e-05   
gb|AIY15539.1|  FtsZ                                                  51.2    6e-05   
gb|AFY07478.1|  cell division protein                                 51.2    6e-05   
gb|ADU86029.1|  FtsZ-like protein                                     51.2    6e-05   
ref|WP_026689989.1|  cell division protein FtsZ                       51.6    6e-05   
gb|AHN19924.1|  cell division protein                                 50.8    6e-05   
ref|WP_014313996.1|  cell division protein FtsZ                       51.2    6e-05   
gb|ADX66436.1|  FtsZ                                                  51.2    6e-05   
ref|WP_009381606.1|  cell division protein FtsZ                       51.2    6e-05   
gb|AER41689.1|  cell division protein                                 51.2    6e-05   
ref|WP_029377546.1|  cell division protein FtsZ                       51.2    6e-05   
gb|AHN19930.1|  cell division protein                                 50.8    6e-05   
ref|WP_026964003.1|  cell division protein FtsZ                       51.2    6e-05   
gb|AIN41168.1|  cell division protein                                 51.2    6e-05   
ref|WP_019469315.1|  cell division protein FtsZ                       51.2    6e-05   
gb|ABA39710.1|  cell division protein FtsZ-like protein               50.8    6e-05   
ref|WP_002173153.1|  cell division protein FtsZ                       51.2    6e-05   
ref|WP_002510912.1|  MULTISPECIES: cell division protein FtsZ         51.2    6e-05   
ref|WP_020814396.1|  cell division protein FtsZ [                     51.2    6e-05   
gb|AEO36962.1|  FtsZ                                                  51.2    6e-05   
gb|AIN41177.1|  cell division protein                                 51.2    6e-05   
ref|WP_002472854.1|  cell division protein FtsZ                       51.2    6e-05   
gb|AAN37695.1|AF467754_1  cell division protein FtsZ-like protein     50.8    6e-05   
gb|ADP06536.1|  FtsZ                                                  51.2    6e-05   
gb|AIN41166.1|  cell division protein                                 51.2    6e-05   
ref|WP_017176584.1|  cell division protein FtsZ                       51.2    6e-05   
gb|AAS89958.1|  FtsZ                                                  51.2    6e-05   
gb|ADX66433.1|  FtsZ                                                  51.2    6e-05   
gb|AHN19931.1|  cell division protein                                 50.8    6e-05   
gb|AIN41169.1|  cell division protein                                 51.2    6e-05   
gb|ADM47773.1|  cell devision protein                                 51.2    6e-05   
gb|AHN19938.1|  cell division protein                                 50.8    6e-05   
gb|AIN41167.1|  cell division protein                                 51.2    6e-05   
ref|WP_008516016.1|  cell division protein FtsZ                       51.2    6e-05   
gb|ABV56123.1|  cell division protein                                 51.2    6e-05   
gb|ACN23829.1|  cell division protein                                 51.2    6e-05   
gb|AHB24898.1|  cell division protein                                 51.2    6e-05   
ref|WP_034740750.1|  cell division protein FtsZ                       51.2    6e-05   
ref|WP_004224858.1|  MULTISPECIES: cell division protein FtsZ         51.2    6e-05   
ref|WP_017724216.1|  cell division protein FtsZ                       51.2    6e-05   
ref|WP_005767417.1|  cell division protein FtsZ                       51.6    7e-05   
ref|WP_036202762.1|  cell division protein FtsZ                       51.2    7e-05   
emb|CAM84150.1|  cell division protein                                51.2    7e-05   
ref|WP_022028142.1|  cell division protein FtsZ                       51.2    7e-05   
ref|WP_039066854.1|  cell division protein FtsZ                       51.2    7e-05   



>ref|NP_001275153.1| plastid-dividing ring protein [Solanum tuberosum]
 gb|AAT11924.1| plastid-dividing ring protein [Solanum tuberosum]
Length=419

 Score =   105 bits (263),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGF-HRNNTPSPFFSRQCIFPGPRRRSL----RFYART  187
            MA LGL+N AEL   +S  S+SL F HR +T   F  +QC F G RR+S     RF   +
Sbjct  1    MAILGLSNPAEL---ASSPSSSLTFSHRLHTS--FIPKQCFFTGVRRKSFCRPQRFSISS  55

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            SFT   SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTDAQALV SAAENP+QIGEL
Sbjct  56   SFTPMDSAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALVQSAAENPLQIGEL  115

Query  6    LT  1
            LT
Sbjct  116  LT  117



>ref|NP_001233950.1| plastid-dividing ring protein [Solanum lycopersicum]
 gb|ADB57040.1| plastid-dividing ring protein [Solanum lycopersicum]
Length=419

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 78/121 (64%), Positives = 87/121 (72%), Gaps = 8/121 (7%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL----RFYARTS  184
            MA LGL+N AEL  + S S      HR +  S F  +QC F G RR+S     RF   +S
Sbjct  1    MAILGLSNPAELASSPSSSLAFS--HRLH--SSFIPKQCFFTGVRRKSFCRPQRFSISSS  56

Query  183  FTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELL  4
            FT   SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTDAQALV SAAENP+QIGELL
Sbjct  57   FTPMDSAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALVQSAAENPLQIGELL  116

Query  3    T  1
            T
Sbjct  117  T  117



>ref|XP_009591422.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nicotiana tomentosiformis]
 emb|CAB41987.1| FtsZ-like protein [Nicotiana tabacum]
Length=419

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 87/118 (74%), Gaps = 9/118 (8%)
 Frame = -3

Query  342  LGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL----RFYARTSFTS  175
            LGL+N AE+  ASS SS S  F+     S F  +QC F   RR+SL    RF   +SFT 
Sbjct  5    LGLSNPAEIA-ASSPSSTSFAFYH----SSFIPKQCCFTKARRKSLCKPQRFSISSSFTP  59

Query  174  SASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
              SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTDAQAL+ SAAENP+QIGELLT
Sbjct  60   FDSAKIKVIGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLQSAAENPLQIGELLT  117



>ref|XP_009765068.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=413

 Score = 89.4 bits (220),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 82/116 (71%), Gaps = 12/116 (10%)
 Frame = -3

Query  336  LANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL----RFYARTSFTSSA  169
            ++N AE+      SS S  F+     S F  +QC F   RR+SL    RF   +SFT   
Sbjct  4    ISNPAEIAA----SSPSFAFYH----SSFIPKQCCFTKARRKSLCKPQRFSISSSFTPFD  55

Query  168  SAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTDAQAL+ SAAENP+QIGELLT
Sbjct  56   SAKIKVIGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLQSAAENPLQIGELLT  111



>emb|CAB89287.1| chloroplast FtsZ-like protein [Nicotiana tabacum]
Length=413

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 82/116 (71%), Gaps = 12/116 (10%)
 Frame = -3

Query  336  LANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL----RFYARTSFTSSA  169
            ++N AE+      SS S  F+     S F  +QC F   RR+SL    RF   +SFT   
Sbjct  4    ISNPAEIAA----SSPSFAFYH----SSFIPKQCCFTKARRKSLCKPQRFSISSSFTPFD  55

Query  168  SAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTDAQAL+ SAAENP+QIGELLT
Sbjct  56   SAKIKVIGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLQSAAENPLQIGELLT  111



>ref|XP_010675824.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=421

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 85/123 (69%), Gaps = 10/123 (8%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGP--RRRSLRFYA----R  190
            MA+ GL N+ EL  +   S+    FH   + + FF +   FP    RRR+ + YA     
Sbjct  1    MATFGLTNANELVYSPPISTP---FHSKKSFN-FFPKTLNFPKTSRRRRNGKNYAAFSTY  56

Query  189  TSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGE  10
             SF+   +AKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTDAQAL+ SAAE+PIQIGE
Sbjct  57   CSFSPMETAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYTINTDAQALLQSAAEHPIQIGE  116

Query  9    LLT  1
            LLT
Sbjct  117  LLT  119



>ref|XP_006344879.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Solanum tuberosum]
Length=419

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 84/123 (68%), Gaps = 12/123 (10%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSS  172
            MA LGL+N  ++    S SSNSL F+ +  PS F   Q  FP PR R    Y R  F+ S
Sbjct  1    MAVLGLSNRGDI---LSSSSNSLEFY-HKIPSSFVPTQW-FP-PRTRRKILYKRQHFSIS  54

Query  171  AS------AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGE  10
            +S      AKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTD QAL  S AENPIQIGE
Sbjct  55   SSLSPKNSAKIKVIGVGGGGNNAVNRMIGSGLQGVDFYAINTDTQALSQSTAENPIQIGE  114

Query  9    LLT  1
            LLT
Sbjct  115  LLT  117



>ref|XP_004294407.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=411

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 77/120 (64%), Gaps = 11/120 (9%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPR--RRSL-RFYARTSF  181
            MA+   AN  +L   S+ SS    FH N        R C  P P   R +L R     SF
Sbjct  1    MATTTWANPNDL--ISTSSSIPTAFHHNTL------RTCTIPLPTKTRTALKRHRVSCSF  52

Query  180  TSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
                SAKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTDAQAL+ SAAENP+QIGELLT
Sbjct  53   APMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDAQALLQSAAENPLQIGELLT  112



>ref|XP_006452476.1| hypothetical protein CICLE_v10008445mg [Citrus clementina]
 ref|XP_006474983.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Citrus sinensis]
 gb|ESR65716.1| hypothetical protein CICLE_v10008445mg [Citrus clementina]
 gb|KDO62154.1| hypothetical protein CISIN_1g014946mg [Citrus sinensis]
Length=415

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 82/117 (70%), Gaps = 4/117 (3%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSS  172
            MA+L + N  EL  +S+  +NSL  H NN+ S   SR+ +     +R        SF   
Sbjct  1    MATLQVTNPNELISSSTSFANSL--HYNNSRS--LSRKTMRKSAWKRCRSGNISCSFAPM  56

Query  171  ASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
             +AKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTD+QAL+ SAAENP+QIG+LLT
Sbjct  57   ETAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLQSAAENPLQIGDLLT  113



>ref|XP_009343640.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=421

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = -3

Query  330  NSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL----RF-YARTSFTSSAS  166
            N  EL ++++ SS    FH +N P P   R CI    +RRS     RF     SF    S
Sbjct  6    NPNEL-ISTTSSSIPAAFHHHNKPLPSL-RTCIPLNSKRRSAWKRHRFGVVSCSFAPMES  63

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTD+QAL+ SAAE P+QIGELLT
Sbjct  64   AKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGELLT  118



>ref|XP_009334175.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=421

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = -3

Query  330  NSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL----RF-YARTSFTSSAS  166
            N  EL ++++ SS    FH +N P P   R CI    +RRS     RF     SF    S
Sbjct  6    NPNEL-ISTTSSSIPAAFHHHNKPLPSL-RTCIPLNSKRRSAWERHRFGVVSCSFAPMES  63

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTD+QAL+ SAAE P+QIGELLT
Sbjct  64   AKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGELLT  118



>ref|XP_009334174.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=437

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = -3

Query  330  NSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL----RF-YARTSFTSSAS  166
            N  EL ++++ SS    FH +N P P   R CI    +RRS     RF     SF    S
Sbjct  6    NPNEL-ISTTSSSIPAAFHHHNKPLPSL-RTCIPLNSKRRSAWERHRFGVVSCSFAPMES  63

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTD+QAL+ SAAE P+QIGELLT
Sbjct  64   AKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGELLT  118



>ref|XP_009343639.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=437

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 78/115 (68%), Gaps = 7/115 (6%)
 Frame = -3

Query  330  NSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL----RF-YARTSFTSSAS  166
            N  EL ++++ SS    FH +N P P   R CI    +RRS     RF     SF    S
Sbjct  6    NPNEL-ISTTSSSIPAAFHHHNKPLPSL-RTCIPLNSKRRSAWKRHRFGVVSCSFAPMES  63

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTD+QAL+ SAAE P+QIGELLT
Sbjct  64   AKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGELLT  118



>ref|XP_010270112.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nelumbo nucifera]
Length=503

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 87/145 (60%), Gaps = 22/145 (15%)
 Frame = -3

Query  399  KNEYQNREKKKKER*TMASLGLANSAELGVASSFSSNSL-------GFHRNNTPSPFFSR  241
            KN  + +E K      MA+L L +  +L  +SS S   L       GFH   +P      
Sbjct  67   KNTKKGKEGKVFGLKLMATLHLTSPTQLASSSSISVGFLQKKLFNNGFHIGFSPR-----  121

Query  240  QCIFPGPRRRSLR-----FYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFY  76
                   RRRS           ++F+S  SAKIKV+GVGGGGNNAVNRMI SGLQGV+FY
Sbjct  122  -----ARRRRSWSPSDFGVCCSSAFSSMDSAKIKVVGVGGGGNNAVNRMIGSGLQGVEFY  176

Query  75   SINTDAQALVLSAAENPIQIGELLT  1
            +INTDAQAL+ SAA+NP+QIGELLT
Sbjct  177  AINTDAQALLQSAAKNPLQIGELLT  201



>ref|XP_007146538.1| hypothetical protein PHAVU_006G049100g [Phaseolus vulgaris]
 gb|ESW18532.1| hypothetical protein PHAVU_006G049100g [Phaseolus vulgaris]
Length=418

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 66/91 (73%), Gaps = 1/91 (1%)
 Frame = -3

Query  273  RNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGL  94
            RN  P     R C+F  PRR  L      SF++  SAKIKV+GVGGGGNNAVNRMI  GL
Sbjct  27   RNCVPLNPIPRTCVFASPRR-PLASVRCCSFSALESAKIKVVGVGGGGNNAVNRMIGCGL  85

Query  93   QGVDFYSINTDAQALVLSAAENPIQIGELLT  1
              V+FY+INTDAQAL+ SAAENPI+IGELLT
Sbjct  86   HDVEFYAINTDAQALLKSAAENPIKIGELLT  116



>ref|XP_003551732.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Glycine max]
Length=417

 Score = 80.1 bits (196),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = -3

Query  246  SRQCIFPGPRRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSIN  67
            SR+C F  P+RR        SF++  SAKIKV+GVGGGGNNAVNRMI  GL GV+FY+IN
Sbjct  34   SRRCAFE-PQRRRFASVTCCSFSTVDSAKIKVVGVGGGGNNAVNRMIGCGLHGVEFYAIN  92

Query  66   TDAQALVLSAAENPIQIGELLT  1
            TDAQAL+ SAAENPI+IGELLT
Sbjct  93   TDAQALLHSAAENPIKIGELLT  114



>gb|AAF81220.1| FtsZ1 [Tagetes erecta]
Length=410

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = -3

Query  258  SPFFSRQCIF-PGPRRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVD  82
            SPFF +     P PRR   R     SF S  SAKIKV+GVGGGGNNAVNRMI SGLQGVD
Sbjct  27   SPFFLKSSSHSPNPRRHR-RSAVCCSFASLDSAKIKVVGVGGGGNNAVNRMIGSGLQGVD  85

Query  81   FYSINTDAQALVLSAAENPIQIGELLT  1
            FY+INTD+QAL+ S A NPIQIGELLT
Sbjct  86   FYAINTDSQALLQSVAHNPIQIGELLT  112



>ref|XP_004149587.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Cucumis sativus]
 gb|KGN56071.1| hypothetical protein Csa_3G064200 [Cucumis sativus]
Length=421

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 69/93 (74%), Gaps = 3/93 (3%)
 Frame = -3

Query  279  FHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINS  100
            F  +N PSP  +++     P RR        SF+   SAKIKV+GVGGGGNNAVNRMI S
Sbjct  27   FFPSNFPSPSIAKRKF---PSRRHHLAVVGCSFSPMESAKIKVVGVGGGGNNAVNRMIGS  83

Query  99   GLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            GL+GVDFY+INTD+QAL+ SAAENP+QIGELLT
Sbjct  84   GLKGVDFYAINTDSQALLQSAAENPLQIGELLT  116



>ref|XP_004166970.1| PREDICTED: LOW QUALITY PROTEIN: cell division protein FtsZ homolog 
1, chloroplastic-like [Cucumis sativus]
Length=421

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 69/93 (74%), Gaps = 3/93 (3%)
 Frame = -3

Query  279  FHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINS  100
            F  +N PSP  +++     P RR        SF+   SAKIKV+GVGGGGNNAVNRMI S
Sbjct  27   FFPSNFPSPSIAKRKF---PSRRHHLAVVGCSFSPMESAKIKVVGVGGGGNNAVNRMIGS  83

Query  99   GLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            GL+GVDFY+INTD+QAL+ SAAENP+QIGELLT
Sbjct  84   GLKGVDFYAINTDSQALLQSAAENPLQIGELLT  116



>ref|XP_004251908.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X2 [Solanum lycopersicum]
Length=419

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 86/125 (69%), Gaps = 16/125 (13%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGF----HRNNTPSPFFSRQCIFPGPRRRSL----RFY  196
            MA LGL+N  ++    S SSNSL F    H ++ P+ +F      P  RR+ L    RF 
Sbjct  1    MAVLGLSNRGDI---LSSSSNSLEFYHKIHSSSVPTQWFP-----PRTRRKILYKRHRFS  52

Query  195  ARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQI  16
              +S +S  SAKIKV+GVGGGGNNAVNRMI+SGLQGVDFYS+NTD QAL  S AENPIQI
Sbjct  53   ISSSLSSKNSAKIKVIGVGGGGNNAVNRMIDSGLQGVDFYSMNTDTQALSQSTAENPIQI  112

Query  15   GELLT  1
            GELLT
Sbjct  113  GELLT  117



>emb|CDY19897.1| BnaC09g31630D [Brassica napus]
Length=411

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 78/117 (67%), Gaps = 9/117 (8%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSS  172
            MA   LA   EL V+SSF + S   H +     F          +RRS     R SF+  
Sbjct  1    MAISPLAQLNELRVSSSFVATSHSLHSSRINGGF---------SKRRSKPTRLRCSFSPM  51

Query  171  ASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
             SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S+A+NP+QIGELLT
Sbjct  52   ESARIKVVGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQSSAQNPLQIGELLT  108



>gb|KHN30883.1| Cell division protein FtsZ like 1, chloroplastic [Glycine soja]
Length=419

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 65/82 (79%), Gaps = 1/82 (1%)
 Frame = -3

Query  246  SRQCIFPGPRRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSIN  67
            SR+C F  P+RR        SF++  SAKIKV+GVGGGGNNAVNRMI  GL GV+FY+IN
Sbjct  34   SRRCAFE-PQRRRFASVTCCSFSTVDSAKIKVVGVGGGGNNAVNRMIGCGLHGVEFYAIN  92

Query  66   TDAQALVLSAAENPIQIGELLT  1
            TDAQAL+ SAAENPI+IGELLT
Sbjct  93   TDAQALLHSAAENPIKIGELLT  114



>ref|XP_010313930.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
Length=429

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 86/125 (69%), Gaps = 16/125 (13%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGF----HRNNTPSPFFSRQCIFPGPRRRSL----RFY  196
            MA LGL+N  ++    S SSNSL F    H ++ P+ +F      P  RR+ L    RF 
Sbjct  1    MAVLGLSNRGDI---LSSSSNSLEFYHKIHSSSVPTQWFP-----PRTRRKILYKRHRFS  52

Query  195  ARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQI  16
              +S +S  SAKIKV+GVGGGGNNAVNRMI+SGLQGVDFYS+NTD QAL  S AENPIQI
Sbjct  53   ISSSLSSKNSAKIKVIGVGGGGNNAVNRMIDSGLQGVDFYSMNTDTQALSQSTAENPIQI  112

Query  15   GELLT  1
            GELLT
Sbjct  113  GELLT  117



>ref|XP_010313931.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X3 [Solanum lycopersicum]
Length=399

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 86/125 (69%), Gaps = 16/125 (13%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGF----HRNNTPSPFFSRQCIFPGPRRRSL----RFY  196
            MA LGL+N  ++    S SSNSL F    H ++ P+ +F      P  RR+ L    RF 
Sbjct  1    MAVLGLSNRGDI---LSSSSNSLEFYHKIHSSSVPTQWFP-----PRTRRKILYKRHRFS  52

Query  195  ARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQI  16
              +S +S  SAKIKV+GVGGGGNNAVNRMI+SGLQGVDFYS+NTD QAL  S AENPIQI
Sbjct  53   ISSSLSSKNSAKIKVIGVGGGGNNAVNRMIDSGLQGVDFYSMNTDTQALSQSTAENPIQI  112

Query  15   GELLT  1
            GELLT
Sbjct  113  GELLT  117



>emb|CDY17316.1| BnaA10g09500D [Brassica napus]
Length=411

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 80/117 (68%), Gaps = 9/117 (8%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSS  172
            MA   LA   EL ++SSF + S   H     S  FS+Q        RS +   R SF+  
Sbjct  1    MAISPLAQLNELPISSSFLATSHSLHSTRI-SGGFSKQ--------RSKQTRLRCSFSPM  51

Query  171  ASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
             SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S+A+NP+QIGELLT
Sbjct  52   ESARIKVVGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQSSAQNPLQIGELLT  108



>ref|XP_003600215.1| Cell division protein FtsZ [Medicago truncatula]
 gb|AES70466.1| cell division FtsZ-like protein [Medicago truncatula]
Length=413

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 4/84 (5%)
 Frame = -3

Query  243  RQCIFPGPRRRSLRFYAR---TSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYS  73
            R CI   PR+ +LR   +    SF S  +AKIKV+GVGGGGNNAVNRMI  GLQGVDFY+
Sbjct  28   RNCISLNPRK-TLRHRLKPVSCSFESIDNAKIKVVGVGGGGNNAVNRMIGCGLQGVDFYA  86

Query  72   INTDAQALVLSAAENPIQIGELLT  1
            INTDAQAL+ SAAENPI+IGELLT
Sbjct  87   INTDAQALLHSAAENPIKIGELLT  110



>gb|AFK39538.1| unknown [Lotus japonicus]
Length=416

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 85/122 (70%), Gaps = 9/122 (7%)
 Frame = -3

Query  351  MASL-GLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIF---PGPRRRSLRFYA-RT  187
            MA+L  L N  EL  +SSF  N+L    + +PS   +   I      P+R + RF + R 
Sbjct  1    MATLPSLTNPNELPSSSSFYHNAL----STSPSVSLNTTRITRVASTPQRLTRRFRSVRC  56

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            SF S  +AKIKV+G+GGGGNNAVNRMI SGLQGVDFY+INTDAQALV S AENPI+IGEL
Sbjct  57   SFASVENAKIKVVGIGGGGNNAVNRMIGSGLQGVDFYAINTDAQALVHSVAENPIKIGEL  116

Query  6    LT  1
            LT
Sbjct  117  LT  118



>ref|XP_009361066.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=420

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  PRRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVL  43
            PR+RS       SF  + SAKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTDAQAL+ 
Sbjct  44   PRKRSRFGVVSCSFVPTESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDAQALLQ  103

Query  42   SAAENPIQIGELLT  1
            SAAE P+QIGELLT
Sbjct  104  SAAEYPLQIGELLT  117



>gb|EYU27393.1| hypothetical protein MIMGU_mgv1a007772mg [Erythranthe guttata]
Length=395

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 77/110 (70%), Gaps = 11/110 (10%)
 Frame = -3

Query  312  VASSFSSNSLGFHR-NNTPSPFFSRQ-----CIFPGPRRRSLRFYARTSFTSSASAKIKv  151
            +ASS +S S+G     +T S  FSR      C F   +R S   Y   S T   SAKIKV
Sbjct  1    MASSTTSISIGCSELTSTRSICFSRSRRKSFCNF---KRHSSGVYC--SLTPMDSAKIKV  55

Query  150  lgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            +GVGGGGNNAVNRMI SGL+GVDFY+INTDAQAL+ S+AENPIQIGELLT
Sbjct  56   VGVGGGGNNAVNRMIGSGLRGVDFYAINTDAQALLQSSAENPIQIGELLT  105



>ref|XP_009625657.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=412

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 64/83 (77%), Gaps = 7/83 (8%)
 Frame = -3

Query  240  QCIFPGPRRRSLRFYARTSFT---SSASAKIKvlgvggggnnavNRMINSGLQGVDFYSI  70
            QC  P    +SLR   R  F+   S +SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY++
Sbjct  32   QCFSP----KSLRKRQRQRFSICSSLSSAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAV  87

Query  69   NTDAQALVLSAAENPIQIGELLT  1
            NTDAQAL+ S  ENPIQIGELLT
Sbjct  88   NTDAQALLQSTVENPIQIGELLT  110



>ref|XP_010099992.1| Cell division protein FtsZ-1-like protein [Morus notabilis]
 gb|EXB81097.1| Cell division protein FtsZ-1-like protein [Morus notabilis]
Length=423

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -3

Query  219  RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLS  40
            +R         SF    +AKIKV+GVGGGG+NAVNRMI SGLQGVDFY+INTDAQALV S
Sbjct  47   KRHRFDAVVSCSFQPMETAKIKVVGVGGGGSNAVNRMIGSGLQGVDFYAINTDAQALVHS  106

Query  39   AAENPIQIGELLT  1
            AAENP+QIGELLT
Sbjct  107  AAENPLQIGELLT  119



>gb|KHM99513.1| Cell division protein FtsZ like 1, chloroplastic [Glycine soja]
Length=419

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 9/101 (9%)
 Frame = -3

Query  276  HRNNTPSPFFSRQCIFPGPRRRSL-------RFYART--SFTSSASAKIKvlgvggggnn  124
            H   + S F  R+C+   PR R+        RF + T  SF++  SAKIKV+GVGGGGNN
Sbjct  14   HNALSSSSFVQRKCVSLIPRIRTCDSEPQRRRFASVTCCSFSTLDSAKIKVVGVGGGGNN  73

Query  123  avNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AVNRMI  GL GV+FY+INTDAQAL+ S+AENPI+IGELLT
Sbjct  74   AVNRMIGCGLHGVEFYAINTDAQALLHSSAENPIKIGELLT  114



>ref|XP_006586107.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Glycine max]
Length=417

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 72/101 (71%), Gaps = 9/101 (9%)
 Frame = -3

Query  276  HRNNTPSPFFSRQCIFPGPRRRSL-------RFYART--SFTSSASAKIKvlgvggggnn  124
            H   + S F  R+C+   PR R+        RF + T  SF++  SAKIKV+GVGGGGNN
Sbjct  14   HNALSSSSFVQRKCVSLIPRIRTCDSEPQRRRFASVTCCSFSTLDSAKIKVVGVGGGGNN  73

Query  123  avNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AVNRMI  GL GV+FY+INTDAQAL+ S+AENPI+IGELLT
Sbjct  74   AVNRMIGCGLHGVEFYAINTDAQALLHSSAENPIKIGELLT  114



>gb|EYU33680.1| hypothetical protein MIMGU_mgv1a008311mg [Erythranthe guttata]
Length=378

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 60/73 (82%), Gaps = 2/73 (3%)
 Frame = -3

Query  219  RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLS  40
            RRRS   Y   SF    +A+IKV+GVGGGGNNAVNRMI SGLQGVDFY++NTDAQAL+ S
Sbjct  51   RRRSGGVYC--SFIPMDTARIKVIGVGGGGNNAVNRMIGSGLQGVDFYAVNTDAQALLQS  108

Query  39   AAENPIQIGELLT  1
             AENPIQIGELLT
Sbjct  109  VAENPIQIGELLT  121



>ref|XP_009765135.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nicotiana sylvestris]
Length=412

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 83/119 (70%), Gaps = 11/119 (9%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGP--RRRSLRFYARTSFT  178
            MA LGL+++  + + SS S++   +H     S  F+ QC  P    +R+  RF   +S +
Sbjct  1    MAMLGLSSNTGIDILSSSSNSLSFYH-----STRFT-QCFSPKSLCKRQRRRFSICSSLS  54

Query  177  SSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            S   AKIKV+GVGGGGNNAVNRMI SGLQGVDFY++NTDAQAL+ S  ENPIQIGELLT
Sbjct  55   S---AKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAVNTDAQALLQSTVENPIQIGELLT  110



>ref|XP_008449114.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Cucumis melo]
Length=425

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  PRRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVL  43
            P RR        SF+   SAKIKV+GVGGGGNNAVNRMI SGL+GVDFY+INTD+QAL+ 
Sbjct  46   PSRRHHLAVVGCSFSPMESAKIKVVGVGGGGNNAVNRMIGSGLKGVDFYAINTDSQALLQ  105

Query  42   SAAENPIQIGELLT  1
            SAAENP+QIGELLT
Sbjct  106  SAAENPLQIGELLT  119



>ref|XP_009120048.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Brassica rapa]
Length=411

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 79/117 (68%), Gaps = 9/117 (8%)
 Frame = -3

Query  351  MASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSS  172
            MA   LA   EL ++SSF + S   H     +  FS+Q   P P R       R SF+  
Sbjct  1    MAISPLAQLNELPISSSFLATSHSLHSTRI-NGGFSKQR--PKPTR------LRCSFSPM  51

Query  171  ASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
             SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S+A NP+QIGELLT
Sbjct  52   ESARIKVVGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQSSAHNPLQIGELLT  108



>gb|EPS68972.1| plastid-dividing ring protein, partial [Genlisea aurea]
Length=361

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            SFT   +A+IKV+GVGGGGNNAVNRMI SGL+GVDFY+INTDAQAL+ SAAENPIQIGEL
Sbjct  1    SFTPMETARIKVVGVGGGGNNAVNRMIGSGLKGVDFYAINTDAQALLQSAAENPIQIGEL  60

Query  6    LT  1
            LT
Sbjct  61   LT  62



>ref|XP_008366436.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X2 [Malus domestica]
Length=424

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 80/123 (65%), Gaps = 10/123 (8%)
 Frame = -3

Query  354  TMASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL----RF-YAR  190
            TMA+    N  EL + ++ SS    FH +  P P   R CI    +RRS     RF    
Sbjct  4    TMAAW--XNPNEL-IXTTSSSIPAAFHHHK-PLPSL-RTCIPLSSKRRSAWKRHRFGVVS  58

Query  189  TSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGE  10
             SF    SAKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTD+QAL+ SAAE P+QIGE
Sbjct  59   CSFAPMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGE  118

Query  9    LLT  1
            LLT
Sbjct  119  LLT  121



>gb|KDP39208.1| hypothetical protein JCGZ_00965 [Jatropha curcas]
Length=415

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            SF    SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTDAQALV SAA+NP+QIGEL
Sbjct  51   SFAPMESAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALVQSAAQNPLQIGEL  110

Query  6    LT  1
            LT
Sbjct  111  LT  112



>ref|XP_011097822.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
isoform X2 [Sesamum indicum]
Length=338

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  204  RFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENP  25
            R   + SF    SAKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTDAQAL+ SAAENP
Sbjct  55   RSGVQCSFIPMDSAKIKVVGVGGGGNNAVNRMIGSGLSGVDFYAINTDAQALLQSAAENP  114

Query  24   IQIGELLT  1
            IQIGELLT
Sbjct  115  IQIGELLT  122



>ref|XP_008366435.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X1 [Malus domestica]
Length=440

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 80/123 (65%), Gaps = 10/123 (8%)
 Frame = -3

Query  354  TMASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL----RF-YAR  190
            TMA+    N  EL + ++ SS    FH +  P P   R CI    +RRS     RF    
Sbjct  4    TMAAW--XNPNEL-IXTTSSSIPAAFHHHK-PLPSL-RTCIPLSSKRRSAWKRHRFGVVS  58

Query  189  TSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGE  10
             SF    SAKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTD+QAL+ SAAE P+QIGE
Sbjct  59   CSFAPMESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDSQALLQSAAEYPLQIGE  118

Query  9    LLT  1
            LLT
Sbjct  119  LLT  121



>ref|XP_007211741.1| hypothetical protein PRUPE_ppa006258mg [Prunus persica]
 gb|EMJ12940.1| hypothetical protein PRUPE_ppa006258mg [Prunus persica]
Length=420

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 73/109 (67%), Gaps = 7/109 (6%)
 Frame = -3

Query  312  VASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL---RFYARTS--FTSSASAKIKvl  148
            ++++ S+    FH +     F  R CI    +RRS    R +   S  F    SAKIKV+
Sbjct  11   ISTTSSTIPTAFHHHKAVPSF--RTCISLSSKRRSALKRRCFGVVSCSFAPMESAKIKVV  68

Query  147  gvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            GVGGGGNNAVNRMI SGL GVDFY+INTDAQAL+ SAAE P+QIGELLT
Sbjct  69   GVGGGGNNAVNRMIGSGLHGVDFYAINTDAQALLQSAAEYPLQIGELLT  117



>ref|XP_002276623.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Vitis vinifera]
Length=422

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 60/73 (82%), Gaps = 2/73 (3%)
 Frame = -3

Query  219  RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLS  40
            +RR  RF    SF    SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTD+QAL+ S
Sbjct  49   KRR--RFGVCCSFAPMESAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLHS  106

Query  39   AAENPIQIGELLT  1
            AA NP+QIGELLT
Sbjct  107  AASNPLQIGELLT  119



>gb|AFC37491.1| FtsZ1 protein [Manihot esculenta]
Length=415

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = -3

Query  288  SLGFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRM  109
            S   HR  + S    R  ++   R RS       SF    SAKIKV+GVGGGGNNAVNRM
Sbjct  19   STSLHRKFSISQRTGRSSVWK--RYRSGSGSVSCSFAPVESAKIKVVGVGGGGNNAVNRM  76

Query  108  INSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            I SGLQGVDFY+INTD+QAL+ SAA+NP+QIGELLT
Sbjct  77   IGSGLQGVDFYAINTDSQALLQSAAQNPLQIGELLT  112



>emb|CDP13769.1| unnamed protein product [Coffea canephora]
Length=153

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  SAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTDAQAL+ SAA NPIQIGELLT
Sbjct  3    SAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDAQALLQSAAGNPIQIGELLT  58



>ref|XP_010482963.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Camelina sativa]
Length=426

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = -3

Query  222  PRRRSLRFYA-RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALV  46
            P+RRS      R SF+   SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+
Sbjct  49   PKRRSGSTKGLRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALI  108

Query  45   LSAAENPIQIGELLT  1
             S+AENP+QIGELLT
Sbjct  109  QSSAENPLQIGELLT  123



>ref|XP_011097821.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
isoform X1 [Sesamum indicum]
Length=424

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = -3

Query  204  RFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENP  25
            R   + SF    SAKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTDAQAL+ SAAENP
Sbjct  55   RSGVQCSFIPMDSAKIKVVGVGGGGNNAVNRMIGSGLSGVDFYAINTDAQALLQSAAENP  114

Query  24   IQIGELLT  1
            IQIGELLT
Sbjct  115  IQIGELLT  122



>ref|XP_008227026.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Prunus mume]
Length=419

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 77/115 (67%), Gaps = 9/115 (8%)
 Frame = -3

Query  330  NSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSL---RFYARTS--FTSSAS  166
            N  EL ++++ S+    FH +     F  R CI P  R+RS    R +   S  F    S
Sbjct  6    NPNEL-ISTTSSTIPTAFHHHKAVPSF--RTCI-PLSRKRSALKRRCFGVVSCSFAPMES  61

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTDAQAL+ SAAE P+QIGELLT
Sbjct  62   AKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDAQALLQSAAEYPLQIGELLT  116



>ref|NP_200339.1| cell division protein ftsZ-like protein 1 [Arabidopsis thaliana]
 sp|Q42545.2|FTSZ1_ARATH RecName: Full=Cell division protein FtsZ homolog 1, chloroplastic; 
Short=AtFtsZ1; Short=AtFtsZ1-1; Short=Chloroplast FtsZ; 
Short=CpFtsZ; AltName: Full=Protein ACCUMULATION AND REPLICATION 
OF CHLOROPLASTS 10; AltName: Full=Protein PLASTID MOVEMENT 
IMPAIRED4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08597.1| cell division protein FtsZ chloroplast homolog precursor [Arabidopsis 
thaliana]
 gb|AAK59497.1| putative cell division protein FtsZ chloroplast homolog precursor 
[Arabidopsis thaliana]
 gb|AAM44944.1| putative cell division protein FtsZ chloroplast homolog precursor 
[Arabidopsis thaliana]
 gb|AED96609.1| cell division protein ftsZ-like protein 1 [Arabidopsis thaliana]
Length=433

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 63/73 (86%), Gaps = 2/73 (3%)
 Frame = -3

Query  219  RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLS  40
            R +S+R   R SF+   SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S
Sbjct  58   RSKSMRL--RCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQS  115

Query  39   AAENPIQIGELLT  1
            +AENP+QIGELLT
Sbjct  116  SAENPLQIGELLT  128



>ref|XP_002866084.1| ftsz1-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42343.1| ftsz1-1 [Arabidopsis lyrata subsp. lyrata]
Length=433

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 63/73 (86%), Gaps = 2/73 (3%)
 Frame = -3

Query  219  RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLS  40
            R +S+R   R SF+   SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S
Sbjct  58   RSKSMRL--RCSFSPMESARIKVVGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQS  115

Query  39   AAENPIQIGELLT  1
            +AENP+QIGELLT
Sbjct  116  SAENPLQIGELLT  128



>gb|AAF23770.1|AF205858_1 FtsZ-like protein 2 [Nicotiana tabacum]
Length=413

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 5/82 (6%)
 Frame = -3

Query  240  QCIFPGP--RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSIN  67
            QC  P    +R+  RF   +S +S   AKIKV+GVGGGGNNAVNRMI SGLQGVDFY++N
Sbjct  33   QCFSPKSLCKRQRRRFSICSSLSS---AKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAVN  89

Query  66   TDAQALVLSAAENPIQIGELLT  1
            TDAQAL+ S  ENPIQIGELLT
Sbjct  90   TDAQALLQSTVENPIQIGELLT  111



>emb|CAB89286.1| chloroplast FtsZ-like protein [Nicotiana tabacum]
Length=408

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 5/82 (6%)
 Frame = -3

Query  240  QCIFPGP--RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSIN  67
            QC  P    +R+  RF   +S +S   AKIKV+GVGGGGNNAVNRMI SGLQGVDFY++N
Sbjct  28   QCFSPKSLCKRQRRRFSICSSLSS---AKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAVN  84

Query  66   TDAQALVLSAAENPIQIGELLT  1
            TDAQAL+ S  ENPIQIGELLT
Sbjct  85   TDAQALLQSTVENPIQIGELLT  106



>ref|XP_007020677.1| Bacterial cytokinesis Z-ring protein FTSZ 1-1 isoform 2 [Theobroma 
cacao]
 gb|EOY12202.1| Bacterial cytokinesis Z-ring protein FTSZ 1-1 isoform 2 [Theobroma 
cacao]
Length=407

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            SF    +AKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTD+QAL+ SAAENP+QIGEL
Sbjct  50   SFAPMETAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLQSAAENPLQIGEL  109

Query  6    LT  1
            LT
Sbjct  110  LT  111



>gb|KHG27532.1| Cell division FtsZ, chloroplastic -like protein [Gossypium arboreum]
Length=399

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            SF    +AKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTD+QAL+ SAAENP+QIGEL
Sbjct  51   SFAPMETAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLQSAAENPLQIGEL  110

Query  6    LT  1
            LT
Sbjct  111  LT  112



>ref|XP_007020676.1| Bacterial cytokinesis Z-ring protein FTSZ 1-1 isoform 1 [Theobroma 
cacao]
 gb|EOY12201.1| Bacterial cytokinesis Z-ring protein FTSZ 1-1 isoform 1 [Theobroma 
cacao]
Length=470

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            SF    +AKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTD+QAL+ SAAENP+QIGEL
Sbjct  107  SFAPMETAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLQSAAENPLQIGEL  166

Query  6    LT  1
            LT
Sbjct  167  LT  168



>ref|XP_004500118.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Cicer arietinum]
Length=425

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = -3

Query  222  PRRRSLRFY-ARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALV  46
            PRRR   F     SF+S  +AKIKV+GVGGGGNNAVNRMI  GLQGVDFY+INTDAQAL+
Sbjct  51   PRRR---FRPVNCSFSSIDNAKIKVVGVGGGGNNAVNRMIGCGLQGVDFYAINTDAQALL  107

Query  45   LSAAENPIQIGELLT  1
             S+AENPI+IGELLT
Sbjct  108  HSSAENPIKIGELLT  122



>ref|XP_002300342.2| cell division family protein [Populus trichocarpa]
 gb|EEE85147.2| cell division family protein [Populus trichocarpa]
Length=410

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = -3

Query  237  CIFPGPRRRSLRFYARTS--FTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINT  64
            C F   RR S   +   S  F    SAKIKV+GVGGGGNNAVNRMI S LQG+DFY+INT
Sbjct  27   CRFSQKRRLSSSKHGSVSCSFAPMESAKIKVVGVGGGGNNAVNRMIGSDLQGIDFYAINT  86

Query  63   DAQALVLSAAENPIQIGELLT  1
            DAQALV SAA+NP+QIGELLT
Sbjct  87   DAQALVQSAAQNPLQIGELLT  107



>ref|XP_003544739.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Glycine max]
Length=418

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = -3

Query  303  SFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRF-YARTSFTSSASAKIKvlgvggggn  127
            S S +S+  H   T S  F  +     P+R S RF   R S+    +AKIKV+G+GGGGN
Sbjct  17   SLSCSSIFHHHAFTTSVSFKPRTTKIAPQRLSRRFGSVRCSYAYVDNAKIKVVGIGGGGN  76

Query  126  navNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            NAVNRMI SGLQGVDFY+INTDAQAL+ SAAENPI+IGE+LT
Sbjct  77   NAVNRMIGSGLQGVDFYAINTDAQALLNSAAENPIKIGEVLT  118



>ref|XP_009127013.1| PREDICTED: LOW QUALITY PROTEIN: cell division protein FtsZ homolog 
1, chloroplastic-like [Brassica rapa]
Length=427

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 78/113 (69%), Gaps = 15/113 (13%)
 Frame = -3

Query  336  LANSAELGVASSFSSNSL-GFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSSASAK  160
            LANS    + SSF+S  + GF +  + S            + +SLR   R SF+   +AK
Sbjct  24   LANSISNSLHSSFTSTRISGFTKRRSDS------------KSKSLRL--RCSFSPMETAK  69

Query  159  IKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S+A+ P+QIGELLT
Sbjct  70   IKVVGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQSSAQTPLQIGELLT  122



>gb|KHN43855.1| Cell division protein FtsZ like 1, chloroplastic [Glycine soja]
Length=418

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = -3

Query  303  SFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRF-YARTSFTSSASAKIKvlgvggggn  127
            S S +S+  H   T S   + +     PRR S RF   R S+    +AKIKV+G+GGGGN
Sbjct  17   SLSCSSIFHHNALTTSVSLNPRTTKIAPRRLSRRFGSVRCSYAYVDNAKIKVVGIGGGGN  76

Query  126  navNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            NAVNRMI SGLQGVDFY+INTDAQAL+ SAAENPI+IGE+LT
Sbjct  77   NAVNRMIGSGLQGVDFYAINTDAQALLNSAAENPIKIGEVLT  118



>gb|ACU24263.1| unknown [Glycine max]
Length=285

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = -3

Query  303  SFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRF-YARTSFTSSASAKIKvlgvggggn  127
            S S +S+  H   T S   + +     P+R S RF   R S+    +AKIKV+G+GGGGN
Sbjct  17   SLSCSSIFHHNALTTSVSLNPRTTKIAPQRLSRRFGSVRCSYAYVDNAKIKVVGIGGGGN  76

Query  126  navNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            NAVNRMI SGLQGVDFY+INTDAQAL+ SAAENPI+IGE+LT
Sbjct  77   NAVNRMIGSGLQGVDFYAINTDAQALLNSAAENPIKIGEVLT  118



>gb|KHN23882.1| Cell division protein FtsZ like 1, chloroplastic [Glycine soja]
Length=418

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = -3

Query  303  SFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRF-YARTSFTSSASAKIKvlgvggggn  127
            S S +S+  H   T S  F  +     P+R S RF   R S+    +AKIKV+G+GGGGN
Sbjct  17   SLSCSSIFHHNAFTTSVSFKPRTTKIAPQRLSRRFGSVRCSYAYVDNAKIKVVGIGGGGN  76

Query  126  navNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            NAVNRMI SGLQGVDFY+INTDAQAL+ SAAENPI+IGE+LT
Sbjct  77   NAVNRMIGSGLQGVDFYAINTDAQALLNSAAENPIKIGEVLT  118



>gb|ACG70179.1| chloroplast FtsZ1-1 [Brassica oleracea var. botrytis]
 emb|CDY06595.1| BnaC02g13190D [Brassica napus]
Length=425

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 78/113 (69%), Gaps = 15/113 (13%)
 Frame = -3

Query  336  LANSAELGVASSFSSNSL-GFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSSASAK  160
            LANS    + SSF+S  + GF +  + S            + +SLR   R SF+   +AK
Sbjct  22   LANSISNSLHSSFASTRISGFPKRRSDS------------KSKSLRL--RCSFSPMETAK  67

Query  159  IKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S+A+ P+QIGELLT
Sbjct  68   IKVVGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQSSAQTPLQIGELLT  120



>ref|XP_011047540.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Populus euphratica]
Length=410

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = -3

Query  237  CIFPGPRRRSLRFYARTS--FTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINT  64
            C F   RR S   +   S  F    SAKIKV+GVGGGGNNAVNRMI S LQG+DFY+INT
Sbjct  27   CRFSQRRRLSSSKHGSVSCSFAPMESAKIKVVGVGGGGNNAVNRMIGSDLQGIDFYAINT  86

Query  63   DAQALVLSAAENPIQIGELLT  1
            DAQALV SAA+NP+QIGELLT
Sbjct  87   DAQALVQSAAQNPLQIGELLT  107



>ref|XP_008364389.1| PREDICTED: LOW QUALITY PROTEIN: cell division protein FtsZ homolog 
1, chloroplastic-like [Malus domestica]
 ref|XP_008355316.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Malus domestica]
Length=421

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  PRRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVL  43
            P +R        SF  + SAKIKV+GVGGGGNNAVNRMI SGL GVDFY+INTDAQAL+ 
Sbjct  45   PXKRYRFGVVSCSFAPTESAKIKVVGVGGGGNNAVNRMIGSGLHGVDFYAINTDAQALLQ  104

Query  42   SAAENPIQIGELLT  1
            SAAE P+QIGELLT
Sbjct  105  SAAEYPLQIGELLT  118



>ref|XP_002531210.1| Cell division protein ftsZ, putative [Ricinus communis]
 gb|EEF31187.1| Cell division protein ftsZ, putative [Ricinus communis]
Length=412

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            SF    SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTD+QAL+ SAA+NP+QIGEL
Sbjct  48   SFAPIESAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLQSAAQNPLQIGEL  107

Query  6    LT  1
            LT
Sbjct  108  LT  109



>ref|XP_010449352.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Camelina sativa]
Length=427

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 63/74 (85%), Gaps = 1/74 (1%)
 Frame = -3

Query  219  RRRSLRFYA-RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVL  43
            +RRS+     R SF+   SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ 
Sbjct  51   KRRSISTRGLRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALIQ  110

Query  42   SAAENPIQIGELLT  1
            S+A+NP+QIGELLT
Sbjct  111  SSADNPLQIGELLT  124



>ref|XP_006401472.1| hypothetical protein EUTSA_v10013612mg [Eutrema salsugineum]
 gb|ESQ42925.1| hypothetical protein EUTSA_v10013612mg [Eutrema salsugineum]
Length=430

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 2/73 (3%)
 Frame = -3

Query  219  RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLS  40
            R + +R   R SF+   SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S
Sbjct  56   RSKPMRL--RCSFSPMESARIKVVGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQS  113

Query  39   AAENPIQIGELLT  1
            +AENP+QIGELLT
Sbjct  114  SAENPLQIGELLT  126



>ref|XP_006280511.1| hypothetical protein CARUB_v10026448mg [Capsella rubella]
 gb|EOA13409.1| hypothetical protein CARUB_v10026448mg [Capsella rubella]
Length=430

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 60/71 (85%), Gaps = 0/71 (0%)
 Frame = -3

Query  213  RSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAA  34
            RS     R SF+   SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S+A
Sbjct  57   RSKSMGWRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQSSA  116

Query  33   ENPIQIGELLT  1
            ENP+QIGELLT
Sbjct  117  ENPLQIGELLT  127



>ref|XP_008798743.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Phoenix dactylifera]
Length=411

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 7/80 (9%)
 Frame = -3

Query  219  RRRSLRF----YARTSFTSSA---SAKIKvlgvggggnnavNRMINSGLQGVDFYSINTD  61
            RRR+ R+      R S++S A   SA+IKV+GVGGGGNNAVNRMI SGLQGV+FY+INTD
Sbjct  35   RRRAFRWRGGSTVRCSYSSFAPVDSARIKVVGVGGGGNNAVNRMIGSGLQGVEFYAINTD  94

Query  60   AQALVLSAAENPIQIGELLT  1
            +QAL+LS A+NP+QIGELLT
Sbjct  95   SQALLLSQAKNPLQIGELLT  114



>ref|XP_010536696.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Tarenaya hassleriana]
Length=425

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            SF    SA+IKV+GVGGGGNNAVNRMI+SGLQGVDFY+INTD+QAL+ SAA+NP+QIGEL
Sbjct  62   SFAPMESARIKVVGVGGGGNNAVNRMISSGLQGVDFYAINTDSQALLQSAADNPLQIGEL  121

Query  6    LT  1
            LT
Sbjct  122  LT  123



>gb|KFK27127.1| hypothetical protein AALP_AA8G338300 [Arabis alpina]
Length=425

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 60/73 (82%), Gaps = 0/73 (0%)
 Frame = -3

Query  219  RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLS  40
            RR       R SF+   SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S
Sbjct  49   RRSDSGMRLRCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQS  108

Query  39   AAENPIQIGELLT  1
            +AENP+QIGELLT
Sbjct  109  SAENPLQIGELLT  121



>ref|XP_006839100.1| hypothetical protein AMTR_s00090p00136440 [Amborella trichopoda]
 gb|ERN01669.1| hypothetical protein AMTR_s00090p00136440 [Amborella trichopoda]
Length=409

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            SF    SAKIKV+GVGGGGNNAVNRMI SGLQGV+FY+INTD+QALV SAA+NP+QIGEL
Sbjct  53   SFAPMESAKIKVVGVGGGGNNAVNRMIGSGLQGVEFYAINTDSQALVNSAAQNPLQIGEL  112

Query  6    LT  1
            LT
Sbjct  113  LT  114



>emb|CDY20776.1| BnaA02g09160D [Brassica napus]
Length=425

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 77/112 (69%), Gaps = 15/112 (13%)
 Frame = -3

Query  333  ANSAELGVASSFSSNSL-GFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSSASAKI  157
            ANS    + SSF+S  + GF +  + S            + +SLR   R SF+   +AKI
Sbjct  23   ANSISNSLHSSFASTRISGFTKRRSDS------------KSKSLRL--RCSFSPMETAKI  68

Query  156  KvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            KV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S+A+ P+QIGELLT
Sbjct  69   KVVGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQSSAQTPLQIGELLT  120



>ref|XP_003519603.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Glycine max]
Length=418

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = -3

Query  303  SFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRF-YARTSFTSSASAKIKvlgvggggn  127
            S S +S+  H   T S   + +     P+R S RF   R S+    +AKIKV+G+GGGGN
Sbjct  17   SLSCSSIFHHNALTTSVSLNPRTTKIAPQRLSRRFGSVRCSYAYVDNAKIKVVGIGGGGN  76

Query  126  navNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            NAVNRMI SGLQGVDFY+INTDAQAL+ SAAENPI+IGE+LT
Sbjct  77   NAVNRMIGSGLQGVDFYAINTDAQALLNSAAENPIKIGEVLT  118



>gb|AAA82068.1| cpFtsZ [Arabidopsis thaliana]
Length=433

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 62/73 (85%), Gaps = 2/73 (3%)
 Frame = -3

Query  219  RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLS  40
            R +S+R   R SF+   SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+  
Sbjct  58   RSKSMRL--RCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALLQF  115

Query  39   AAENPIQIGELLT  1
            +AENP+QIGELLT
Sbjct  116  SAENPLQIGELLT  128



>ref|XP_010443150.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Camelina sativa]
Length=426

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIG  13
            + SF+   SA+IKV+GVGGGGNNAVNRMI+SGLQ VDFY+INTD+QAL+ S+AENP+QIG
Sbjct  60   KCSFSPMESARIKVIGVGGGGNNAVNRMISSGLQSVDFYAINTDSQALIQSSAENPLQIG  119

Query  12   ELLT  1
            ELLT
Sbjct  120  ELLT  123



>gb|KHG00460.1| Cell division FtsZ, chloroplastic -like protein [Gossypium arboreum]
Length=400

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 61/78 (78%), Gaps = 5/78 (6%)
 Frame = -3

Query  219  RRRSLRFYAR-----TSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQ  55
            +R S   Y R      SF S  +AKIKV+GVGGGGNNAVNRMI S LQGVDFY++NTD+Q
Sbjct  36   KRSSFCTYHRFGRISCSFASMETAKIKVVGVGGGGNNAVNRMIGSSLQGVDFYAVNTDSQ  95

Query  54   ALVLSAAENPIQIGELLT  1
            AL+ S+AENP+QIGELLT
Sbjct  96   ALLQSSAENPLQIGELLT  113



>emb|CAA75603.1| FtsZ protein [Pisum sativum]
Length=423

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 63/79 (80%), Gaps = 1/79 (1%)
 Frame = -3

Query  234  IFPGPRRRSLRF-YARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDA  58
            I+P  +R   RF   R S     +AKIKV+G+GGGGNNAVNRMI SGLQGVDFY+INTDA
Sbjct  41   IYPKTQRFGRRFGSVRCSLAYVDNAKIKVVGIGGGGNNAVNRMIGSGLQGVDFYAINTDA  100

Query  57   QALVLSAAENPIQIGELLT  1
            QAL+ SAAENPI+IGELLT
Sbjct  101  QALLHSAAENPIKIGELLT  119



>ref|XP_004491442.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Cicer arietinum]
Length=413

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SGLQGVDFY+INTDAQAL+ SAAENPI+IGELLT
Sbjct  72   RMIGSGLQGVDFYAINTDAQALLHSAAENPIKIGELLT  109



>emb|CAI44667.1| plastid division protein [Medicago truncatula]
 gb|AET00625.2| cell division FtsZ-like protein [Medicago truncatula]
Length=418

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SGLQGVDFY+INTDAQAL+ SAAENPI+IGELLT
Sbjct  77   RMIGSGLQGVDFYAINTDAQALLHSAAENPIKIGELLT  114



>ref|XP_003617666.1| FtsZ protein [Medicago truncatula]
Length=420

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SGLQGVDFY+INTDAQAL+ SAAENPI+IGELLT
Sbjct  77   RMIGSGLQGVDFYAINTDAQALLHSAAENPIKIGELLT  114



>emb|CBI26709.3| unnamed protein product [Vitis vinifera]
Length=361

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  SAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            SAKIKV+GVGGGGNNAVNRMI SGLQGVDFY+INTD+QAL+ SAA NP+QIGELLT
Sbjct  3    SAKIKVVGVGGGGNNAVNRMIGSGLQGVDFYAINTDSQALLHSAASNPLQIGELLT  58



>ref|XP_010063064.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW70253.1| hypothetical protein EUGRSUZ_F03510 [Eucalyptus grandis]
Length=421

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -3

Query  195  ARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQI  16
            A  SF    SAKIKV+GVGGGGNNAVNRMI SGLQ VDFY+INTD+QAL+ SAAE P+QI
Sbjct  55   ASCSFVPMESAKIKVVGVGGGGNNAVNRMIGSGLQSVDFYAINTDSQALLQSAAEYPLQI  114

Query  15   GELLT  1
            GELLT
Sbjct  115  GELLT  119



>ref|XP_010913967.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Elaeis guineensis]
Length=411

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -3

Query  189  TSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGE  10
            +SF    SA+IKV+GVGGGGNNAVNRMI SGLQGV+FY+INTDAQAL+ S A+NP+QIGE
Sbjct  52   SSFAPVDSARIKVVGVGGGGNNAVNRMIGSGLQGVEFYAINTDAQALLHSQAKNPLQIGE  111

Query  9    LLT  1
            LLT
Sbjct  112  LLT  114



>gb|ACF85277.1| unknown [Zea mays]
 tpg|DAA35501.1| TPA: cell division protein ftsZ [Zea mays]
Length=405

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  RRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSA  37
            RRS R   R SF    +A+IKV+GVGGGGNNAVNRMI SGLQG++FY+INTD+QAL+ S 
Sbjct  35   RRSRRATVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALINSQ  94

Query  36   AENPIQIGELLT  1
            A+ P+QIGE LT
Sbjct  95   AQYPLQIGEQLT  106



>ref|NP_001149695.1| LOC100283321 [Zea mays]
 gb|ACG36412.1| cell division protein ftsZ [Zea mays]
Length=405

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  RRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSA  37
            RRS R   R SF    +A+IKV+GVGGGGNNAVNRMI SGLQG++FY+INTD+QAL+ S 
Sbjct  35   RRSRRATVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALINSQ  94

Query  36   AENPIQIGELLT  1
            A+ P+QIGE LT
Sbjct  95   AQYPLQIGEQLT  106



>ref|XP_011095476.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Sesamum indicum]
Length=408

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = -3

Query  219  RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLS  40
            +RR    Y   S+  + S KIKV+GVGGGGNNAVNRMI SGLQG+DFY+INTDAQ L+ S
Sbjct  45   KRRRGGVYC--SYIPTGSTKIKVVGVGGGGNNAVNRMIGSGLQGMDFYAINTDAQTLLQS  102

Query  39   AAENPIQIGELLT  1
             A+NPIQIGE+LT
Sbjct  103  LAKNPIQIGEVLT  115



>ref|XP_002448714.1| hypothetical protein SORBIDRAFT_06g031950 [Sorghum bicolor]
 gb|EES13042.1| hypothetical protein SORBIDRAFT_06g031950 [Sorghum bicolor]
Length=405

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 62/89 (70%), Gaps = 2/89 (2%)
 Frame = -3

Query  261  PSPFFSRQCIFPGPR--RRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQG  88
            P P   R     G R  RR  R   R SF    +A+IKV+GVGGGGNNAVNRMI SGLQG
Sbjct  18   PGPGHLRALPRSGWRDHRRPRRAIVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQG  77

Query  87   VDFYSINTDAQALVLSAAENPIQIGELLT  1
            ++FY+INTD+QAL+ S A+ P+QIGE LT
Sbjct  78   IEFYAINTDSQALINSQAQYPLQIGEQLT  106



>ref|XP_010928879.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=332

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -3

Query  219  RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLS  40
            RR         S  S  +A+I+V+GVGGGGNNAVNRMI SGLQGV+FY+INTDAQAL+ S
Sbjct  41   RREGSALQCSNSSVSVDAARIRVVGVGGGGNNAVNRMIGSGLQGVEFYAINTDAQALLHS  100

Query  39   AAENPIQIGELLT  1
             A+NP+QIGELLT
Sbjct  101  QAKNPLQIGELLT  113



>ref|XP_010928878.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=410

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -3

Query  219  RRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLS  40
            RR         S  S  +A+I+V+GVGGGGNNAVNRMI SGLQGV+FY+INTDAQAL+ S
Sbjct  41   RREGSALQCSNSSVSVDAARIRVVGVGGGGNNAVNRMIGSGLQGVEFYAINTDAQALLHS  100

Query  39   AAENPIQIGELLT  1
             A+NP+QIGELLT
Sbjct  101  QAKNPLQIGELLT  113



>gb|ADX77916.1| FtsZ [Syringa microphylla]
Length=190

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SGL+GVDFY++NTD+QAL+ SAAE P+QIGELLT
Sbjct  5    RMIGSGLKGVDFYAVNTDSQALLQSAAETPLQIGELLT  42



>gb|ABK24653.1| unknown [Picea sitchensis]
Length=439

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -3

Query  183  FTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELL  4
            F    SA+IKV+G+GGGGNNAVNRMI +GL GV+FY+INTDAQAL+ SAAENP+QIGE L
Sbjct  84   FRQMESARIKVVGIGGGGNNAVNRMIAAGLHGVEFYAINTDAQALLQSAAENPVQIGEQL  143

Query  3    T  1
            T
Sbjct  144  T  144



>ref|XP_004960200.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Setaria italica]
Length=406

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -3

Query  216  RRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSA  37
            R+  R   R SF    +A+IKV+GVGGGGNNAVNRMI SGLQG++FY+INTD+QAL+ S 
Sbjct  35   RQPRRATVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALITSQ  94

Query  36   AENPIQIGELLT  1
            A+ P+QIGE LT
Sbjct  95   AQYPLQIGEQLT  106



>ref|XP_009407904.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=416

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 54/61 (89%), Gaps = 0/61 (0%)
 Frame = -3

Query  183  FTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELL  4
            F    SA+IKV+GVGGGGNNAVNRMI SGLQGV+FY+INTD+QAL+ S A+NP+QIGE+L
Sbjct  60   FVPVESARIKVVGVGGGGNNAVNRMIGSGLQGVEFYAINTDSQALLHSQAQNPLQIGEVL  119

Query  3    T  1
            T
Sbjct  120  T  120



>gb|ACN40898.1| unknown [Picea sitchensis]
Length=439

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -3

Query  183  FTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELL  4
            F    SA+IKV+G+GGGGNNAVNRMI +GL GV+FY+INTDAQAL+ SA ENP+QIGE L
Sbjct  84   FRQMESARIKVVGIGGGGNNAVNRMIAAGLHGVEFYAINTDAQALLQSATENPVQIGEQL  143

Query  3    T  1
            T
Sbjct  144  T  144



>ref|XP_008782917.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Phoenix dactylifera]
Length=411

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+GVGGGGNNAVNRMI SGL+GV+FY+INTDAQAL+ S A+NP+QIGELLT
Sbjct  60   ARIKVVGVGGGGNNAVNRMIGSGLEGVEFYAINTDAQALLHSQAKNPLQIGELLT  114



>dbj|BAG97403.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61856.1| hypothetical protein OsJ_16530 [Oryza sativa Japonica Group]
Length=402

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = -3

Query  237  CIFPGPRRRSLRFYA--RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINT  64
            C  P PR  + R +A  R SF    +A+IKV+GVGGGGNNAVNRMI SGLQG++FY+INT
Sbjct  23   CSAP-PRGSARRRHASVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINT  81

Query  63   DAQALVLSAAENPIQIGELLT  1
            D+QAL+ S A+ P+QIGE LT
Sbjct  82   DSQALLNSQAQYPLQIGEQLT  102



>ref|NP_001054176.1| Os04g0665400 [Oryza sativa Japonica Group]
 gb|AAK64282.1|AF383876_1 plastid division protein FtsZ [Oryza sativa]
 emb|CAE03583.1| OSJNBa0087O24.6 [Oryza sativa Japonica Group]
 dbj|BAF16090.1| Os04g0665400 [Oryza sativa Japonica Group]
 emb|CAH65978.1| H1005F08.7 [Oryza sativa Indica Group]
Length=404

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = -3

Query  237  CIFPGPRRRSLRFYA--RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINT  64
            C  P PR  + R +A  R SF    +A+IKV+GVGGGGNNAVNRMI SGLQG++FY+INT
Sbjct  23   CSAP-PRGSARRRHASVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINT  81

Query  63   DAQALVLSAAENPIQIGELLT  1
            D+QAL+ S A+ P+QIGE LT
Sbjct  82   DSQALLNSQAQYPLQIGEQLT  102



>gb|EEC78198.1| hypothetical protein OsI_17816 [Oryza sativa Indica Group]
Length=399

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = -3

Query  237  CIFPGPRRRSLRFYA--RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINT  64
            C  P PR  + R +A  R SF    +A+IKV+GVGGGGNNAVNRMI SGLQG++FY+INT
Sbjct  23   CSAP-PRGSARRRHASVRCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINT  81

Query  63   DAQALVLSAAENPIQIGELLT  1
            D+QAL+ S A+ P+QIGE LT
Sbjct  82   DSQALLNSQAQYPLQIGEQLT  102



>ref|XP_006846633.1| hypothetical protein AMTR_s00156p00058400 [Amborella trichopoda]
 gb|ERN08308.1| hypothetical protein AMTR_s00156p00058400 [Amborella trichopoda]
Length=375

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  SASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            S +A+IKV+G+GGGGNNAVNRMI SGLQGV+FY++NTDAQAL+LS AE+ +QIGE LT
Sbjct  81   SETARIKVIGIGGGGNNAVNRMIGSGLQGVEFYAVNTDAQALLLSNAEHRVQIGEQLT  138



>ref|XP_002985903.1| hypothetical protein SELMODRAFT_123081 [Selaginella moellendorffii]
 gb|EFJ13080.1| hypothetical protein SELMODRAFT_123081 [Selaginella moellendorffii]
Length=355

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  SAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            SA+IKV+G+GGGGNNAVNRMI SGLQGVDF++INTDAQALV S+A N +QIGE LT
Sbjct  3    SARIKVVGIGGGGNNAVNRMIGSGLQGVDFWAINTDAQALVQSSASNRLQIGEELT  58



>ref|XP_002984848.1| hypothetical protein SELMODRAFT_156840 [Selaginella moellendorffii]
 gb|EFJ14098.1| hypothetical protein SELMODRAFT_156840 [Selaginella moellendorffii]
Length=355

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  SAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            SA+IKV+G+GGGGNNAVNRMI SGLQGVDF++INTDAQALV S+A N +QIGE LT
Sbjct  3    SARIKVVGIGGGGNNAVNRMIGSGLQGVDFWAINTDAQALVQSSASNRLQIGEELT  58



>dbj|BAJ85582.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=403

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            +F    +A+IKV+GVGGGGNNAVNRMI SGLQG++FY+INTD+QALV S A++P+QIGE 
Sbjct  44   AFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALVNSQAQHPLQIGEQ  103

Query  6    LT  1
            LT
Sbjct  104  LT  105



>gb|AEV40986.1| putative tubulin/FtsZ domain-containing protein [Oryza minuta]
Length=334

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIG  13
            R SF    +A+IKV+GVGGGGNNAVNRMI SGLQG++FY+INTD+QAL+ S A+ P+QIG
Sbjct  42   RCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALLNSQAQYPLQIG  101

Query  12   ELLT  1
            E LT
Sbjct  102  EQLT  105



>gb|AEV40936.1| putative tubulin/FtsZ domain-containing protein [Oryza punctata]
Length=407

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIG  13
            R SF    +A+IKV+GVGGGGNNAVNRMI SGLQG++FY+INTD+QAL+ S A+ P+QIG
Sbjct  42   RCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALLNSQAQYPLQIG  101

Query  12   ELLT  1
            E LT
Sbjct  102  EQLT  105



>ref|XP_003580765.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic 
[Brachypodium distachyon]
Length=405

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
            +F    +A+IKV+GVGGGGNNAVNRMI SGLQG++FY+INTD+QALV S A++P+QIGE 
Sbjct  48   AFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALVNSQAQHPLQIGEQ  107

Query  6    LT  1
            LT
Sbjct  108  LT  109



>ref|XP_006652974.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Oryza brachyantha]
Length=405

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIG  13
            R SF    +A+IKV+GVGGGGNNAVNRMI SGLQG++FY+INTD+QAL+ S A+ P+QIG
Sbjct  42   RCSFAPVETARIKVVGVGGGGNNAVNRMIGSGLQGIEFYAINTDSQALLNSQAQYPLQIG  101

Query  12   ELLT  1
            E LT
Sbjct  102  EQLT  105



>ref|XP_007020678.1| Bacterial cytokinesis Z-ring protein FTSZ 1-1, putative [Theobroma 
cacao]
 gb|EOY12203.1| Bacterial cytokinesis Z-ring protein FTSZ 1-1, putative [Theobroma 
cacao]
Length=319

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 56/83 (67%), Gaps = 21/83 (25%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQ---------------------GVDFYSI  70
            SF    +AKIKV+GVGGGGNNAVNRMI SGLQ                     GVDFY+I
Sbjct  50   SFAPMETAKIKVVGVGGGGNNAVNRMIGSGLQNLDWIEEGNGDDNLGDFGGKIGVDFYAI  109

Query  69   NTDAQALVLSAAENPIQIGELLT  1
            NTD++AL+ SAAENP+QIGELLT
Sbjct  110  NTDSEALLQSAAENPLQIGELLT  132



>ref|XP_002501749.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63007.1| predicted protein [Micromonas sp. RCC299]
Length=359

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  183  FTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELL  4
             +  + A+IKV+G GGGG NAVNRMINSGLQGV+F+S+NTDAQALV S A+N IQIG+ +
Sbjct  1    MSGVSEARIKVIGCGGGGGNAVNRMINSGLQGVEFWSLNTDAQALVQSQADNRIQIGKQV  60

Query  3    T  1
            T
Sbjct  61   T  61



>ref|XP_003080788.1| ftsZ1 (ISS) [Ostreococcus tauri]
Length=381

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIG  13
            R S  + A+AKIKVLG GGGG+NAVNRMI+ GLQGV+F+++NTD+QALV S A N +QIG
Sbjct  14   RESVVARANAKIKVLGCGGGGSNAVNRMISGGLQGVEFWTVNTDSQALVNSLAPNKLQIG  73

Query  12   ELLT  1
            E +T
Sbjct  74   EQVT  77



>dbj|BAC57986.1| ftsZ1 [Marchantia polymorpha]
 dbj|BAC57993.1| ftsZ1 [Marchantia polymorpha]
Length=446

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 2/71 (3%)
 Frame = -3

Query  213  RSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAA  34
            +  R +A  S     SA+IKV+GVGGGGNNA+NRMI SGLQGV+F++INTDAQAL+ SAA
Sbjct  80   KGTRIFA--SMIPMDSARIKVIGVGGGGNNAINRMIGSGLQGVEFWAINTDAQALLQSAA  137

Query  33   ENPIQIGELLT  1
             + +QIGE LT
Sbjct  138  THRVQIGETLT  148



>gb|EMS66227.1| Cell division protein ftsZ-like protein 1, chloroplastic [Triticum 
urartu]
Length=357

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SGLQG++FY+INTD+QALV S A++P+QIGE LT
Sbjct  84   RMIGSGLQGIEFYAINTDSQALVNSQAQHPLQIGEQLT  121



>emb|CEG01485.1| Cell division protein FtsZ, C-terminal [Ostreococcus tauri]
Length=418

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/64 (66%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIG  13
            R S  + A+AKIKVLG GGGG+NAVNRMI+ GLQGV+F+++NTD+QALV S A N +QIG
Sbjct  51   RESVVARANAKIKVLGCGGGGSNAVNRMISGGLQGVEFWTVNTDSQALVNSLAPNKLQIG  110

Query  12   ELLT  1
            E +T
Sbjct  111  EQVT  114



>ref|WP_015956956.1| cell division protein FtsZ [Cyanothece sp. PCC 7424]
 ref|YP_002380244.1| cell division protein FtsZ [Cyanothece sp. PCC 7424]
 gb|ACK73376.1| cell division protein FtsZ [Cyanothece sp. PCC 7424]
Length=418

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 63/101 (62%), Gaps = 13/101 (13%)
 Frame = -3

Query  303  SFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSSASAKIKvlgvggggnn  124
            S +S  + FHRNN P        + P  R RS       +   S  A+IKV+GVGGGG N
Sbjct  31   SLNSAGIPFHRNNEPQ-------VNPRERARS------NTIVQSNVAQIKVIGVGGGGCN  77

Query  123  avNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AVNRMI SG+ G++F+SINTDAQAL  SAA   +QIG+ +T
Sbjct  78   AVNRMIASGIIGIEFWSINTDAQALAHSAAPQRLQIGQKIT  118



>ref|XP_010249043.1| PREDICTED: cell division protein FtsZ homolog 1, chloroplastic-like 
[Nelumbo nucifera]
Length=431

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  SAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            SA+IKV+GVGGGGNNAVNRMI SGLQGV+FY+INTDAQAL+ S+ +  +QIGE LT
Sbjct  78   SARIKVIGVGGGGNNAVNRMIESGLQGVEFYAINTDAQALLQSSTKRQVQIGEKLT  133



>ref|WP_005582518.1| hypothetical protein [Clostridium ultunense]
 emb|CCQ92916.1| hypothetical protein CULT_1130017 [Clostridium ultunense Esp]
Length=137

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F  S+ A+IKV+GVGGGG+NAVNRMI+SG+QGV+F  +NTDAQAL  S A+  +QIGE 
Sbjct  5    EFEMSSLAQIKVIGVGGGGSNAVNRMIDSGVQGVEFICVNTDAQALNQSKAKTKMQIGEK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>gb|EOS57895.1| cell division protein ftsZ [Paenibacillus barengoltzii G22]
Length=384

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 57/79 (72%), Gaps = 4/79 (5%)
 Frame = -3

Query  237  CIFPGPRRRSLRFYARTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDA  58
            CI  G  +  L F     F   + A+IKV+GVGGGG+NAVNRMI +G+QGV+F ++NTDA
Sbjct  5    CILRGRWKSMLEF----DFEMESLAQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDA  60

Query  57   QALVLSAAENPIQIGELLT  1
            QAL L+ +E+ +QIG+ LT
Sbjct  61   QALHLAKSEHKLQIGDKLT  79



>ref|WP_027889761.1| cell division protein FtsZ [Megamonas hypermegale]
Length=351

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGGNNAVNRMI SGL+GV+F +INTDAQALV + A+N IQIGE LT
Sbjct  12   AKIKVVGVGGGGNNAVNRMIASGLKGVEFVAINTDAQALVHAMAQNRIQIGEKLT  66



>ref|XP_001780238.1| ftsZ1-1 plastid division protein [Physcomitrella patens]
 emb|CAD22047.1| putative plastid division protein FtsZ1-1 [Physcomitrella patens]
 gb|EDQ54902.1| ftsZ1-1 plastid division protein [Physcomitrella patens]
Length=444

 Score = 57.0 bits (136),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SG+QGVDF++INTD QAL  S AE+ +QIGE LT
Sbjct  108  RMIGSGIQGVDFWAINTDVQALQKSQAEHRVQIGEALT  145



>ref|WP_011640258.1| cell division protein FtsZ [Syntrophomonas wolfei]
 ref|YP_753524.1| hypothetical protein Swol_0833 [Syntrophomonas wolfei subsp. 
wolfei str. Goettingen G311]
 gb|ABI68153.1| cell division protein FtsZ [Syntrophomonas wolfei subsp. wolfei 
str. Goettingen G311]
Length=355

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+G GGGGNNA+NRMI +GL+GV+F ++NTDAQAL LS AE  IQ+GE LT
Sbjct  13   AKIKVIGAGGGGNNAINRMIEAGLKGVEFIAVNTDAQALFLSRAEKKIQVGEKLT  67



>ref|WP_013778216.1| cell division protein FtsZ [Tepidanaerobacter acetatoxydans]
 ref|YP_004460600.1| cell division protein FtsZ [Tepidanaerobacter acetatoxydans Re1]
 ref|YP_007271955.1| cell-division initiation protein [Tepidanaerobacter acetatoxydans 
Re1]
 gb|AEE91293.1| cell division protein FtsZ [Tepidanaerobacter acetatoxydans Re1]
 emb|CCP25979.1| cell-division initiation protein [Tepidanaerobacter acetatoxydans 
Re1]
Length=350

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI++GL+GV+F S+NTDAQAL LS A+  IQIGE LT
Sbjct  29   RMIDAGLKGVEFISVNTDAQALYLSKADKKIQIGEKLT  66



>ref|WP_013174987.1| cell division protein FtsZ [Syntrophothermus lipocalidus]
 ref|YP_003702150.1| cell division protein FtsZ [Syntrophothermus lipocalidus DSM 
12680]
 gb|ADI01585.1| cell division protein FtsZ [Syntrophothermus lipocalidus DSM 
12680]
Length=352

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI +GL+GV+F +INTDAQAL LS AE  IQIGE LT
Sbjct  30   RMIEAGLKGVEFIAINTDAQALYLSKAEKKIQIGEKLT  67



>dbj|BAD12165.1| plastid division protein FtsZ [Nannochloris bacillaris]
Length=434

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/117 (43%), Positives = 68/117 (58%), Gaps = 4/117 (3%)
 Frame = -3

Query  348  ASLGLANSAELGVASSFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTS-S  172
            A L +  +A LG ++  +   +  H      P   ++ I     R S   Y+  ++    
Sbjct  12   AGLAIRANANLGSSTHMAGCPISRHSAAVSVPVIRQERILVAVPRAS---YSNANYGPMG  68

Query  171  ASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
              A+IKV+GVGGGG NAVNRMINSGLQGV+F+++NTDAQAL    A N +QIG  LT
Sbjct  69   GDARIKVVGVGGGGGNAVNRMINSGLQGVEFWAVNTDAQALEKHDALNKLQIGTALT  125



>ref|WP_013322397.1| cell division protein FtsZ [Cyanothece sp. PCC 7822]
 ref|YP_003887567.1| cell division protein FtsZ [Cyanothece sp. PCC 7822]
 gb|ADN14292.1| cell division protein FtsZ [Cyanothece sp. PCC 7822]
Length=418

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 13/101 (13%)
 Frame = -3

Query  303  SFSSNSLGFHRNNTPSPFFSRQCIFPGPRRRSLRFYARTSFTSSASAKIKvlgvggggnn  124
            + +S  + FHR+N P        + P  R RS       +   S  A+IKV+GVGGGG N
Sbjct  31   ALNSAGIPFHRSNEPQ-------VNPRDRARS------NTIVHSNVAQIKVIGVGGGGCN  77

Query  123  avNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AVNRMI SG+ GV+F+SINTDAQAL  SAA   +QIG+ +T
Sbjct  78   AVNRMIASGIVGVEFWSINTDAQALAHSAAPQRLQIGQKIT  118



>ref|WP_012094996.1| cell division protein FtsZ [Bacillus cytotoxicus]
 ref|YP_001375784.1| cell division protein FtsZ [Bacillus cytotoxicus NVH 391-98]
 gb|ABS22789.1| cell division protein FtsZ [Bacillus cytotoxicus NVH 391-98]
Length=384

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIGE LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGEKLT  66



>ref|XP_003058549.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57004.1| predicted protein [Micromonas pusilla CCMP1545]
Length=367

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -3

Query  168  SAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIG  13
            SA IKV+G GGGG NAVNRMI SG+QGV+F+S+NTDAQALV S A+N IQIG
Sbjct  8    SATIKVIGCGGGGGNAVNRMIKSGIQGVEFWSLNTDAQALVQSEADNRIQIG  59



>ref|WP_033405533.1| cell division protein FtsZ, partial [Megamonas rupellensis]
Length=309

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGGNNAVNRMI SGL+GV+F +INTDAQALV + A+N +QIGE LT
Sbjct  5    AKIKVVGVGGGGNNAVNRMIASGLKGVEFIAINTDAQALVHAMAQNRMQIGEKLT  59



>ref|WP_013075835.1| cell division protein FtsZ [Kyrpidia tusciae]
 ref|YP_003589693.1| cell division protein FtsZ [Kyrpidia tusciae DSM 2912]
 gb|ADG06549.1| cell division protein FtsZ [Kyrpidia tusciae DSM 2912]
Length=357

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F +   A+IKV+GVGGGG NAVNRMI SG++GV+F ++NTDAQAL LS AE+ +QIGE 
Sbjct  5    EFDTEHLAQIKVIGVGGGGCNAVNRMIESGIKGVEFIAVNTDAQALQLSKAESRLQIGEK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_022227972.1| cell division protein FtsZ 1 [Megamonas funiformis CAG:377]
 emb|CDB95941.1| cell division protein FtsZ 1 [Megamonas funiformis CAG:377]
Length=357

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGGNNAVNRMI SGL+GV+F +INTDAQALV + A+N +QIGE LT
Sbjct  15   AKIKVVGVGGGGNNAVNRMIASGLKGVEFIAINTDAQALVHAMAQNRMQIGEKLT  69



>ref|WP_008538349.1| cell division protein FtsZ [Megamonas funiformis]
 gb|EHR37559.1| cell division protein FtsZ [Megamonas funiformis YIT 11815]
Length=357

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGGNNAVNRMI SGL+GV+F +INTDAQALV + A+N +QIGE LT
Sbjct  15   AKIKVVGVGGGGNNAVNRMIASGLKGVEFIAINTDAQALVHAMAQNRMQIGEKLT  69



>ref|WP_003867934.1| MULTISPECIES: cell division protein FtsZ [Thermoanaerobacter]
 ref|YP_001663611.1| cell division protein FtsZ [Thermoanaerobacter sp. X514]
 ref|YP_003903850.1| cell division protein FtsZ [Thermoanaerobacter sp. X513]
 gb|ABY93275.1| cell division protein FtsZ [Thermoanaerobacter sp. X514]
 gb|EEU62134.1| cell division protein FtsZ [Thermoanaerobacter ethanolicus CCSD1]
 gb|EFK84748.1| cell division protein FtsZ [Thermoanaerobacter sp. X561]
 gb|ADN54559.1| cell division protein FtsZ [Thermoanaerobacter sp. X513]
Length=357

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI++GL+GV+F +INTD QAL LS AE  IQIGE LT
Sbjct  29   RMIDAGLRGVEFIAINTDKQALYLSKAETKIQIGEKLT  66



>ref|WP_014063046.1| cell division protein FtsZ [Thermoanaerobacter wiegelii]
 ref|YP_004820285.1| cell division protein FtsZ [Thermoanaerobacter wiegelii Rt8.B1]
 gb|AEM79001.1| cell division protein FtsZ [Thermoanaerobacter wiegelii Rt8.B1]
Length=357

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI++GL+GV+F +INTD QAL LS AE  IQIGE LT
Sbjct  29   RMIDAGLRGVEFIAINTDKQALYLSKAETKIQIGEKLT  66



>ref|WP_012995467.1| cell division protein FtsZ [Thermoanaerobacter italicus]
 ref|YP_003477294.1| cell division protein FtsZ [Thermoanaerobacter italicus Ab9]
 gb|ADD02732.1| cell division protein FtsZ [Thermoanaerobacter italicus Ab9]
Length=357

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI++GL+GV+F +INTD QAL LS AE  IQIGE LT
Sbjct  29   RMIDAGLRGVEFIAINTDKQALYLSKAETKIQIGEKLT  66



>gb|KHO62804.1| cell division protein FtsZ [Thermoanaerobacter sp. YS13]
Length=357

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI++GL+GV+F SINTD QAL LS AE  IQIGE LT
Sbjct  29   RMIDAGLRGVEFISINTDKQALYLSKAEIKIQIGEKLT  66



>ref|XP_001769058.1| ftsZ1-2 plastid division protein [Physcomitrella patens]
 gb|EDQ66136.1| ftsZ1-3 plastid division protein [Physcomitrella patens]
Length=443

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SG+QGVDF++INTD QAL  S A++ +QIGE LT
Sbjct  109  RMIGSGIQGVDFWAINTDVQALQKSQAQHRVQIGEALT  146



>ref|WP_013150470.1| MULTISPECIES: cell division protein FtsZ [Thermoanaerobacter]
 ref|YP_003677189.1| cell division protein FtsZ [Thermoanaerobacter mathranii subsp. 
mathranii str. A3]
 gb|ADH61178.1| cell division protein FtsZ [Thermoanaerobacter mathranii subsp. 
mathranii str. A3]
Length=357

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI++GL+GV+F +INTD QAL LS AE  IQIGE LT
Sbjct  29   RMIDAGLRGVEFIAINTDKQALYLSKAETKIQIGEKLT  66



>ref|WP_021295404.1| cell division protein FtsZ [Alicyclobacillus acidoterrestris]
 gb|EPZ51516.1| cell division protein FtsZ [Alicyclobacillus acidoterrestris 
ATCC 49025]
Length=372

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F S + A IKV+GVGGGG NAVNRMI SG++GV+F  +NTDAQAL LS AE  +QIGE 
Sbjct  5    DFESDSLAHIKVIGVGGGGCNAVNRMIESGVKGVEFIVVNTDAQALKLSKAETRLQIGEK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_007289296.1| cell division protein FtsZ [Thermosinus carboxydivorans]
 gb|EAX47797.1| cell division protein FtsZ [Thermosinus carboxydivorans Nor1]
Length=348

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SGLQGV+F +INTDAQAL+LS A   IQIGE LT
Sbjct  29   RMIASGLQGVEFIAINTDAQALLLSQASYRIQIGEKLT  66



>ref|WP_036125233.1| cell division protein FtsZ, partial [Lysinibacillus sphaericus]
Length=107

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAEIKLQIGAKLT  66



>ref|WP_012810654.1| cell division protein FtsZ [Alicyclobacillus acidocaldarius]
 ref|YP_003184705.1| cell division protein FtsZ [Alicyclobacillus acidocaldarius subsp. 
acidocaldarius DSM 446]
 gb|ACV58316.1| cell division protein FtsZ [Alicyclobacillus acidocaldarius subsp. 
acidocaldarius DSM 446]
Length=379

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F + + A IKV+GVGGGG NAVNRMI SG++GV+F  +NTDAQAL LS AE  +QIGE 
Sbjct  5    DFETDSLANIKVIGVGGGGCNAVNRMIESGVKGVEFIVVNTDAQALKLSKAETKLQIGEK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>gb|AAF87239.1|AF275720_1 FtsZ, partial [Asplenium nidus]
Length=188

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SGLQGV+F++INTDAQALV S A   +QIG+ +T
Sbjct  5    RMIGSGLQGVEFWAINTDAQALVQSTASQRLQIGKQIT  42



>ref|WP_008339618.1| cell division protein FtsZ [Alicyclobacillus acidocaldarius]
 gb|EED07237.1| cell division protein FtsZ [Alicyclobacillus acidocaldarius LAA1]
Length=379

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F + + A IKV+GVGGGG NAVNRMI SG++GV+F  +NTDAQAL LS AE  +QIGE 
Sbjct  5    DFETDSLANIKVIGVGGGGCNAVNRMIESGVKGVEFIVVNTDAQALKLSKAETKLQIGEK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_007287886.1| cell division protein FtsZ [Intestinibacter bartlettii]
 gb|EDQ95430.1| cell division protein FtsZ [Intestinibacter bartlettii DSM 16795]
 gb|ETI93182.1| Cell division protein ftsZ [Intestinibacter bartlettii DORA_8_9]
Length=390

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  SAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            +AKIKV GVGGGGNNAVNRMI+  ++G++F SINTD QALV S AEN IQIGE LT
Sbjct  11   NAKIKVFGVGGGGNNAVNRMIDEKIKGIEFISINTDRQALVTSKAENQIQIGEKLT  66



>ref|WP_038681737.1| cell division protein FtsZ [Rubrobacter radiotolerans]
 gb|AHY46779.1| ftsZ: cell division protein FtsZ [Rubrobacter radiotolerans]
Length=361

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMINSGLQGV+F +INTDAQAL +  A+  I IGE LT
Sbjct  27   RMINSGLQGVEFIAINTDAQALQMCDADQKIHIGEKLT  64



>ref|WP_025027694.1| cell division protein FtsZ [Bacillus mannanilyticus]
Length=379

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+GVGGGG+NAVNRMI +G+QGV+F ++NTDAQAL LS AEN IQIG  LT
Sbjct  12   AQIKVIGVGGGGSNAVNRMIETGVQGVEFIAVNTDAQALHLSKAENRIQIGGKLT  66



>ref|WP_022072126.1| cell division protein FtsZ [Clostridium bartlettii CAG:1329]
 emb|CDA10913.1| cell division protein FtsZ [Clostridium bartlettii CAG:1329]
Length=390

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -3

Query  168  SAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            +AKIKV GVGGGGNNAVNRMI+  ++G++F SINTD QALV S AEN IQIGE LT
Sbjct  11   NAKIKVFGVGGGGNNAVNRMIDEKIKGIEFISINTDRQALVTSKAENQIQIGEKLT  66



>ref|WP_034422748.1| cell division protein FtsZ [Clostridiales bacterium DRI-13]
Length=346

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+GVGGGG+NAVNRMI SGL+GV+F ++NTDAQAL LS AE+ IQIG  LT
Sbjct  12   AQIKVIGVGGGGSNAVNRMIESGLKGVEFIAVNTDAQALYLSKAEHKIQIGTKLT  66



>ref|WP_019175265.1| cell division protein FtsZ [Brevibacterium massiliense]
Length=382

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV G GGGG NAV RMI++GL+GV+F +INTDAQALVLS A+  I+IG  LT
Sbjct  9    AEIKVAGTGGGGVNAVQRMIDAGLRGVEFIAINTDAQALVLSEADTKIEIGRELT  63



>ref|WP_022076980.1| cell division protein FtsZ [Clostridium sp. CAG:571]
 emb|CDA15689.1| cell division protein FtsZ [Clostridium sp. CAG:571]
Length=143

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  ASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
             +A IKV+GVGG G NAVNRM++SG++GV+F ++NTD QAL+LS A + IQIGE +T
Sbjct  15   GTATIKVIGVGGAGTNAVNRMVDSGIRGVEFVAVNTDRQALLLSKAASKIQIGEKIT  71



>ref|WP_021717426.1| cell division protein FtsZ [Phascolarctobacterium sp. CAG:207]
 emb|CDB45395.1| cell division protein FtsZ [Phascolarctobacterium sp. CAG:207]
Length=381

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI++G+QGV+F S+N DAQAL+LS A N IQIGE LT
Sbjct  31   RMISAGVQGVEFISVNCDAQALLLSKAPNRIQIGEKLT  68



>gb|EUJ32082.1| cell division protein FtsZ [Listeria floridensis FSL S10-1187]
Length=82

 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI+ G+QGV+F S+NTDAQAL LS +E  +QIG  LT
Sbjct  29   RMIDHGVQGVEFISVNTDAQALNLSKSEVKLQIGSKLT  66



>ref|WP_027308716.1| cell division protein FtsZ [Caloramator sp. ALD01]
Length=361

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F   A AKIKV+GVGGGGNNAVNRMI SGLQGV+F S+NTD QAL  S A   IQIGE 
Sbjct  5    DFEIEAGAKIKVVGVGGGGNNAVNRMIESGLQGVEFISVNTDRQALHHSKAPVKIQIGEK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_022090093.1| cell division protein ftsZ [Clostridium sp. CAG:492]
 emb|CDA30954.1| cell division protein ftsZ [Clostridium sp. CAG:492]
Length=126

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  171  ASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
             +A IKV+GVGGGG NAVNRM++SG++GV+F ++NTD QAL+LS A + IQIGE +T
Sbjct  15   GTATIKVIGVGGGGTNAVNRMVDSGIRGVEFVAVNTDRQALLLSKAASKIQIGEKIT  71



>ref|WP_013275763.1| cell division protein FtsZ [Thermosediminibacter oceani]
 ref|YP_003825344.1| cell division protein FtsZ [Thermosediminibacter oceani DSM 16646]
 gb|ADL07721.1| cell division protein FtsZ [Thermosediminibacter oceani DSM 16646]
Length=350

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RM+ +GL+GV+F ++NTDAQAL LS A+  IQIGE LT
Sbjct  29   RMVEAGLKGVEFIAVNTDAQALFLSKADKKIQIGEKLT  66



>ref|WP_038087826.1| cell division protein FtsZ [Tumebacillus flagellatus]
 gb|KEO83172.1| cell division protein FtsZ [Tumebacillus flagellatus]
Length=356

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F   A A+IKV+G GGGG NAVNRMI +G++GV+F ++NTDAQAL LS AE+ +QIGE 
Sbjct  5    DFDIEAFAQIKVIGCGGGGCNAVNRMIEAGIKGVEFITVNTDAQALHLSKAEHRLQIGEK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_006446859.1| cell division protein FtsZ [Alicyclobacillus hesperidum]
 gb|EJY55806.1| cell division protein FtsZ [Alicyclobacillus hesperidum URH17-3-68]
Length=379

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F S + A IKV+GVGGGG NAVNRMI SG++GV+F  +NTDAQAL L+ AE  +QIGE 
Sbjct  5    DFESDSLANIKVIGVGGGGCNAVNRMIESGVKGVEFIVVNTDAQALKLAKAETRLQIGEK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_004402383.1| MULTISPECIES: cell division protein FtsZ [Thermoanaerobacter]
 ref|YP_001664812.1| cell division protein FtsZ [Thermoanaerobacter pseudethanolicus 
ATCC 33223]
 ref|YP_004185812.1| cell division protein FtsZ [Thermoanaerobacter brockii subsp. 
finnii Ako-1]
 gb|ABY94476.1| cell division protein FtsZ [Thermoanaerobacter pseudethanolicus 
ATCC 33223]
 gb|ADV79429.1| cell division protein FtsZ [Thermoanaerobacter brockii subsp. 
finnii Ako-1]
 gb|EMT38370.1| cell division protein FtsZ [Thermoanaerobacter thermohydrosulfuricus 
WC1]
Length=357

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI++GL+GV+F +INTD QAL LS AE  IQIGE LT
Sbjct  29   RMIDAGLRGVEFIAINTDKQALYLSKAEIKIQIGEKLT  66



>ref|WP_003871212.1| cell division protein FtsZ [Thermoanaerobacter ethanolicus]
 gb|EGD50743.1| cell division protein FtsZ [Thermoanaerobacter ethanolicus JW 
200]
Length=357

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI++GL+GV+F +INTD QAL LS AE  IQIGE LT
Sbjct  29   RMIDAGLRGVEFIAINTDKQALYLSKAEIKIQIGEKLT  66



>ref|WP_011247196.1| cell division protein FtsZ [Bacillus clausii]
 ref|YP_175849.1| cell division protein FtsZ [Bacillus clausii KSM-K16]
 dbj|BAD64888.1| cell division initiation protein FtsZ [Bacillus clausii KSM-K16]
 gb|KFE65849.1| Cell division protein FtsZ [Bacillus clausii]
Length=373

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+GVGGGG+NAVNRMI +GLQGVDF ++NTDAQAL LS AE  +Q+G  LT
Sbjct  12   AQIKVIGVGGGGSNAVNRMIENGLQGVDFIAVNTDAQALHLSKAEKKLQLGGKLT  66



>ref|WP_006570252.1| cell division protein FtsZ [Thermoanaerobacter siderophilus]
 gb|EIW00884.1| cell division protein FtsZ [Thermoanaerobacter siderophilus SR4]
Length=357

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI++GL+GV+F +INTD QAL LS AE  IQIGE LT
Sbjct  29   RMIDAGLRGVEFIAINTDKQALYLSKAEIKIQIGEKLT  66



>ref|WP_012063991.1| cell division protein FtsZ [Alkaliphilus metalliredigens]
 ref|YP_001320682.1| cell division protein FtsZ [Alkaliphilus metalliredigens QYMF]
 gb|ABR49023.1| cell division protein FtsZ [Alkaliphilus metalliredigens QYMF]
Length=364

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SGL+GV+F +INTD QAL  S AE+ IQIGE LT
Sbjct  29   RMIESGLKGVEFIAINTDKQALFTSKAEHKIQIGEKLT  66



>gb|KEI67555.1| FtsZ [Planktothrix agardhii NIVA-CYA 126/8]
Length=424

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 63/94 (67%), Gaps = 5/94 (5%)
 Frame = -3

Query  270  NNTPSPFFSRQCIFPGPRRRSLRFYARTSFTS----SASAKIKvlgvggggnnavNRMIN  103
            +++ +PF  ++ I   P   S       S++S    S +AKIKV+GVGG G NAVNRMI+
Sbjct  26   DDSANPFRRKELIV-NPNNDSKDMPREDSWSSDIIPSNAAKIKVIGVGGSGGNAVNRMID  84

Query  102  SGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            S + G++F+S+NTDAQAL LS A+  +Q+G+ LT
Sbjct  85   SQVAGIEFWSMNTDAQALTLSKAQKRLQVGQKLT  118



>ref|WP_012159241.1| cell division protein FtsZ [Alkaliphilus oremlandii]
 ref|YP_001512925.1| cell division protein FtsZ [Alkaliphilus oremlandii OhILAs]
 gb|ABW18929.1| cell division protein FtsZ [Alkaliphilus oremlandii OhILAs]
Length=368

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI+SGL+GV+F S+NTD QAL  S AE+ +QIGE LT
Sbjct  29   RMIDSGLKGVEFISVNTDKQALFTSKAEHKLQIGEKLT  66



>ref|WP_007505648.1| cell division protein FtsZ [Caldalkalibacillus thermarum]
 gb|EGL82181.1| cell division protein FtsZ [Caldalkalibacillus thermarum TA2.A1]
Length=373

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+GVGGGG+NAVNRMI SG+QGV+F ++NTDAQAL LS AE+ +QIG  LT
Sbjct  12   ARIKVIGVGGGGSNAVNRMIESGVQGVEFITVNTDAQALQLSKAEHRLQIGAKLT  66



>ref|WP_009765590.1| cell division protein FtsZ [Sporosarcina newyorkensis]
 gb|EGQ27275.1| cell division protein FtsZ [Sporosarcina newyorkensis 2681]
Length=388

 Score = 53.9 bits (128),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGV+F ++NTDAQAL LS+AE  +QIGE LT
Sbjct  29   RMIEHGVQGVEFIAVNTDAQALKLSSAEVKLQIGEKLT  66



>ref|WP_010898709.1| cell division protein FtsZ [Bacillus halodurans]
 ref|NP_243424.1| cell division protein FtsZ [Bacillus halodurans C-125]
 sp|Q9K9T7.1|FTSZ_BACHD RecName: Full=Cell division protein FtsZ [Bacillus halodurans 
C-125]
 dbj|BAB06277.1| cell-division initiation protein (septum formation) [Bacillus 
halodurans C-125]
Length=382

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+GVGGGG+NAVNRMI +GLQGVDF S+NTDAQAL LS AE  +Q+G  LT
Sbjct  12   AQIKVIGVGGGGSNAVNRMIENGLQGVDFISVNTDAQALHLSKAEVKLQLGGKLT  66



>emb|CDZ74743.1| Cell division protein FtsZ [Peptoniphilus sp. 1-1]
Length=354

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGGNNAVNRMIN+G++GVDF ++NTD QAL  S AE  IQIGE +T
Sbjct  12   AKIKVVGVGGGGNNAVNRMINAGVKGVDFIALNTDKQALRASLAETKIQIGEKIT  66



>ref|WP_011564468.1| cell division protein FtsZ [Rubrobacter xylanophilus]
 ref|YP_644263.1| cell division protein FtsZ [Rubrobacter xylanophilus DSM 9941]
 gb|ABG04451.1| cell division protein FtsZ [Rubrobacter xylanophilus DSM 9941]
Length=358

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMINSGLQGV+F +INTDAQAL +  A+  I IGE +T
Sbjct  27   RMINSGLQGVEFIAINTDAQALQMCDADQKIHIGEKIT  64



>ref|WP_029052369.1| cell division protein FtsZ [Sporosarcina ureae]
Length=389

 Score = 53.9 bits (128),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGV+F ++NTDAQAL LS+AE  +QIGE LT
Sbjct  29   RMIEHGVQGVEFIAVNTDAQALKLSSAEIKLQIGEKLT  66



>ref|WP_029982211.1| cell division protein FtsZ, partial [Prochlorococcus sp. scB245a_519G16]
Length=80

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -3

Query  174  SASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            S +AKI+V+GVGGGG+NAVNRMINS L+GV F  +NTDAQAL+ S+AE+ +Q+G+ LT
Sbjct  18   SQNAKIEVIGVGGGGSNAVNRMINSDLEGVSFRVLNTDAQALLQSSAESRVQLGQNLT  75



>gb|AIS52701.1| cell division protein FtsZ [Thermoanaerobacter kivui]
Length=357

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI +GL+GV+F  INTD QAL LS AE  IQIGE LT
Sbjct  29   RMIEAGLKGVEFIVINTDKQALYLSKAETKIQIGEKLT  66



>ref|XP_007515227.1| cell division protein FtsZ [Bathycoccus prasinos]
 emb|CCO14106.1| cell division protein FtsZ [Bathycoccus prasinos]
Length=407

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = -3

Query  192  RTSFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIG  13
             T   S++SAKIKV+G GGGG NAVNRMI +G+ GV+F+ +NTDAQALV +   N  QIG
Sbjct  58   ETVVVSASSAKIKVVGCGGGGGNAVNRMIEAGVSGVEFWVVNTDAQALVNAQTVNVCQIG  117

Query  12   ELLT  1
            E +T
Sbjct  118  EQVT  121



>ref|WP_026476379.1| cell division protein FtsZ [Alkaliphilus transvaalensis]
Length=360

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SGL+GV+F ++NTD QAL  S AE+ IQIGE LT
Sbjct  29   RMIESGLKGVEFIAVNTDKQALYTSKAEHKIQIGEKLT  66



>ref|WP_009345078.1| cell division protein FtsZ [Peptoniphilus sp. oral taxon 836]
 gb|EFK39439.1| cell division protein FtsZ [Peptoniphilus sp. oral taxon 836 
str. F0141]
Length=360

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGGNNAVNRMI++G++GVDFY+ NTD QAL  S A+N IQIGE +T
Sbjct  12   AKIKVVGVGGGGNNAVNRMISAGIKGVDFYAFNTDRQALKSSLADNKIQIGEKVT  66



>ref|WP_013489176.1| cell division protein FtsZ [Bacillus cellulosilyticus]
 ref|YP_004095573.1| cell division protein FtsZ [Bacillus cellulosilyticus DSM 2522]
 gb|ADU30842.1| cell division protein FtsZ [Bacillus cellulosilyticus DSM 2522]
Length=379

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI +GLQGVDF ++NTDAQAL LS AE  +Q+G  LT
Sbjct  29   RMIENGLQGVDFIAVNTDAQALHLSKAETKLQLGGKLT  66



>ref|WP_019554726.1| cell division protein FtsZ [Zymophilus raffinosivorans]
Length=357

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI+SGLQGV+F S+NTDAQAL+ + A   IQIGE LT
Sbjct  29   RMISSGLQGVEFISVNTDAQALIHAMAPKRIQIGEKLT  66



>gb|ADZ39767.1| cell division protein FtsZ [Bartonella sp. OS09]
 gb|ADZ39768.1| cell division protein FtsZ [Bartonella sp. OS23]
 gb|ADZ39769.1| cell division protein FtsZ [Bartonella senegalensis OS02]
Length=147

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  MINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            MIN+GLQGVDF   NTDAQAL +S AE  IQ+G  +T
Sbjct  24   MINAGLQGVDFVVANTDAQALAMSKAERVIQLGAAVT  60



>ref|WP_034575506.1| hypothetical protein [Clostridiales genomosp. BVAB3]
Length=451

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            AKIKV+GVGGGG NAV RMI SG+QGV+F +INTDAQAL L++AE  ++IGE +T
Sbjct  5    AKIKVVGVGGGGCNAVQRMIMSGVQGVEFIAINTDAQALALNSAETRLKIGEKVT  59



>ref|WP_004627003.1| cell division protein FtsZ [[Clostridium] termitidis]
 gb|EMS71220.1| cell division protein FtsZ [ [[Clostridium] termitidis CT1112]
Length=377

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+G GGGGNNAVNRMI++GL+GVDF +INTD QAL LS A   IQIG+ LT
Sbjct  12   AQIKVVGCGGGGNNAVNRMIDAGLRGVDFIAINTDKQALFLSKANTKIQIGDKLT  66



>ref|WP_014464040.1| cell division protein FtsZ [Alicyclobacillus acidocaldarius]
 ref|YP_005517674.1| cell division protein FtsZ [Alicyclobacillus acidocaldarius subsp. 
acidocaldarius Tc-4-1]
 gb|AEJ43155.1| cell division protein FtsZ [Alicyclobacillus acidocaldarius subsp. 
acidocaldarius Tc-4-1]
Length=365

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SG++GV+F  +NTDAQAL LS AE  +QIGE LT
Sbjct  14   RMIESGVKGVEFIVVNTDAQALKLSKAETKLQIGEKLT  51



>ref|WP_000888975.1| hypothetical protein, partial [Bacillus anthracis]
Length=234

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>dbj|GAE04268.1| cell division protein FtsZ [Paenibacillus sp. JCM 10914]
Length=261

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F   + A+IKV+GVGGGG+NAVNRMI +G+QGV+F ++NTDAQAL L+ +E+ +QIG+ 
Sbjct  5    DFEMESLAQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHLAKSEHKLQIGDK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_018886787.1| MULTISPECIES: cell division protein FtsZ [Paenibacillus]
Length=368

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F   + A+IKV+GVGGGG+NAVNRMI++G+QGV+F ++NTDAQAL L+ +E+ +QIG+ 
Sbjct  5    DFEMESLAQIKVIGVGGGGSNAVNRMIDNGVQGVEFITVNTDAQALHLAKSEHKLQIGDK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_033672172.1| cell division protein FtsZ [Bacillus gaemokensis]
 gb|KEK25835.1| cell division protein FtsZ [Bacillus gaemokensis]
Length=384

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI+ G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIDHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_027094786.1| cell division protein FtsZ [[Clostridium] viride]
Length=373

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RM+ SG++GVDF ++NTD QAL +S+A + IQIGE LT
Sbjct  30   RMVRSGMKGVDFIAVNTDKQALAVSSATHKIQIGEKLT  67



>ref|WP_026674366.1| cell division protein FtsZ [Bacillus bogoriensis]
Length=378

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI +GLQGVDF ++NTDAQAL LS AE  +Q+G  LT
Sbjct  29   RMIENGLQGVDFIAVNTDAQALHLSKAETKLQLGGKLT  66



>gb|ACL35745.1| cell division protein [Bartonella sp. EYL-2008]
Length=111

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  MINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            MIN+GLQGVDF   NTDAQAL +S AE  IQ+G  +T
Sbjct  4    MINAGLQGVDFVVANTDAQALAMSKAERVIQLGAAVT  40



>ref|XP_001419359.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97652.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=305

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI+SGLQGV+F+++NTD+QALV S A N  QIGE +T
Sbjct  19   RMISSGLQGVEFWAVNTDSQALVNSLAPNKCQIGEQVT  56



>ref|WP_017727216.1| cell division protein FtsZ [Bacillus sp. L1(2012)]
Length=377

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+GVGGGG+NAVNRMI +GLQGVDF ++NTDAQAL LS AE  +Q+G  LT
Sbjct  12   AQIKVIGVGGGGSNAVNRMIENGLQGVDFIAVNTDAQALHLSKAEAKLQLGGKLT  66



>ref|WP_027629563.1| cell division protein FtsZ [[Clostridium] cellobioparum]
Length=377

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+G GGGGNNAVNRMI++GL+GVDF +INTD QAL LS A   IQIG+ LT
Sbjct  12   AQIKVVGCGGGGNNAVNRMIDAGLRGVDFIAINTDKQALFLSKANTKIQIGDKLT  66



>ref|WP_006598481.1| cell division protein FtsZ [Pseudoramibacter alactolyticus]
 gb|EFV01664.1| cell division protein FtsZ [Pseudoramibacter alactolyticus ATCC 
23263]
Length=366

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI SGL+GVDF SINTD QAL L+ AE  +QIGE  T
Sbjct  29   RMIESGLKGVDFVSINTDNQALALTLAEKRLQIGEKTT  66



>gb|ADE58435.1| cell devision protein [Bartonella quintana]
 gb|ADE58436.1| cell devision protein [Bartonella quintana]
 gb|AFY97813.1| cell devision protein, partial [Bartonella quintana]
 gb|AFY97814.1| cell devision protein, partial [Bartonella quintana]
 gb|AFY97815.1| cell devision protein, partial [Bartonella quintana]
 gb|AFY97816.1| cell devision protein, partial [Bartonella quintana]
Length=138

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  MINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            MIN+GLQGVDF   NTDAQAL +S AE  IQ+G  +T
Sbjct  1    MINAGLQGVDFVVANTDAQALAMSKAERVIQLGAAVT  37



>ref|WP_008297313.1| Cell division protein FtsZ [Bhargavaea cecembensis]
 gb|EMR07597.1| Cell division protein FtsZ [Bhargavaea cecembensis DSE10]
Length=392

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGV+F ++NTDAQAL LS AE  +QIGE LT
Sbjct  29   RMIEHGVQGVEFIAVNTDAQALKLSQAEVTLQIGEKLT  66



>gb|ACR43977.1| cell division protein FtsZ [Candidatus Bartonella thailandensis]
Length=162

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  MINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            MIN+GLQGVDF   NTDAQAL +S AE  IQ+G  +T
Sbjct  32   MINAGLQGVDFVVANTDAQALAMSKAERVIQLGAAVT  68



>gb|KGA97006.1| cell division protein FtsZ [Bacillus alcalophilus ATCC 27647]
Length=380

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+GVGGGG+NAVNRMI +GLQGVDF ++NTDAQAL LS AE  +Q+G  LT
Sbjct  12   AQIKVIGVGGGGSNAVNRMIENGLQGVDFIAVNTDAQALHLSKAEAKLQLGGKLT  66



>gb|ABY64535.1| cell division protein [Candidatus Bartonella eldjazairii]
Length=95

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  MINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            MIN+GLQGVDF   NTDAQAL +S AE  IQ+G  +T
Sbjct  4    MINAGLQGVDFVVANTDAQALAMSKAERVIQLGAAVT  40



>ref|WP_022190998.1| cell division protein FtsZ [Firmicutes bacterium CAG:240]
 emb|CDB43747.1| cell division protein FtsZ [Firmicutes bacterium CAG:240]
Length=381

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RM+ SG QGV+F ++NTD QAL +S+A+  IQIGE LT
Sbjct  30   RMVKSGTQGVEFIAVNTDKQALAVSSADQKIQIGEKLT  67



>ref|WP_035662468.1| cell division protein FtsZ [Bacillus akibai]
 dbj|GAE33864.1| cell division protein FtsZ [Bacillus akibai JCM 9157]
Length=381

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+GVGGGG+NAVNRMI +GLQGVDF ++NTDAQAL LS AE  +Q+G  LT
Sbjct  12   AQIKVIGVGGGGSNAVNRMIENGLQGVDFIAVNTDAQALHLSKAEAKLQLGGKLT  66



>ref|WP_014758451.1| MULTISPECIES: cell division protein FtsZ [Thermoanaerobacterium]
 ref|YP_006392181.1| cell division protein FtsZ [Thermoanaerobacterium saccharolyticum 
JW/SL-YS485]
 gb|AFK86582.1| cell division protein FtsZ [Thermoanaerobacterium saccharolyticum 
JW/SL-YS485]
 gb|ETO38404.1| cell division protein FtsZ [Thermoanaerobacterium aotearoense 
SCUT27]
Length=362

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI +GL+GV+F +INTD QAL +S AE  IQIG+ LT
Sbjct  29   RMIEAGLKGVEFIAINTDKQALYMSKAETKIQIGDKLT  66



>ref|WP_013787845.1| cell division protein FtsZ [Thermoanaerobacterium xylanolyticum]
 ref|YP_004470775.1| cell division protein FtsZ [Thermoanaerobacterium xylanolyticum 
LX-11]
 gb|AEF17103.1| cell division protein FtsZ [Thermoanaerobacterium xylanolyticum 
LX-11]
Length=362

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI +GL+GV+F +INTD QAL +S AE  IQIG+ LT
Sbjct  29   RMIEAGLKGVEFIAINTDKQALYMSKAETKIQIGDKLT  66



>ref|WP_015311907.1| cell division protein FtsZ [Thermoanaerobacterium thermosaccharolyticum]
 ref|YP_007299084.1| cell division protein FtsZ [Thermoanaerobacterium thermosaccharolyticum 
M0795]
 gb|AGB19387.1| cell division protein FtsZ [Thermoanaerobacterium thermosaccharolyticum 
M0795]
Length=362

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI +GL+GV+F +INTD QAL +S AE  IQIG+ LT
Sbjct  29   RMIEAGLKGVEFIAINTDKQALYMSKAETKIQIGDKLT  66



>ref|WP_021978524.1| cell division protein FtsZ [Clostridium sp. CAG:793]
 emb|CCY99353.1| cell division protein FtsZ [Clostridium sp. CAG:793]
Length=367

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RM++SG++GV+F +INTD QAL+LS A   IQIGE +T
Sbjct  35   RMVDSGIEGVEFVAINTDKQALMLSKASTKIQIGEKIT  72



>ref|WP_013485914.1| cell division protein FtsZ [Ethanoligenens harbinense]
 ref|YP_004092297.1| cell division protein FtsZ [Ethanoligenens harbinense YUAN-3]
 gb|ADU27566.1| cell division protein FtsZ [Ethanoligenens harbinense YUAN-3]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMINS +QGV+F SINTD QAL+LS A + +QIG+ LT
Sbjct  30   RMINSDVQGVEFISINTDRQALILSQATHKLQIGDKLT  67



>ref|WP_001972547.1| cell division protein FtsZ, partial [Bacillus cereus]
 gb|EAL15387.1| cell division protein FtsZ, partial [Bacillus cereus G9241]
Length=290

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_037289880.1| cell division protein FtsZ [Saccharibacillus sacchari]
Length=377

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F   + A+IKV+GVGGGG+NAVNRMI +G+QGV+F ++NTDAQAL L+ +E+ +QIG+ 
Sbjct  5    DFEMESLARIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHLAKSEHKLQIGDK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_039725564.1| cell division protein FtsZ [Lyngbya confervoides]
 gb|KIF13893.1| cell division protein FtsZ [Aphanocapsa montana BDHKU210001]
 gb|KIF41629.1| cell division protein FtsZ [Lyngbya confervoides BDU141951]
Length=370

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI+SGL G++F+++NTDAQAL+ +A EN +QIG+ LT
Sbjct  30   RMIHSGLSGIEFWTVNTDAQALLNTATENRLQIGQKLT  67



>ref|WP_019120692.1| cell division protein FtsZ [Brevibacillus massiliensis]
Length=381

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI +G++GV+F ++NTDAQAL LS+AE+ +QIGE LT
Sbjct  29   RMIAAGVRGVEFITVNTDAQALHLSSAESKLQIGEKLT  66



>ref|WP_011025862.1| cell division protein FtsZ [Caldanaerobacter subterraneus]
 ref|NP_623237.1| cell division protein FtsZ [Caldanaerobacter subterraneus subsp. 
tengcongensis MB4]
 gb|AAM24841.1| Cell division GTPase [Caldanaerobacter subterraneus subsp. tengcongensis 
MB4]
 gb|ERM92813.1| cell division protein FtsZ [Caldanaerobacter subterraneus subsp. 
yonseiensis KB-1]
Length=357

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RM+ +G++GV+F +INTD QAL LS AE  IQIGE LT
Sbjct  29   RMVEAGVKGVEFIAINTDKQALSLSKAETKIQIGEKLT  66



>ref|WP_003199787.1| MULTISPECIES: cell division protein FtsZ [Bacillus]
 gb|EEM04390.1| Cell division protein ftsZ [Bacillus mycoides Rock1-4]
 gb|EEM10114.1| Cell division protein ftsZ [Bacillus mycoides Rock3-17]
 gb|EEM15610.1| Cell division protein ftsZ [Bacillus pseudomycoides DSM 12442]
 gb|AIK36149.1| cell division protein FtsZ [Bacillus mycoides]
 gb|KFN17019.1| cell division protein FtsZ [Bacillus mycoides]
Length=385

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_031548434.1| cell division protein FtsZ [Salinicoccus luteus]
Length=374

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI+ G+Q V+F +INTD QAL LS AE+ IQ+GE LT
Sbjct  29   RMIDDGMQNVEFIAINTDGQALNLSKAESKIQVGEKLT  66



>gb|KHF33090.1| Cell division protein FtsZ [Paenibacillus sp. P1XP2]
Length=272

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F   + A+IKV+GVGGGG+NAVNRMI +G+QGV+F ++NTDAQAL ++ +E+ +QIG+ 
Sbjct  5    DFEMESLAQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHMAKSEHKLQIGDK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_018975671.1| cell division protein FtsZ [Saccharibacillus kuerlensis]
Length=374

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F   + A+IKV+GVGGGG+NAVNRMI +G+QGV+F ++NTDAQAL L+ +E+ +QIG+ 
Sbjct  5    DFEMESLARIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHLAKSEHKLQIGDK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_021856949.1| cell division protein FtsZ [Firmicutes bacterium CAG:555]
 emb|CCX71754.1| cell division protein FtsZ [Firmicutes bacterium CAG:555]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RM+ SG QGV+F S+NTD QAL +S A+  IQIGE LT
Sbjct  30   RMVKSGTQGVEFISVNTDKQALAVSNADQKIQIGEKLT  67



>ref|WP_036946165.1| cell division protein FtsZ [Pseudobacteroides cellulosolvens]
Length=378

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = -3

Query  165  AKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            A+IKV+GVGGGGNNAVNRMI +GL+GV+FYSINTD QAL LS +   IQIG+ LT
Sbjct  12   AQIKVIGVGGGGNNAVNRMITAGLRGVEFYSINTDKQALFLSKSNTKIQIGDKLT  66



>gb|KIH71107.1| cell division protein FtsZ [Salinicoccus roseus]
Length=374

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI+ G+Q V+F +INTD QAL LS AE+ IQ+GE LT
Sbjct  29   RMIDDGMQNVEFIAINTDGQALNLSKAESKIQVGEKLT  66



>ref|WP_013277739.1| cell division protein FtsZ [Acetohalobium arabaticum]
 ref|YP_003827358.1| cell division protein FtsZ [Acetohalobium arabaticum DSM 5501]
 gb|ADL12293.1| cell division protein FtsZ [Acetohalobium arabaticum DSM 5501]
Length=365

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI S L+GV+F +INTDAQALV SAA + +QIGE LT
Sbjct  29   RMIESQLKGVEFVAINTDAQALVSSAANSTVQIGEKLT  66



>ref|WP_026799689.1| cell division protein FtsZ [Pontibacillus halophilus]
 gb|KGX93255.1| cell division protein FtsZ [Pontibacillus halophilus JSM 076056 
= DSM 19796]
Length=392

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGV+F ++NTDAQAL LS AE  +QIGE LT
Sbjct  29   RMIEHGVQGVEFIAVNTDAQALNLSKAEVKMQIGEKLT  66



>ref|WP_002165146.1| cell division protein FtsZ [Bacillus cereus]
 gb|EJR38732.1| cell division protein ftsZ [Bacillus cereus VD048]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_036624324.1| cell division protein FtsZ [Paenibacillus barengoltzii]
Length=371

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F   + A+IKV+GVGGGG+NAVNRMI +G+QGV+F ++NTDAQAL L+ +E+ +QIG+ 
Sbjct  5    DFEMESLAQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHLAKSEHKLQIGDK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_000888988.1| cell division protein FtsZ [Bacillus anthracis]
 ref|NP_846285.1| cell division protein FtsZ [Bacillus anthracis str. Ames]
 ref|YP_020687.1| cell division protein FtsZ [Bacillus anthracis str. 'Ames Ancestor']
 ref|YP_030008.1| cell division protein FtsZ [Bacillus anthracis str. Sterne]
 ref|YP_002813193.1| cell division protein FtsZ [Bacillus anthracis str. CDC 684]
 ref|YP_002868142.1| cell division protein FtsZ [Bacillus anthracis str. A0248]
 ref|YP_006210910.1| cell division protein FtsZ [Bacillus anthracis str. H9401]
 gb|AAP27771.1| cell division protein FtsZ [Bacillus anthracis str. Ames]
 gb|AAT33162.1| cell division protein FtsZ [Bacillus anthracis str. 'Ames Ancestor']
 gb|AAT56059.1| cell division protein FtsZ [Bacillus anthracis str. Sterne]
 gb|EDR17530.1| cell division protein FtsZ [Bacillus anthracis str. A0488]
 gb|EDR86277.1| cell division protein FtsZ [Bacillus anthracis str. A0193]
 gb|EDR90813.1| cell division protein FtsZ [Bacillus anthracis str. A0442]
 gb|EDT17977.1| cell division protein FtsZ [Bacillus anthracis str. A0465]
 gb|EDV17083.1| cell division protein FtsZ [Bacillus anthracis str. Tsiankovskii-I]
 gb|ACP15347.1| cell division protein FtsZ [Bacillus anthracis str. CDC 684]
 gb|ACQ50137.1| cell division protein FtsZ [Bacillus anthracis str. A0248]
 gb|AFH85242.1| Cell division protein FtsZ [Bacillus anthracis str. H9401]
 gb|EJT21731.1| cell division protein FtsZ [Bacillus anthracis str. UR-1]
 gb|EJY90571.1| cell division protein FtsZ [Bacillus anthracis str. BF1]
 gb|AHE85444.1| Cell division GTPase [Bacillus anthracis str. A16R]
 gb|AHE91312.1| Cell division GTPase [Bacillus anthracis str. A16]
 dbj|GAE99422.1| cell division protein FtsZ [Bacillus anthracis CZC5]
 gb|EVT92301.1| cell division protein FtsZ [Bacillus anthracis 8903-G]
 gb|EVT96694.1| cell division protein FtsZ [Bacillus anthracis 9080-G]
 gb|EVU03684.1| cell division protein FtsZ [Bacillus anthracis 52-G]
 gb|AHK40014.1| cell division protein FtsZ [Bacillus anthracis str. SVA11]
 gb|EXJ18628.1| cell division protein FtsZ [Bacillus anthracis str. 95014]
 gb|AIF58038.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KEY94276.1| cell division protein FtsZ [Bacillus anthracis str. Carbosap]
 gb|AIK10060.1| Cell division protein FtsZ [Bacillus anthracis]
 gb|KFJ82463.1| cell division protein FtsZ [Bacillus anthracis]
 gb|AIK57566.1| cell division protein FtsZ [Bacillus anthracis]
 gb|AIK62200.1| cell division protein FtsZ [Bacillus anthracis str. Vollum]
 gb|AIK52436.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KFL67343.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KFL71306.1| cell division protein FtsZ [Bacillus anthracis]
 gb|AIM07753.1| cell division protein FtsZ [Bacillus anthracis]
 gb|AIM13231.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KGZ44797.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KGZ50052.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KGZ55557.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KGZ61976.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KGZ63639.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KGZ70354.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KGZ77660.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KGZ81621.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KGZ99198.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KHA01025.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KHA02959.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KHA07600.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KHA08764.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KHA25286.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KHA26182.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KHA28714.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KHA35226.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KHG46383.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KHG53055.1| cell division protein FtsZ [Bacillus anthracis]
 gb|KHG59300.1| cell division protein FtsZ [Bacillus anthracis]
 gb|AJA88062.1| cell division protein FtsZ [Bacillus anthracis]
Length=386

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_028537941.1| cell division protein FtsZ [Paenibacillus sp. J14]
Length=371

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F   + A+IKV+GVGGGG+NAVNRMI +G+QGV+F ++NTDAQAL L+ +E+ +QIG+ 
Sbjct  5    DFEMESLAQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHLAKSEHKLQIGDK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_000888989.1| cell division protein FtsZ [Bacillus cereus]
 gb|EEK77593.1| Cell division protein ftsZ [Bacillus cereus R309803]
Length=383

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>gb|KFM23856.1| Cell division protein FtsZ-like protein 1, chloroplastic [Auxenochlorella 
protothecoides]
Length=389

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 6/78 (8%)
 Frame = -3

Query  216  RRSLRFYARTSFTSS------ASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQ  55
            R  + F  + S+ S         A+IKV+GVGGGG NAVNRMI+SGLQGV+F+++NTDAQ
Sbjct  5    RSHIGFVTQASYGSGNYGPVGGDARIKVIGVGGGGGNAVNRMISSGLQGVEFWAVNTDAQ  64

Query  54   ALVLSAAENPIQIGELLT  1
            AL    A N +QIG  LT
Sbjct  65   ALESHQALNKLQIGTTLT  82



>ref|WP_000888992.1| cell division protein FtsZ [Bacillus cereus]
 gb|EEL49601.1| Cell division protein ftsZ [Bacillus cereus Rock3-44]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_000888983.1| cell division protein FtsZ [Bacillus cereus]
 gb|EEK66170.1| Cell division protein ftsZ [Bacillus cereus MM3]
 gb|EJS71784.1| cell division protein ftsZ [Bacillus cereus BAG2X1-2]
 gb|EJV60304.1| cell division protein ftsZ [Bacillus cereus BAG6X1-1]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_017548457.1| cell division protein FtsZ [Salinicoccus carnicancri]
Length=379

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI+ G+Q V+F +INTD QAL LS AE+ IQ+GE LT
Sbjct  29   RMIDDGMQNVEFIAINTDGQALNLSKAESKIQVGEKLT  66



>ref|WP_006574902.1| cell division protein FtsZ [Pseudoflavonifractor capillosus]
 gb|EDM97951.1| cell division protein FtsZ [Pseudoflavonifractor capillosus ATCC 
29799]
Length=379

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RM+ SG++GVDF ++NTD QAL +S+A   IQIGE LT
Sbjct  30   RMVKSGMKGVDFIAVNTDKQALTMSSATYKIQIGEKLT  67



>ref|WP_013298223.1| cell division protein FtsZ [Thermoanaerobacterium thermosaccharolyticum]
 ref|YP_003852341.1| cell division protein FtsZ [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
 gb|ADL69257.1| cell division protein FtsZ [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
Length=362

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI +GL+GV+F +INTD QAL +S AE  IQIG+ LT
Sbjct  29   RMIEAGLKGVEFIAINTDKQALYMSKAETKIQIGDKLT  66



>ref|WP_026590251.1| cell division protein FtsZ [Bacillus sp. UNC437CL72CviS29]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_016106026.1| cell division protein ftsZ [Bacillus cereus]
 gb|EOP65982.1| cell division protein ftsZ [Bacillus cereus VD118]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_000888982.1| cell division protein FtsZ [Bacillus cereus]
 gb|EJQ55786.1| cell division protein ftsZ [Bacillus cereus BAG5X2-1]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_026788004.1| MULTISPECIES: cell division protein FtsZ [Planktothrix]
Length=424

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 62/94 (66%), Gaps = 5/94 (5%)
 Frame = -3

Query  270  NNTPSPFFSRQCIFPGPRRRSLRFYARTSFTS----SASAKIKvlgvggggnnavNRMIN  103
            +++ +PF  ++ I   P   S       S++     S +AKIKV+GVGG G NAVNRMI+
Sbjct  26   DDSANPFRRKELIV-NPNNDSKDMPREDSWSGDIIPSNAAKIKVIGVGGSGGNAVNRMID  84

Query  102  SGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            S + G++F+S+NTDAQAL LS A+  +Q+G+ LT
Sbjct  85   SQVAGIEFWSMNTDAQALTLSKAQKRLQVGQKLT  118



>ref|WP_002160704.1| cell division protein FtsZ [Bacillus cereus]
 gb|EJQ98821.1| cell division protein ftsZ [Bacillus cereus MC67]
 gb|EOP20622.1| cell division protein ftsZ [Bacillus cereus MC118]
Length=385

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_017811789.1| cell division protein FtsZ [Paenibacillus sp. A9]
Length=382

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F   + A+IKV+GVGGGG+NAVNRMI +G+QGV+F ++NTDAQAL L+ +E+ +QIG+ 
Sbjct  5    DFEMESLAQIKVIGVGGGGSNAVNRMIENGVQGVEFITVNTDAQALHLAKSEHKLQIGDK  64

Query  6    LT  1
            LT
Sbjct  65   LT  66



>ref|WP_025147788.1| cell division protein FtsZ [Bacillus sp. H1a]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_000888991.1| MULTISPECIES: cell division protein FtsZ [Bacillus cereus group]
 ref|NP_980246.1| cell division protein FtsZ [Bacillus cereus ATCC 10987]
 ref|YP_002339896.1| cell division protein FtsZ [Bacillus cereus AH187]
 ref|YP_002531409.1| cell division protein ftsz [Bacillus cereus Q1]
 ref|YP_005106271.1| cell division protein FtsZ [Bacillus cereus NC7401]
 ref|YP_005567483.1| cell division protein FtsZ [Bacillus thuringiensis serovar finitimus 
YBT-020]
 gb|AAS42854.1| cell division protein FtsZ [Bacillus cereus ATCC 10987]
 gb|EDZ56491.1| cell division protein FtsZ [Bacillus cereus H3081.97]
 gb|ACJ82507.1| cell division protein FtsZ [Bacillus cereus AH187]
 gb|ACM14120.1| cell division protein FtsZ [Bacillus cereus Q1]
 gb|EEK43601.1| Cell division protein ftsZ [Bacillus cereus m1293]
 gb|EEK82685.1| Cell division protein ftsZ [Bacillus cereus ATCC 4342]
 gb|EEK99392.1| Cell division protein ftsZ [Bacillus cereus BDRD-ST26]
 gb|EEM21086.1| Cell division protein ftsZ [Bacillus thuringiensis serovar tochigiensis 
BGSC 4Y1]
 gb|ADY23065.1| cell division protein FtsZ [Bacillus thuringiensis serovar finitimus 
YBT-020]
 dbj|BAL19531.1| cell division protein FtsZ [Bacillus cereus NC7401]
 gb|EJP97594.1| cell division protein ftsZ [Bacillus cereus IS075]
 gb|EJQ02290.1| cell division protein ftsZ [Bacillus cereus AND1407]
 gb|EJR18758.1| cell division protein ftsZ [Bacillus cereus MSX-D12]
 gb|EJR21015.1| cell division protein ftsZ [Bacillus cereus MSX-A12]
 gb|EJR51444.1| cell division protein ftsZ [Bacillus cereus VD102]
 gb|EOO88794.1| cell division protein ftsZ [Bacillus cereus IS845/00]
 gb|EOO96614.1| cell division protein ftsZ [Bacillus cereus IS195]
 gb|KDB40505.1| cell division protein FtsZ [Bacillus cereus]
 gb|KFK75407.1| cell division protein FtsZ [Bacillus cereus]
 gb|KFL84779.1| cell division protein FtsZ [Bacillus cereus]
 gb|KFM87613.1| cell division protein FtsZ [Bacillus cereus ATCC 4342]
 gb|AIY74259.1| cell division protein FtsZ [Bacillus cereus]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_000888978.1| cell division protein FtsZ [Bacillus cereus]
 gb|EJR66540.1| cell division protein ftsZ [Bacillus cereus VD115]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_002121892.1| cell division protein FtsZ [Bacillus cereus]
 gb|EJQ48603.1| cell division protein ftsZ [Bacillus cereus BAG6X1-2]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_003758246.1| cell division protein FtsZ [Listeria grayi]
 gb|EFI84461.1| cell division protein FtsZ [Listeria grayi DSM 20601]
 gb|EUJ29262.1| cell division protein FtsZ [Listeria grayi FSL F6-1183]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = -3

Query  180  TSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            TS + A IKV+GVGGGGNNAVNRMI+ G+QGV+F S+NTDAQAL L+ +E  +QIG  LT
Sbjct  7    TSESLATIKVIGVGGGGNNAVNRMIDHGVQGVEFISVNTDAQALKLAKSETKLQIGTKLT  66



>ref|WP_000888976.1| cell division protein FtsZ [Bacillus cereus]
 gb|EEL59630.1| Cell division protein ftsZ [Bacillus cereus Rock4-18]
 gb|EOP22157.1| cell division protein ftsZ [Bacillus cereus VD131]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_000888979.1| cell division protein FtsZ [Bacillus cereus]
 gb|EJS71079.1| cell division protein ftsZ [Bacillus cereus BAG2X1-1]
 gb|EJS77442.1| cell division protein ftsZ [Bacillus cereus BAG2X1-3]
Length=381

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_017186040.1| cell division protein FtsZ [Alkalibacillus haloalkaliphilus]
Length=376

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGV+F ++NTDAQAL LS A+  +QIGE LT
Sbjct  29   RMIEHGVQGVEFIAVNTDAQALNLSKADTKLQIGEKLT  66



>ref|WP_034635783.1| cell division protein FtsZ [Bacillus manliponensis]
 gb|KEK20901.1| cell division protein FtsZ [Bacillus manliponensis]
Length=382

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_000888985.1| cell division protein FtsZ [Bacillus thuringiensis]
 gb|EEM94852.1| Cell division protein ftsZ [Bacillus thuringiensis IBL 200]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_000888981.1| cell division protein FtsZ [Bacillus cereus]
 gb|EEL80807.1| Cell division protein ftsZ [Bacillus cereus AH1271]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_000888977.1| MULTISPECIES: cell division protein FtsZ [Bacillus cereus group]
 ref|YP_006829949.1| phosphate starvation-induced protein [Bacillus thuringiensis 
MC28]
 ref|YP_008781847.1| Cell division protein FtsZ [Bacillus toyonensis BCT-7112]
 gb|EEL21479.1| Cell division protein ftsZ [Bacillus cereus Rock1-3]
 gb|EEL33121.1| Cell division protein ftsZ [Bacillus cereus Rock3-28]
 gb|EEL38927.1| Cell division protein ftsZ [Bacillus cereus Rock3-29]
 gb|EJQ36689.1| cell division protein ftsZ [Bacillus cereus BAG5O-1]
 gb|EJQ79375.1| cell division protein ftsZ [Bacillus cereus HuB4-10]
 gb|EJQ86098.1| cell division protein ftsZ [Bacillus cereus HuB5-5]
 gb|EJR65961.1| cell division protein ftsZ [Bacillus cereus VD148]
 gb|EJS54261.1| cell division protein ftsZ [Bacillus cereus BAG1O-2]
 gb|EJV50323.1| cell division protein ftsZ [Bacillus cereus BAG4X2-1]
 gb|EJV52974.1| cell division protein ftsZ [Bacillus cereus BAG6O-1]
 gb|EJV95697.1| cell division protein ftsZ [Bacillus cereus HuB2-9]
 gb|AFU14550.1| Cell division protein ftsZ [Bacillus thuringiensis MC28]
 gb|EOP24621.1| cell division protein ftsZ [Bacillus cereus HuA2-3]
 gb|EOP38613.1| cell division protein ftsZ [Bacillus cereus VD214]
 gb|EPF04291.1| cell division protein ftsZ [Bacillus cereus BAG2O-2]
 gb|AHA07158.1| Cell division protein FtsZ [Bacillus toyonensis BCT-7112]
Length=384

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMI  G+QGVDF ++NTDAQAL LS AE  +QIG  LT
Sbjct  29   RMIEHGVQGVDFIAVNTDAQALNLSKAETKMQIGGKLT  66



>ref|WP_034106842.1| cell division protein FtsZ [Desulfotomaculum sp. BIC-A1/1_c6]
Length=353

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  RMINSGLQGVDFYSINTDAQALVLSAAENPIQIGELLT  1
            RMIN+GL+GV+F S+NTD+QAL ++ A N IQIG  LT
Sbjct  29   RMINAGLKGVEFISVNTDSQALQMALANNKIQIGSKLT  66



>ref|WP_018661364.1| Cell division protein FtsZ [Thermobrachium celere]
 emb|CDF57837.1| Cell division protein FtsZ [Thermobrachium celere DSM 8682]
Length=358

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  186  SFTSSASAKIKvlgvggggnnavNRMINSGLQGVDFYSINTDAQALVLSAAENPIQIGEL  7
             F   + A+IKV+GVGGGGNNAVNRMI SGL GV+F S+NTD QAL LS A   IQIGE 
Sbjct  5    DFEIESGAQIKVVGVGGGGNNAVNRMIESGLSGVEFISVNTDRQALYLSKAGQKIQIGEK  64

Query  6    LT  1
            +T
Sbjct  65   MT  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512662103758