BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10242_g1_i2 len=1283 path=[1349:0-138 90:139-164 1512:165-1282]

Length=1283
                                                                      Score     E

gb|EYU22790.1|  hypothetical protein MIMGU_mgv1a011924mg                187   3e-52   
ref|XP_006367365.1|  PREDICTED: uncharacterized protein LOC102584616    181   3e-48   
ref|XP_009765498.1|  PREDICTED: uncharacterized protein LOC104217042    180   2e-47   
ref|XP_009599457.1|  PREDICTED: uncharacterized protein LOC104095114    177   3e-46   
ref|XP_004250627.1|  PREDICTED: uncharacterized protein LOC101264586    173   2e-45   
ref|XP_007131293.1|  hypothetical protein PHAVU_011G001700g             172   3e-45   
gb|KHM98827.1|  Transmembrane protein 205                               170   1e-44   
ref|XP_006585749.1|  PREDICTED: uncharacterized protein LOC100808861    169   3e-44   
emb|CBI35529.3|  unnamed protein product                                164   2e-42   
ref|NP_001236456.1|  seed maturation protein PM27 precursor             159   8e-41   
gb|KHN32470.1|  Transmembrane protein 205                               159   8e-41   
ref|XP_010244844.1|  PREDICTED: uncharacterized protein LOC104588560    162   9e-41   
gb|ACU20077.1|  unknown                                                 159   1e-40   Glycine max [soybeans]
ref|XP_006591921.1|  PREDICTED: seed maturation protein PM27 isof...    156   7e-40   
gb|AHF21579.1|  late embryogenesis abundant protein                     156   5e-39   
ref|XP_011096288.1|  PREDICTED: uncharacterized protein LOC105175521    157   6e-39   
ref|XP_010063755.1|  PREDICTED: uncharacterized protein LOC104450764    156   7e-39   
ref|XP_010912527.1|  PREDICTED: uncharacterized protein LOC105038415    150   4e-37   
emb|CDP10676.1|  unnamed protein product                                147   5e-36   
gb|KFK41626.1|  hypothetical protein AALP_AA2G152200                    145   7e-35   
ref|XP_008807668.1|  PREDICTED: uncharacterized protein LOC103719958    144   1e-34   
emb|CAN77279.1|  hypothetical protein VITISV_037453                     141   2e-34   Vitis vinifera
ref|XP_010415942.1|  PREDICTED: uncharacterized protein LOC104701...    141   1e-33   
dbj|BAJ91683.1|  predicted protein                                      141   2e-33   
gb|EMT04172.1|  hypothetical protein F775_30700                         140   4e-33   
ref|XP_006859142.1|  hypothetical protein AMTR_s00070p00109270          139   5e-33   
ref|XP_010415941.1|  PREDICTED: uncharacterized protein LOC104701...    139   7e-33   
ref|XP_010428064.1|  PREDICTED: uncharacterized protein LOC104712790    139   7e-33   
ref|XP_002521819.1|  conserved hypothetical protein                     139   9e-33   Ricinus communis
gb|EMS55518.1|  hypothetical protein TRIUR3_20741                       139   1e-32   
ref|XP_010431488.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    136   1e-32   
ref|XP_011074959.1|  PREDICTED: uncharacterized protein LOC105159552    137   3e-32   
ref|XP_010645833.1|  PREDICTED: uncharacterized protein LOC100256187    137   3e-32   
ref|XP_009781129.1|  PREDICTED: uncharacterized protein LOC104230092    137   4e-32   
ref|XP_006302242.1|  hypothetical protein CARUB_v10020268mg             136   5e-32   
ref|NP_177355.1|  late embryogenesis abundant domain-containing p...    136   5e-32   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52683.1|  hypothetical protein Csa_5G650480                       135   5e-32   
gb|KHG00926.1|  Transmembrane protein                                   133   5e-32   
ref|XP_009414887.1|  PREDICTED: uncharacterized protein LOC103995882    135   1e-31   
gb|AAO42139.1|  unknown protein                                         135   1e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CBI35531.3|  unnamed protein product                                133   2e-31   
ref|XP_002446504.1|  hypothetical protein SORBIDRAFT_06g017050          134   5e-31   Sorghum bicolor [broomcorn]
ref|XP_006390707.1|  hypothetical protein EUTSA_v10018523mg             132   8e-31   
ref|XP_002887412.1|  hypothetical protein ARALYDRAFT_476340             133   8e-31   
ref|XP_004141640.1|  PREDICTED: uncharacterized protein LOC101208468    132   9e-31   
ref|XP_006434684.1|  hypothetical protein CICLE_v10001073mg             132   2e-30   
ref|XP_010095892.1|  hypothetical protein L484_008289                   132   2e-30   
ref|XP_008361622.1|  PREDICTED: uncharacterized protein LOC103425319    125   8e-30   
emb|CDY03662.1|  BnaA02g15750D                                          129   1e-29   
ref|XP_009127895.1|  PREDICTED: uncharacterized protein LOC103852751    129   1e-29   
ref|XP_006473884.1|  PREDICTED: uncharacterized protein LOC102618133    129   2e-29   
emb|CDX82188.1|  BnaC02g21020D                                          129   2e-29   
ref|XP_008361625.1|  PREDICTED: seed biotin-containing protein SB...    127   5e-29   
ref|XP_003579779.1|  PREDICTED: uncharacterized protein LOC100835682    128   7e-29   
ref|XP_009591281.1|  PREDICTED: uncharacterized protein LOC104088327    127   8e-29   
ref|XP_008339201.1|  PREDICTED: uncharacterized protein LOC103402237    127   9e-29   
ref|XP_008368140.1|  PREDICTED: uncharacterized protein LOC103431746    127   1e-28   
ref|XP_008459625.1|  PREDICTED: uncharacterized protein LOC103498695    126   1e-28   
ref|XP_004162866.1|  PREDICTED: uncharacterized protein LOC101231534    124   3e-28   
ref|XP_010521158.1|  PREDICTED: uncharacterized protein LOC104800...    125   4e-28   
gb|EPS65890.1|  hypothetical protein M569_08895                         124   4e-28   
ref|XP_010521159.1|  PREDICTED: uncharacterized protein LOC104800...    124   5e-28   
ref|XP_008352801.1|  PREDICTED: uncharacterized protein LOC103416320    125   7e-28   
ref|XP_009362438.1|  PREDICTED: uncharacterized protein LOC103952558    124   8e-28   
ref|XP_006356548.1|  PREDICTED: uncharacterized protein LOC102585078    120   1e-26   
gb|KFK44353.1|  hypothetical protein AALP_AA1G246500                    118   2e-26   
ref|NP_173674.1|  Late embryogenesis abundant protein (LEA) famil...    117   7e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893240.1|  hypothetical protein ARALYDRAFT_472499             117   7e-26   
ref|XP_004516134.1|  PREDICTED: uncharacterized protein LOC101512941    117   8e-26   
ref|XP_008368141.1|  PREDICTED: transmembrane protein 205-like          113   1e-25   
gb|KDP35105.1|  hypothetical protein JCGZ_10947                         117   2e-25   
ref|XP_007224898.1|  hypothetical protein PRUPE_ppa022136mg             116   3e-25   
ref|XP_006305902.1|  hypothetical protein CARUB_v10011076mg             114   5e-25   
ref|XP_010460015.1|  PREDICTED: uncharacterized protein LOC104740962    114   9e-25   
ref|XP_010498737.1|  PREDICTED: uncharacterized protein LOC104776381    113   1e-24   
gb|AFW58284.1|  hypothetical protein ZEAMMB73_800275                    115   2e-24   
ref|XP_008219004.1|  PREDICTED: uncharacterized protein LOC103319269    113   7e-24   
ref|XP_006416182.1|  hypothetical protein EUTSA_v10008247mg             109   1e-23   
ref|XP_010322771.1|  PREDICTED: uncharacterized protein LOC101255207    110   3e-23   
gb|KEH29295.1|  late embryogenesis abundant protein (LEA) family ...    110   3e-23   
ref|XP_010431487.1|  PREDICTED: uncharacterized protein LOC104715812    109   2e-22   
emb|CDY69861.1|  BnaCnng65680D                                          107   2e-22   
emb|CAH66906.1|  H0823A09.7                                             104   6e-21   Oryza sativa [red rice]
emb|CAD41023.1|  OSJNBb0086G13.7                                        104   6e-21   Oryza sativa Japonica Group [Japonica rice]
gb|EAY94192.1|  hypothetical protein OsI_15966                          104   6e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_010477518.1|  PREDICTED: uncharacterized protein LOC104756605    102   6e-21   
ref|XP_009103229.1|  PREDICTED: uncharacterized protein LOC103829321    102   9e-21   
emb|CDY25745.1|  BnaA07g10370D                                          102   1e-20   
ref|XP_008663208.1|  PREDICTED: transmembrane protein 205-like        98.6    2e-20   
ref|XP_010682507.1|  PREDICTED: uncharacterized protein LOC104897327  96.7    1e-18   
ref|XP_004299879.1|  PREDICTED: uncharacterized protein LOC101292414  92.4    9e-17   
ref|XP_010474290.1|  PREDICTED: uncharacterized protein LOC104753790  83.6    3e-14   
gb|KDO38275.1|  hypothetical protein CISIN_1g037813mg                 80.1    4e-13   
gb|EYU22791.1|  hypothetical protein MIMGU_mgv11b021530mg             76.3    9e-13   
ref|XP_004495913.1|  PREDICTED: transmembrane protein 205-like        73.2    2e-11   
ref|XP_002989961.1|  hypothetical protein SELMODRAFT_428422           75.9    2e-11   
ref|XP_002968913.1|  hypothetical protein SELMODRAFT_440470           75.9    2e-11   
ref|XP_003591427.1|  Transmembrane protein                            72.0    5e-11   
gb|AFK35536.1|  unknown                                               71.6    8e-11   
ref|XP_002275502.1|  PREDICTED: transmembrane protein 205             70.9    1e-10   Vitis vinifera
ref|XP_010038275.1|  PREDICTED: transmembrane protein 205-like        70.1    2e-10   
ref|XP_007145160.1|  hypothetical protein PHAVU_007G215400g           70.1    2e-10   
ref|XP_010559194.1|  PREDICTED: transmembrane protein 205-like        70.1    2e-10   
ref|XP_010521444.1|  PREDICTED: transmembrane protein 205-like        70.1    2e-10   
gb|KHG21214.1|  Transmembrane protein                                 69.7    2e-10   
gb|EYU46797.1|  hypothetical protein MIMGU_mgv1a013677mg              69.3    3e-10   
gb|AHF21581.1|  late embryogenesis abundant protein                   69.3    4e-10   
ref|XP_011079574.1|  PREDICTED: transmembrane protein 205             68.6    7e-10   
gb|KHF99197.1|  Transmembrane protein                                 68.2    9e-10   
ref|XP_008386731.1|  PREDICTED: transmembrane protein 205             68.2    9e-10   
ref|XP_002967473.1|  hypothetical protein SELMODRAFT_169057           67.8    1e-09   
ref|XP_004300464.1|  PREDICTED: transmembrane protein 205-like        67.8    1e-09   
ref|NP_001235713.1|  uncharacterized protein LOC100305973             67.4    1e-09   
ref|XP_002960240.1|  hypothetical protein SELMODRAFT_139492           67.4    1e-09   
ref|XP_004229403.1|  PREDICTED: transmembrane protein 205             67.0    2e-09   
gb|KCW50100.1|  hypothetical protein EUGRSUZ_K03533                   66.6    2e-09   
ref|XP_010468945.1|  PREDICTED: transmembrane protein 205-like        66.6    3e-09   
ref|XP_009594998.1|  PREDICTED: transmembrane protein 205             66.6    3e-09   
ref|XP_008345233.1|  PREDICTED: transmembrane protein 205-like        66.6    3e-09   
ref|XP_006444466.1|  hypothetical protein CICLE_v10022218mg           66.6    3e-09   
ref|XP_008369056.1|  PREDICTED: transmembrane protein 205-like        66.6    3e-09   
ref|XP_009788476.1|  PREDICTED: transmembrane protein 205             66.2    3e-09   
ref|XP_009378694.1|  PREDICTED: transmembrane protein 205-like is...  66.2    4e-09   
gb|KDP28239.1|  hypothetical protein JCGZ_14010                       65.9    4e-09   
ref|XP_006349201.1|  PREDICTED: transmembrane protein 205-like        65.9    4e-09   
ref|XP_005405712.1|  PREDICTED: transmembrane protein 205 isoform X1  65.5    5e-09   
ref|XP_007051074.1|  Late embryogenesis abundant protein (LEA) fa...  65.9    5e-09   
ref|XP_010413270.1|  PREDICTED: transmembrane protein 205-like is...  65.9    5e-09   
gb|AFK37222.1|  unknown                                               65.5    6e-09   
ref|XP_009339789.1|  PREDICTED: transmembrane protein 205             65.5    6e-09   
gb|AFK41050.1|  unknown                                               65.9    6e-09   
ref|XP_010512647.1|  PREDICTED: transmembrane protein 205-like        65.5    6e-09   
ref|XP_006402366.1|  hypothetical protein EUTSA_v10006236mg           65.5    6e-09   
gb|KFK35427.1|  hypothetical protein AALP_AA5G283100                  65.5    7e-09   
ref|XP_010095303.1|  hypothetical protein L484_001912                 65.5    7e-09   
ref|XP_009116920.1|  PREDICTED: transmembrane protein 205             65.1    9e-09   
ref|XP_008235189.1|  PREDICTED: transmembrane protein 205             65.1    9e-09   
emb|CDX76644.1|  BnaC08g32300D                                        65.1    9e-09   
gb|EAW84194.1|  MBC3205, isoform CRA_b                                63.5    9e-09   
ref|XP_007200488.1|  hypothetical protein PRUPE_ppa011378mg           65.1    1e-08   
ref|XP_010038276.1|  PREDICTED: transmembrane protein 205-like        64.7    1e-08   
emb|CAB83108.1|  putative protein                                     63.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|EPS63239.1|  hypothetical protein M569_11548                       64.3    2e-08   
ref|XP_006291839.1|  hypothetical protein CARUB_v10018012mg           64.3    2e-08   
ref|XP_010038277.1|  PREDICTED: transmembrane protein 205-like        63.9    2e-08   
ref|XP_010259357.1|  PREDICTED: transmembrane protein 205             63.9    2e-08   
ref|XP_010544979.1|  PREDICTED: transmembrane protein 205             63.9    2e-08   
ref|XP_002515303.1|  conserved hypothetical protein                   63.5    3e-08   Ricinus communis
gb|AAL06485.1|AF411796_1  AT3g62580/T12C14_280                        63.5    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876679.1|  hypothetical protein ARALYDRAFT_486758           63.5    3e-08   
ref|NP_567130.1|  Late embryogenesis abundant protein (LEA) famil...  63.5    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302753.1|  hypothetical protein POPTR_0002s19890g           63.2    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_004163149.1|  PREDICTED: transmembrane protein 205-like is...  63.2    3e-08   
ref|XP_008451494.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  63.2    4e-08   
ref|XP_009378695.1|  PREDICTED: transmembrane protein 205-like is...  62.8    4e-08   
ref|XP_004163148.1|  PREDICTED: transmembrane protein 205-like is...  63.2    4e-08   
ref|XP_003123224.2|  PREDICTED: transmembrane protein 205 isoform 3   62.4    5e-08   
ref|XP_006023565.1|  PREDICTED: transmembrane protein 205-like        62.0    5e-08   
dbj|BAE87170.1|  unnamed protein product                              61.2    6e-08   
ref|NP_001124814.1|  transmembrane protein 205                        62.4    6e-08   Pongo abelii [orang utan]
ref|XP_010827125.1|  PREDICTED: transmembrane protein 205-like        61.2    6e-08   
ref|XP_005861438.1|  PREDICTED: transmembrane protein 205             62.0    7e-08   
ref|XP_004060075.1|  PREDICTED: transmembrane protein 205 isoform 1   62.0    7e-08   
ref|XP_006104631.1|  PREDICTED: transmembrane protein 205             62.0    7e-08   
ref|NP_212133.1|  transmembrane protein 205                           62.0    7e-08   Homo sapiens [man]
ref|XP_007460759.1|  PREDICTED: transmembrane protein 205             61.6    9e-08   
ref|XP_010372011.1|  PREDICTED: transmembrane protein 205             61.6    9e-08   
ref|XP_004277434.1|  PREDICTED: transmembrane protein 205             61.6    9e-08   
ref|XP_003123222.1|  PREDICTED: transmembrane protein 205 isoform 1   61.6    9e-08   
ref|XP_007168997.1|  PREDICTED: transmembrane protein 205 isoform X1  61.6    1e-07   
ref|XP_007106730.1|  PREDICTED: transmembrane protein 205 isoform X1  61.6    1e-07   
emb|CDP17085.1|  unnamed protein product                              62.0    1e-07   
ref|XP_004008585.1|  PREDICTED: transmembrane protein 205 isoform 1   61.2    1e-07   
ref|XP_010914547.1|  PREDICTED: transmembrane protein 205             61.2    1e-07   
ref|XP_006905911.1|  PREDICTED: transmembrane protein 205             61.2    1e-07   
ref|XP_002761800.1|  PREDICTED: transmembrane protein 205             60.8    2e-07   Callithrix jacchus [common marmoset]
ref|XP_006291838.1|  hypothetical protein CARUB_v10018012mg           60.8    2e-07   
ref|XP_009393181.1|  PREDICTED: transmembrane protein 205-like        61.2    2e-07   
ref|XP_005682437.1|  PREDICTED: transmembrane protein 205 isoform X1  60.8    2e-07   
ref|XP_006063973.1|  PREDICTED: transmembrane protein 205 isoform X1  60.8    2e-07   
ref|XP_005970320.1|  PREDICTED: ras-related protein Rab-3D-like i...  60.8    2e-07   
ref|XP_005890840.1|  PREDICTED: transmembrane protein 205             60.5    2e-07   
ref|XP_003941832.1|  PREDICTED: transmembrane protein 205             60.5    2e-07   
ref|XP_004748447.1|  PREDICTED: transmembrane protein 205 isoform X1  60.5    2e-07   
ref|XP_008797225.1|  PREDICTED: transmembrane protein 205-like        60.8    2e-07   
ref|XP_004824423.1|  PREDICTED: transmembrane protein 205 isoform X1  60.5    2e-07   
ref|NP_001032688.1|  transmembrane protein 205                        60.5    2e-07   Bos taurus [bovine]
ref|XP_010679353.1|  PREDICTED: transmembrane protein 205             60.5    3e-07   
gb|EDL25229.1|  cDNA sequence BC010787, isoform CRA_c                 58.9    3e-07   
gb|EMS50621.1|  hypothetical protein TRIUR3_30946                     60.5    3e-07   
ref|NP_001181752.1|  transmembrane protein 205                        60.1    3e-07   
ref|XP_007993494.1|  PREDICTED: transmembrane protein 205             60.1    3e-07   
ref|XP_003914966.1|  PREDICTED: transmembrane protein 205             60.1    3e-07   
ref|XP_004398961.1|  PREDICTED: transmembrane protein 205 isoform 1   60.1    3e-07   
gb|ABK26434.1|  unknown                                               60.5    4e-07   Picea sitchensis
ref|XP_006161572.1|  PREDICTED: transmembrane protein 205 isoform X1  59.7    4e-07   
emb|CAN72243.1|  hypothetical protein VITISV_022622                   62.0    4e-07   Vitis vinifera
ref|XP_003577242.1|  PREDICTED: transmembrane protein 205-like        60.1    5e-07   
ref|XP_004378381.1|  PREDICTED: transmembrane protein 205             59.7    5e-07   
ref|XP_006744351.1|  PREDICTED: transmembrane protein 205 isoform X1  59.3    5e-07   
ref|XP_006663101.1|  PREDICTED: transmembrane protein 205-like        59.7    6e-07   
ref|XP_006875194.1|  PREDICTED: transmembrane protein 205             59.3    6e-07   
ref|XP_006262415.1|  PREDICTED: transmembrane protein 205             59.3    6e-07   
ref|NP_001068440.1|  Os11g0673100                                     59.3    6e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002287805.1|  predicted protein                                58.5    7e-07   Thalassiosira pseudonana CCMP1335
gb|EMT31562.1|  hypothetical protein F775_26736                       59.3    8e-07   
ref|XP_006855302.1|  hypothetical protein AMTR_s00057p00058340        58.9    9e-07   
ref|NP_848692.2|  transmembrane protein 205 isoform 2                 58.5    9e-07   Mus musculus [mouse]
ref|XP_001775467.1|  predicted protein                                58.9    1e-06   
ref|XP_005970319.1|  PREDICTED: ras-related protein Rab-3D-like i...  60.5    1e-06   
ref|XP_007079370.1|  PREDICTED: transmembrane protein 205 isoform X2  58.5    1e-06   
ref|XP_007079371.1|  PREDICTED: transmembrane protein 205 isoform X3  58.5    1e-06   
ref|XP_008797440.1|  PREDICTED: transmembrane protein 205-like        58.5    1e-06   
ref|NP_001240796.1|  transmembrane protein 205 isoform 1              59.3    1e-06   
ref|XP_006928488.1|  PREDICTED: transmembrane protein 205 isoform X3  58.2    1e-06   
ref|XP_003981931.2|  PREDICTED: transmembrane protein 205 isoform X1  58.5    1e-06   
ref|XP_004595566.1|  PREDICTED: transmembrane protein 205             58.2    1e-06   
ref|XP_007079369.1|  PREDICTED: transmembrane protein 205 isoform X1  58.2    1e-06   
ref|XP_001754410.1|  predicted protein                                57.8    1e-06   
ref|XP_006928487.1|  PREDICTED: transmembrane protein 205 isoform X2  58.2    2e-06   
ref|XP_004716881.1|  PREDICTED: transmembrane protein 205             57.8    2e-06   
ref|XP_006664096.1|  PREDICTED: transmembrane protein 205-like        58.2    2e-06   
ref|XP_010976605.1|  PREDICTED: transmembrane protein 205             57.8    2e-06   
ref|XP_008156250.1|  PREDICTED: transmembrane protein 205             57.8    2e-06   
ref|XP_533912.2|  PREDICTED: transmembrane protein 205                57.4    2e-06   Canis lupus familiaris [dogs]
ref|XP_003413409.1|  PREDICTED: transmembrane protein 205             57.4    2e-06   
ref|XP_001490060.1|  PREDICTED: transmembrane protein 205 isoform X1  57.4    2e-06   Equus caballus [domestic horse]
ref|XP_007951790.1|  PREDICTED: transmembrane protein 205             57.4    3e-06   
dbj|BAA92764.1|  unnamed protein product                              57.0    3e-06   Mus musculus [mouse]
ref|XP_006184934.1|  PREDICTED: transmembrane protein 205             57.0    3e-06   
ref|XP_002921398.1|  PREDICTED: transmembrane protein 205-like is...  57.0    3e-06   
ref|XP_003797991.1|  PREDICTED: transmembrane protein 205             57.0    3e-06   
ref|XP_006206363.1|  PREDICTED: transmembrane protein 205             57.0    3e-06   
gb|EQB78321.1|  transmembrane protein 205                             57.0    4e-06   
ref|XP_010931739.1|  PREDICTED: transmembrane protein 205-like        57.0    5e-06   
ref|XP_005346982.1|  PREDICTED: transmembrane protein 205             56.6    5e-06   
ref|XP_004084163.1|  PREDICTED: transmembrane protein 205-like is...  56.2    6e-06   
ref|XP_004442704.1|  PREDICTED: transmembrane protein 205             56.2    7e-06   
ref|XP_002451243.1|  hypothetical protein SORBIDRAFT_05g026390        56.2    8e-06   Sorghum bicolor [broomcorn]
ref|XP_005050720.1|  PREDICTED: transmembrane protein 205-like        55.5    9e-06   
ref|XP_003579299.1|  PREDICTED: transmembrane protein 205-like        56.2    9e-06   
ref|XP_006765857.1|  PREDICTED: transmembrane protein 205             55.5    1e-05   
gb|KFW82049.1|  Transmembrane protein 205                             55.5    1e-05   
ref|XP_008923476.1|  PREDICTED: transmembrane protein 205             55.5    1e-05   
ref|XP_008831793.1|  PREDICTED: transmembrane protein 205             55.5    1e-05   
ref|XP_006898852.1|  PREDICTED: transmembrane protein 205             55.5    1e-05   
ref|XP_004616637.1|  PREDICTED: transmembrane protein 205             55.5    1e-05   
ref|XP_004689065.1|  PREDICTED: transmembrane protein 205             55.5    1e-05   
ref|XP_008501066.1|  PREDICTED: transmembrane protein 205             55.1    1e-05   
gb|KFO96458.1|  Transmembrane protein 205                             55.1    1e-05   
gb|EGV96173.1|  Transmembrane protein 205                             55.1    2e-05   
ref|XP_008051446.1|  PREDICTED: transmembrane protein 205             54.7    2e-05   
gb|KFO58631.1|  Transmembrane protein 205                             54.7    2e-05   
ref|XP_008631326.1|  PREDICTED: transmembrane protein 205             54.7    2e-05   
ref|XP_009087166.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  54.7    2e-05   
ref|XP_010407732.1|  PREDICTED: transmembrane protein 205             54.7    2e-05   
ref|XP_004979940.1|  PREDICTED: transmembrane protein 205-like        55.1    2e-05   
ref|XP_004458246.1|  PREDICTED: transmembrane protein 205 isoform 1   54.7    2e-05   
ref|XP_001773290.1|  predicted protein                                57.0    2e-05   
ref|XP_006631556.1|  PREDICTED: transmembrane protein 205-like        54.3    2e-05   
ref|NP_001100274.1|  transmembrane protein 205                        54.3    2e-05   Rattus norvegicus [brown rat]
ref|XP_006879881.1|  PREDICTED: transmembrane protein 205-like        54.3    2e-05   
ref|XP_009402510.1|  PREDICTED: transmembrane protein 205-like        54.7    3e-05   
ref|XP_003275696.2|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  54.7    3e-05   
ref|XP_007488571.1|  PREDICTED: transmembrane protein 205 isoform X1  54.3    3e-05   
ref|XP_005521357.1|  PREDICTED: transmembrane protein 205-like        54.3    3e-05   
ref|XP_002151655.1|  conserved hypothetical protein                   53.9    3e-05   Talaromyces marneffei ATCC 18224
ref|XP_007629766.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...  55.1    3e-05   
ref|XP_004979942.1|  PREDICTED: transmembrane protein 205-like is...  54.3    3e-05   
ref|XP_004979943.1|  PREDICTED: transmembrane protein 205-like is...  53.9    4e-05   
ref|XP_006982404.1|  PREDICTED: transmembrane protein 205 isoform X1  53.9    4e-05   
ref|XP_008510119.1|  PREDICTED: transmembrane protein 205             52.8    4e-05   
ref|XP_005336217.1|  PREDICTED: transmembrane protein 205 isoform X1  53.5    5e-05   
ref|XP_007638645.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...  55.5    5e-05   
ref|XP_005482352.1|  PREDICTED: transmembrane protein 205-like        53.1    5e-05   
ref|XP_008706293.1|  PREDICTED: transmembrane protein 205             53.1    6e-05   
ref|XP_009412120.1|  PREDICTED: transmembrane protein 205-like        53.1    8e-05   
gb|KFP76624.1|  Transmembrane protein 205                             52.8    8e-05   
ref|XP_007359865.1|  hypothetical protein DICSQDRAFT_46861            52.8    8e-05   
ref|XP_009069237.1|  PREDICTED: transmembrane protein 205             52.8    8e-05   
ref|NP_001142530.1|  uncharacterized protein LOC100274772             53.1    8e-05   
gb|KGL92914.1|  Transmembrane protein 205                             52.4    9e-05   
ref|XP_002443352.1|  hypothetical protein SORBIDRAFT_08g017880        53.1    1e-04   
ref|XP_009883117.1|  PREDICTED: transmembrane protein 205             52.8    1e-04   
ref|NP_001143919.1|  hypothetical protein precursor                   52.8    1e-04   
ref|XP_005440481.1|  PREDICTED: transmembrane protein 205-like        52.4    1e-04   
ref|XP_005423056.1|  PREDICTED: acyl-coenzyme A thioesterase 11       54.7    1e-04   
ref|XP_003760487.1|  PREDICTED: transmembrane protein 205             52.4    1e-04   
ref|XP_005233039.1|  PREDICTED: transmembrane protein 205-like        52.4    1e-04   
gb|EMD41633.1|  hypothetical protein CERSUDRAFT_90206                 52.4    1e-04   
ref|NP_001067006.1|  Os12g0557400                                     52.4    1e-04   
ref|XP_009931299.1|  PREDICTED: transmembrane protein 205             51.2    2e-04   
ref|XP_007020086.1|  Uncharacterized protein TCM_036472               52.8    2e-04   
gb|KDO36882.1|  hypothetical protein CISIN_1g043201mg                 50.8    2e-04   
dbj|BAJ98474.1|  predicted protein                                    52.0    3e-04   
dbj|GAM41334.1|  hypothetical protein TCE0_042r14381                  52.0    3e-04   
ref|XP_009505811.1|  PREDICTED: transmembrane protein 205             51.2    3e-04   
gb|ACN28527.1|  unknown                                               50.8    3e-04   
ref|NP_001085593.1|  transmembrane protein 205                        50.8    3e-04   
gb|EPE10281.1|  hypothetical protein F503_05376                       50.8    4e-04   
ref|XP_007782057.1|  hypothetical protein W97_05986                   50.1    4e-04   
ref|XP_007265995.1|  hypothetical protein FOMMEDRAFT_19631            50.8    4e-04   
ref|XP_006025882.1|  PREDICTED: transmembrane protein 205-like        50.8    4e-04   
gb|KFP43373.1|  Transmembrane protein 205                             50.4    4e-04   
ref|XP_010121685.1|  PREDICTED: transmembrane protein 205             50.8    4e-04   
ref|XP_004900414.1|  PREDICTED: transmembrane protein 205 isoform X1  50.8    5e-04   
ref|XP_010156462.1|  PREDICTED: transmembrane protein 205             50.8    5e-04   
ref|XP_009976137.1|  PREDICTED: transmembrane protein 205             50.4    6e-04   
tpg|DAA55263.1|  TPA: hypothetical protein ZEAMMB73_408392            49.7    6e-04   
ref|XP_004667532.1|  PREDICTED: transmembrane protein 205             50.4    6e-04   
ref|XP_009558984.1|  PREDICTED: transmembrane protein 205             50.1    7e-04   
ref|XP_003767367.1|  PREDICTED: transmembrane protein 205-like        51.6    7e-04   
ref|XP_007526029.1|  PREDICTED: transmembrane protein 205             50.1    8e-04   
ref|XP_002480589.1|  conserved hypothetical protein                   50.4    8e-04   
gb|KFO05600.1|  Transmembrane protein 205                             49.7    9e-04   
ref|XP_009285770.1|  PREDICTED: transmembrane protein 205             49.7    0.001   
ref|XP_008031847.1|  hypothetical protein TRAVEDRAFT_25694            49.7    0.001   



>gb|EYU22790.1| hypothetical protein MIMGU_mgv1a011924mg [Erythranthe guttata]
Length=266

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 133/227 (59%), Gaps = 26/227 (11%)
 Frame = -1

Query  833  KKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLST  654
            ++EL +I+ +  EV  DAF+Y FSP+ L+ V G  HL+G A AYGMCVWV+F SSYVL+ 
Sbjct  39   ERELSEIIHKAQEVAVDAFDYAFSPDRLSPVTGILHLMGFAAAYGMCVWVTFASSYVLAG  98

Query  653  ALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIM  474
            ALPR Q A VQ+K+YP+YFKAM YS+G A  GH +  T+    ++   + GFNL+ +L M
Sbjct  99   ALPRNQFANVQSKIYPVYFKAMAYSVGLALFGHLMSHTKRLSPTSVGMFQGFNLMTSLAM  158

Query  473  VLVNLVYLEPRAAKvm--------------------------vermkmekeegrgmngeg  372
            +LVNL+YLEPRA KVM                          V+                
Sbjct  159  ILVNLLYLEPRATKVMLERMKKEKEEGTVKEGQASGLPSGRVVDSTAETVGRVSSTEKSE  218

Query  371  sgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTV  231
                   +++LS+ L++LNS SS LNV TLM++T HL H+ QR+H V
Sbjct  219  EAVAKSQIIRLSQMLQRLNSYSSLLNVFTLMSLTWHLVHLGQRLHIV  265



>ref|XP_006367365.1| PREDICTED: uncharacterized protein LOC102584616 [Solanum tuberosum]
Length=402

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 160/314 (51%), Gaps = 59/314 (19%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFS------------------------------PNADTKAVV  1143
             MMN+LA+SL+L TL  +G  +                              PN ++K+  
Sbjct  1     MMNVLAISLVLSTLVTAGFLTPNKKEDVVLVVEFDQNEGTKVLISPQQAQIPNQNSKSSY  60

Query  1142  VEFEKDNNNGGGNTKVSISPQ-----------EAAQNSRLEKGYVLNAMEKISEKAEEVK  996
             V   KD          S+ P            +  QNS   K  V +A  K  EK   V 
Sbjct  61    VSDLKDKLYEKAEEATSVLPNIGQGISSPYVNQHQQNS--AKDVVCDAFGKCKEKITTVF  118

Query  995   QRFKDAAAVLPNVGEGIS------GHQeeeeevketakeaaekvktaakekvtekvKDRR  834
              + KD       V EG++        + ++   K  +K+   + K    +    +  +  
Sbjct  119   GKTKD------KVEEGVTEASEKVKEKAKDVVDKTKSKKDEVEQKVEQVKGEISEKAEEG  172

Query  833   KKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLST  654
             KK+LKDI+ RG     D F YIFS  NL  V    HLLG A AYGMC+WV+F+SSYVL+ 
Sbjct  173   KKDLKDIIVRG----RDVFTYIFSLGNLRHVMRLMHLLGFAVAYGMCIWVTFVSSYVLAR  228

Query  653   ALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIM  474
             ALPRQQ A VQ+K+YP+YFKAM Y +G AF GHFL Q RW Y++  EA  GFNL+A++ M
Sbjct  229   ALPRQQFAVVQSKIYPVYFKAMAYCVGPAFIGHFLSQKRWFYANLGEAVQGFNLLASISM  288

Query  473   VLVNLVYLEPRAAK  432
             +LVNL+YLEPRA K
Sbjct  289   LLVNLLYLEPRATK  302


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -1

Query  344  KLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQ  246
            KLS++LKKLNS SSFLNVLTLMA+T HL H+ Q
Sbjct  364  KLSQKLKKLNSYSSFLNVLTLMALTHHLVHLTQ  396



>ref|XP_009765498.1| PREDICTED: uncharacterized protein LOC104217042 [Nicotiana sylvestris]
Length=475

 Score =   180 bits (456),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = -1

Query  824  LKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALP  645
            LKDIL RG E  YD F YIFS ENL  V    H LG A AYGMC+WV+F+SSYVL+ ALP
Sbjct  236  LKDILGRGREFFYDVFVYIFSLENLRTVMRLVHFLGFAVAYGMCIWVTFVSSYVLARALP  295

Query  644  RQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLV  465
            RQQ A VQ+K+YP+YFKAM Y +GAAF GH L Q R  ++++ E   GFNL++++ M+LV
Sbjct  296  RQQFALVQSKIYPVYFKAMAYCVGAAFVGHMLSQKRRLHTNSAEVVQGFNLLSSIAMLLV  355

Query  464  NLVYLEPRAAK  432
            NL+YLEPRA K
Sbjct  356  NLIYLEPRATK  366


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 66/110 (60%), Gaps = 25/110 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT-------------KAVVVEFEKDNNNGGGNTKVS  1092
             MMN LA+SL+L TL  +G F+PN +              + VVVEF+K++      TKV 
Sbjct  1     MMNFLAISLVLTTLVTAGFFNPNPENNKKQDDVILKEGPRVVVVEFDKEDG-----TKVL  55

Query  1091  ISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             ISPQ+ A+  + + GYV +  +K+ EKAEE       A++VLPN+G+GIS
Sbjct  56    ISPQQEAEIPKGKSGYVSDLKDKLYEKAEE-------ASSVLPNIGQGIS  98


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  344  KLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRV  240
            +LS++LKKLNS SSFLNVLTLMA++ HL H+ Q V
Sbjct  437  RLSQKLKKLNSYSSFLNVLTLMALSHHLVHLTQLV  471



>ref|XP_009599457.1| PREDICTED: uncharacterized protein LOC104095114 [Nicotiana tomentosiformis]
Length=469

 Score =   177 bits (448),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -1

Query  818  DILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQ  639
            DIL RG E  YD F YIFS ENL  V    H LG A AYGMC+WV+F+SSYVL+ ALPRQ
Sbjct  238  DILGRGREFFYDVFAYIFSLENLRTVMLLVHFLGFAVAYGMCIWVTFVSSYVLARALPRQ  297

Query  638  QIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNL  459
            Q A VQ+K+Y +YFKAM Y +GAAF GH L Q R  Y+S+ EA  GFNL+A++ M+LVNL
Sbjct  298  QFALVQSKIYLVYFKAMAYCVGAAFLGHLLSQKRRLYASSAEAVQGFNLLASIAMLLVNL  357

Query  458  VYLEPRAAK  432
            +YLEPRA K
Sbjct  358  LYLEPRATK  366


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 66/110 (60%), Gaps = 25/110 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT-------------KAVVVEFEKDNNNGGGNTKVS  1092
             MMN LA+SL+L TL  +G F+PN +              + VVVEF+K++      TK+ 
Sbjct  1     MMNFLAISLVLTTLVTAGFFNPNPENNKKKEDVILKEGPRVVVVEFDKEDG-----TKIL  55

Query  1091  ISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             ISPQ+ A+  + + GYV +  +K+ EKAEE       A++VLPN+G+GIS
Sbjct  56    ISPQQEAEIPKGKSGYVSDLKDKLHEKAEE-------ASSVLPNIGQGIS  98


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  344  KLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRV  240
            +LS++LKKLNS SSFLNVLTLMA++ HL H+ Q V
Sbjct  433  RLSQKLKKLNSYSSFLNVLTLMALSHHLVHLTQLV  467



>ref|XP_004250627.1| PREDICTED: uncharacterized protein LOC101264586 [Solanum lycopersicum]
Length=407

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = -1

Query  833  KKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLST  654
            K+++KDI+ RG +   D F Y FS  NL  V    HLLG + AYGMC+WV+FISSYVL+ 
Sbjct  174  KEDMKDIIVRGRDFFRDVFTYRFSFGNLRHVMRLMHLLGFSVAYGMCIWVTFISSYVLAR  233

Query  653  ALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIM  474
             LPRQQ A VQ+K+YP+YFKAM Y +G AF GHFL Q RW Y++  EA  GFNL+A++ M
Sbjct  234  VLPRQQFAVVQSKIYPVYFKAMAYCVGLAFVGHFLSQKRWFYTNLGEAVQGFNLLASISM  293

Query  473  VLVNLVYLEPRAAK  432
            +LVN +YLEPRA K
Sbjct  294  LLVNSLYLEPRATK  307


 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 18/103 (17%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADTKAV-VVEFEKDNNNGGGNTKVSISPQEA-----A  1071
             M+NILA+SL+L TL  +G  +PN     V VVEF  D+N G   TKV ISPQ+A      
Sbjct  1     MINILAISLVLSTLVTAGFLTPNKKEDVVLVVEF--DHNQG---TKVLISPQQAQIPNDN  55

Query  1070  QNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
              NS  + GYV +  +K+ EKAEE       A++VLPN+G+GI+
Sbjct  56    SNSNSKSGYVSDLKDKLYEKAEE-------ASSVLPNIGQGIA  91



>ref|XP_007131293.1| hypothetical protein PHAVU_011G001700g [Phaseolus vulgaris]
 gb|ESW03287.1| hypothetical protein PHAVU_011G001700g [Phaseolus vulgaris]
Length=412

 Score =   172 bits (437),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 143/422 (34%), Positives = 199/422 (47%), Gaps = 97/422 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT--------------KAVVVEFEKDNNNGGGNTKV  1095
             MMN+LA++L   +L AS IFSP   T              + VVVE+++D   G  NTK+
Sbjct  1     MMNVLAVTLFFTSLAASAIFSPPPPTHHKQGANTIVKEGHRVVVVEYDQD---GHHNTKI  57

Query  1094  SISPQEAAQNSRLE----------------------------------------------  1053
             SISP +   +   +                                              
Sbjct  58    SISPDQPTHHHHHQVPENGHDRIREAASVLPNLGQGISQPQDAAFLHAPKELICDAYGKC  117

Query  1052  KGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGISGHQeeeeevketakeaaekvkta  873
             K  V +AMEK  EKA+EV Q+ K+ A    +VG+ ++    +E +     K         
Sbjct  118   KHRVADAMEKTKEKAQEVLQKKKEVAR---HVGDNVAD-ALKETKESVHDKARDVHEYAQ  173

Query  872   akekvtekvKDRRKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMC  693
                +  +   +    E +D LRR    L  +F    S E+L +V G AHLLG AT+YGMC
Sbjct  174   DTVETAKNHVNSNVSEARDYLRRLKHTLKLSFG---SLESLNSVMGVAHLLGFATSYGMC  230

Query  692   VWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATE  513
             VWV+FISSYV S A+ R Q A +Q+K+YP+YF+AM YS G A  GH  G T    S+ + 
Sbjct  231   VWVTFISSYVQSRAMARHQFAVMQSKIYPVYFRAMAYSTGVALFGHVFGNTNTLLSNKSH  290

Query  512   AYLGFNLVAALIMVLVNLVYLEPRAAKvmvermkmekeegrgmngegsg-----------  366
             A   +NL+A+L  +  N +YLEPRA K+M ER+K+EKEEGRG                  
Sbjct  291   ALQTYNLLASLATLFFNSLYLEPRATKLMFERIKIEKEEGRGREDVTVSGERGRTGVREP  350

Query  365   ---------ggspgmMKLSKRLKKLN-------SQSSFLNVLTLMAMTLHLAHIAQRVHT  234
                        S     +  R+ KLN       S SS LN+L L+++T HL ++AQR+H 
Sbjct  351   QRTPDGTGPSISTDHDAVRSRIIKLNDKLKKLNSYSSVLNILNLISLTWHLVYLAQRLHR  410

Query  233   VC  228
              C
Sbjct  411   TC  412



>gb|KHM98827.1| Transmembrane protein 205 [Glycine soja]
Length=383

 Score =   170 bits (431),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 124/407 (30%), Positives = 193/407 (47%), Gaps = 97/407 (24%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT-------------KAVVVEFEKDNNNGGGNTKVS  1092
             MMN+L LSL+L +L A+GIFSPN  T             + VVVE+++    G   TK+S
Sbjct  2     MMNVLGLSLVLTSLAAAGIFSPNPRTEKHGASTIVKEGHRVVVVEYDQ---GGHQKTKIS  58

Query  1091  ISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGISGHQeeeeevk  912
             ISP++   +   +   +                  K+AA+VLPN+ +GIS   +   + +
Sbjct  59    ISPEQPTHHHDHDDDLI------------------KEAASVLPNLCQGISSSSQYSHQPQ  100

Query  911   etakeaaekvktaakekvtekvKDRRKKELKDILRRGGEVL------------------Y  786
                      +     +++      + K ++ D + +  E +                  +
Sbjct  101   NHMDHGPLNLHAPNPKELICDAYGKCKHKISDAMEKAQEAIHKKKDKICKTKETVYDKAH  160

Query  785   DAFEYI-----FSPENLTAVFGTAH----------------LLGLA------TAYGMCVW  687
             D  EY       + E++ +    A                 L+G+A      TAYG+CVW
Sbjct  161   DVHEYAQDTVEAAKEDMASNVSNAKDALKLLIGGSMESLNSLMGVANLLGFATAYGICVW  220

Query  686   VSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY  507
             V+FISSYV S  +PRQQ A VQ+K+YP+YF+AM YSI  AF  HFL       +S ++  
Sbjct  221   VTFISSYVQSRTMPRQQFAVVQSKIYPVYFRAMAYSIALAFLAHFLAHR----NSNSDML  276

Query  506   LGFNLVAALIMVLVNLVYLEPRAAKvm--------------vermkmekeegrgmngegs  369
               +NL+A+L  + +N +YLEPRA K+M               + M   +        +  
Sbjct  277   QSYNLLASLATLFLNYLYLEPRATKLMLERIKIEKEEGRGRSQDMMSSRTVDPKEPADQE  336

Query  368   gggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
                   ++KL+ +LKK NS SSFLN+L LM++T HL ++AQR+H +C
Sbjct  337   DALRSRIIKLNDKLKKFNSYSSFLNILNLMSLTWHLVYLAQRLHHIC  383



>ref|XP_006585749.1| PREDICTED: uncharacterized protein LOC100808861 [Glycine max]
Length=383

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 123/407 (30%), Positives = 193/407 (47%), Gaps = 97/407 (24%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT-------------KAVVVEFEKDNNNGGGNTKVS  1092
             MMN+L LSL+L +L A+GIFSPN  T             + VVVE+++    G   TK+S
Sbjct  2     MMNVLGLSLVLTSLAAAGIFSPNPRTEKHGASTIVKEGHRVVVVEYDQ---GGHQKTKIS  58

Query  1091  ISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGISGHQeeeeevk  912
             ISP++   +   +   +                  K+AA+VLPN+ +GIS   +   + +
Sbjct  59    ISPEQPTHHHDHDDDLI------------------KEAASVLPNLCQGISSSSQYSHQPQ  100

Query  911   etakeaaekvktaakekvtekvKDRRKKELKDILRRGGEVL------------------Y  786
                      +     +++      + K ++ D + +  E +                  +
Sbjct  101   NHMDHGPLNLHAPNPKELICDAYGKCKHKISDAMEKAQEAIHKKKDKICKTKETVYDKAH  160

Query  785   DAFEYI-----FSPENLTAVFGTAH----------------LLGLA------TAYGMCVW  687
             D  EY       + E++ +    A                 L+G+A      TAYG+CVW
Sbjct  161   DVHEYAQDTVEAAKEDMASNVSNAKDALKLLIGGSMESLNSLMGVANLLGFATAYGICVW  220

Query  686   VSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY  507
             V+FISSYV S  +PRQQ A VQ+K+YP+YF+AM YSI  AF  HFL       ++ ++  
Sbjct  221   VTFISSYVQSRTMPRQQFAVVQSKIYPVYFRAMAYSIALAFLAHFLAHR----NTNSDML  276

Query  506   LGFNLVAALIMVLVNLVYLEPRAAKvm--------------vermkmekeegrgmngegs  369
               +NL+A+L  + +N +YLEPRA K+M               + M   +        +  
Sbjct  277   QSYNLLASLATLFLNYLYLEPRATKLMLERIKIEKEEGRGRSQDMMSSRTVDPKEPADQE  336

Query  368   gggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
                   ++KL+ +LKK NS SSFLN+L LM++T HL ++AQR+H +C
Sbjct  337   DALRSRIIKLNDKLKKFNSYSSFLNILNLMSLTWHLVYLAQRLHHIC  383



>emb|CBI35529.3| unnamed protein product [Vitis vinifera]
Length=361

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 132/396 (33%), Positives = 193/396 (49%), Gaps = 96/396 (24%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNAD-----------------TKAVVVEFEKDNNNGGGN  1104
             MMN  AL L + +L A+ I+SPN D                 T+ VVVE++K+   G GN
Sbjct  1     MMNGFALFLAVSSLVAASIWSPNPDQKQKDYPGAEEVIVKEGTRVVVVEYDKE---GPGN  57

Query  1103  TKVSISPQEAAQNSRLEKGYVLNAM---------------EKISEKAEEVKQRFKDA---  978
             TKVSIS QEA   +   K  + +A                +K+SEK  E+++  K+    
Sbjct  58    TKVSISTQEAHHVT--PKELICDAFGKCKEKIATKIGRSEQKVSEKVHEIQEGAKETYGK  115

Query  977   --AAVLPNVGEGISGHQeeeeevketakeaaekvktaakekvtekvKDRRKKELKDILRR  804
                 V+ NV E +S                              +     + E+KD   +
Sbjct  116   AKEKVIGNVEEKLS------------------------------QKVHDIQDEVKDAYTK  145

Query  803   GGE-VLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIAT  627
               E V+YD   Y+ S + + ++    H+LG ATAYG+ VWV+F SS+VL+ ALP QQ A 
Sbjct  146   TKEKVVYDVVNYMLSTDAIGSLTCVIHILGFATAYGVRVWVTFFSSFVLAGALPNQQFAI  205

Query  626   VQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLE  447
             VQ+K+YP YFK M   +G A  GH L Q         + + G  L+A L ++L+NL+YLE
Sbjct  206   VQSKIYPFYFKTMASCVGLALLGHALSQGEKVLLGKPDLFQGHALLATLHIILINLLYLE  265

Query  446   PRAAKvmvermkmekeegrgmngeg-----------------------sgggspgmMKLS  336
             PRA KVM ER+++E EE +G                                +  +++L+
Sbjct  266   PRATKVMFERIRVENEERKGQESSRVEPGKEGEPTTGASDPQVMGRLDQETVNNQILELN  325

Query  335   KRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
             + LKKLN+ SS LN+LTLM + LHL ++A R++  C
Sbjct  326   EMLKKLNAYSSLLNILTLMVLKLHLVYLAHRLYMTC  361



>ref|NP_001236456.1| seed maturation protein PM27 precursor [Glycine max]
 gb|AAD30426.1|AF117723_1 seed maturation protein PM27 [Glycine max]
Length=339

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 164/331 (50%), Gaps = 40/331 (12%)
 Frame = -1

Query  1154  KAVVVEFEKDNNNGGGNTKVSISPQEAAQNSRLE---------KGYVLNAMEKISEKAEE  1002
             + VVVE+++    G  NTK+SISP++    +  +         K  +++AMEK    ++E
Sbjct  27    RVVVVEYDQ---GGHQNTKISISPEQPTHANLKDPICDAYGKCKHKIVDAMEK----SQE  79

Query  1001  VKQRFKDAAAVLPNVGEGISGHQeeeeevketakeaaekvktaakekvtekvKDRRKKEL  822
             V    KD  A        ++G  +E    K        +      +          K   
Sbjct  80    VIHEKKDEIAANKEAARQVAGKTKERVYDKARHVHEYAQNTVETAKNHIACNVSNAKDAF  139

Query  821   KDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPR  642
             K ++    E            ++L ++ G A++LG +TAYGMCVWV+FISSYV S A+ R
Sbjct  140   KRLIAGSLE-----------RQSLNSLMGVANMLGFSTAYGMCVWVTFISSYVQSRAMAR  188

Query  641   QQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVN  462
             QQ A VQ+K+YP+YF+AM YSIG A   H L       S+ ++    +NL+A+L+ +  N
Sbjct  189   QQFAVVQSKIYPVYFRAMSYSIGVALFAHVLAHRNTLLSNKSDLLQAYNLLASLVTLFFN  248

Query  461   LVYLEPRAAKvm-------------vermkmekeegrgmngegsgggspgmMKLSKRLKK  321
              +YLEPRA K+M                    + +               ++KL+ +LKK
Sbjct  249   SLYLEPRATKLMFERIKIEKEEGRGRSEDVSSRTKEPASTTADQDAVRTRIIKLNDKLKK  308

Query  320   LNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
             LNS SSFLN+L LM++T HL ++AQR+  +C
Sbjct  309   LNSYSSFLNILNLMSLTWHLVYLAQRLPHIC  339



>gb|KHN32470.1| Transmembrane protein 205 [Glycine soja]
Length=341

 Score =   159 bits (401),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 164/331 (50%), Gaps = 40/331 (12%)
 Frame = -1

Query  1154  KAVVVEFEKDNNNGGGNTKVSISPQEAAQNSRLE---------KGYVLNAMEKISEKAEE  1002
             + VVVE+++    G  NTK+SISP++    +  +         K  +++AMEK    ++E
Sbjct  29    RVVVVEYDQ---GGHQNTKISISPEQPTHANPKDPICDAYGKCKHKIVDAMEK----SQE  81

Query  1001  VKQRFKDAAAVLPNVGEGISGHQeeeeevketakeaaekvktaakekvtekvKDRRKKEL  822
             V    KD  A        ++G  +E    K        +      +          K   
Sbjct  82    VIHEKKDEIAANKEAARQVAGKTKERVYDKARHVHEYAQNTVETAKNHIACNVSNAKDAF  141

Query  821   KDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPR  642
             K ++    E            ++L ++ G A++LG +TAYGMCVWV+FISSYV S A+ R
Sbjct  142   KRLIAGSLE-----------RQSLNSLMGVANMLGFSTAYGMCVWVTFISSYVQSRAMAR  190

Query  641   QQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVN  462
             QQ A VQ+K+YP+YF+AM YSIG A   H L       S+ ++    +NL+A+L+ +  N
Sbjct  191   QQFAVVQSKIYPVYFRAMSYSIGVALFAHVLAHRNTLLSNKSDLLQAYNLLASLVTLFFN  250

Query  461   LVYLEPRAAKvm-------------vermkmekeegrgmngegsgggspgmMKLSKRLKK  321
              +YLEPRA K+M                    + +               ++KL+ +LKK
Sbjct  251   SLYLEPRATKLMFERIKIEKEEGRGRSEDVSSRTKEPASTTADQDAVRTRIIKLNDKLKK  310

Query  320   LNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
             LNS SSFLN+L LM++T HL ++AQR+  +C
Sbjct  311   LNSYSSFLNILNLMSLTWHLVYLAQRLPHIC  341



>ref|XP_010244844.1| PREDICTED: uncharacterized protein LOC104588560 [Nelumbo nucifera]
Length=543

 Score =   162 bits (411),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 96/136 (71%), Gaps = 0/136 (0%)
 Frame = -1

Query  839  RRKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVL  660
            R ++ L +I RRG EV YDA  Y  SPE ++++ G   L+G ATAYGMCVWV+F+SS+VL
Sbjct  296  RAQQNLTEIFRRGREVAYDAAMYAVSPETVSSLMGLLELIGFATAYGMCVWVTFVSSHVL  355

Query  659  STALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAAL  480
            + ALPRQQ   VQ+K+YP+YF+AM YSIG A   HFLG+     S   E    +NL+  L
Sbjct  356  AGALPRQQFGVVQSKIYPVYFRAMAYSIGTALVAHFLGRQGRVVSGPAETLQAYNLLGYL  415

Query  479  IMVLVNLVYLEPRAAK  432
            +MVLVNL+YLEP+A K
Sbjct  416  VMVLVNLLYLEPQATK  431


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 70/120 (58%), Gaps = 26/120 (22%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT--------------KAVVVEFEKDNNNGGGNTKV  1095
             MMN+LALSL+L +L A+G++SP  +               + VVVE+EK    G  NT+V
Sbjct  1     MMNVLALSLVLSSLVAAGLWSPQIERHKPDDQEVIVKNGHRVVVVEYEK---QGPRNTRV  57

Query  1094  SISPQEAAQNSRL----EKGYVLNAMEKISEKA-----EEVKQRFKDAAAVLPNVGEGIS  942
             SISP+E     +L    +K Y   A  K SE A     E  K++FK+A++VLPN+G+GIS
Sbjct  58    SISPEETGTTHKLVEAADKTYSSTAGGKSSEAAAEGVLETAKEKFKEASSVLPNLGQGIS  117



>gb|ACU20077.1| unknown [Glycine max]
Length=341

 Score =   159 bits (401),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/331 (32%), Positives = 164/331 (50%), Gaps = 40/331 (12%)
 Frame = -1

Query  1154  KAVVVEFEKDNNNGGGNTKVSISPQEAAQNSRLE---------KGYVLNAMEKISEKAEE  1002
             + VVVE+++    G  NTK+SISP++    +  +         K  +++AMEK    ++E
Sbjct  29    RVVVVEYDQ---GGHQNTKISISPEQPTHANLKDPICDAYGKCKHKIVDAMEK----SQE  81

Query  1001  VKQRFKDAAAVLPNVGEGISGHQeeeeevketakeaaekvktaakekvtekvKDRRKKEL  822
             V    KD  A        ++G  +E    K        +      +          K   
Sbjct  82    VIHEKKDEIAANKEAARQVAGKTKERVYDKARHVHEYAQNTVETAKNHIACNVSNAKDAF  141

Query  821   KDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPR  642
             K ++    E            ++L ++ G A++LG +TAYGMCVWV+FISSYV S A+ R
Sbjct  142   KRLIAGSLE-----------RQSLNSLMGVANMLGFSTAYGMCVWVTFISSYVQSRAMAR  190

Query  641   QQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVN  462
             QQ A VQ+K+YP+YF+AM YSIG A   H L       S+ ++    +NL+A+L+ +  N
Sbjct  191   QQFAVVQSKIYPVYFRAMSYSIGVALFAHVLAHRNTLLSNKSDLLQAYNLLASLVTLFFN  250

Query  461   LVYLEPRAAKvm-------------vermkmekeegrgmngegsgggspgmMKLSKRLKK  321
              +YLEPRA K+M                    + +               ++KL+ +LKK
Sbjct  251   SLYLEPRATKLMFERIKIEKEEGRGRSEDVSSRTKEPASTTADQDAVRTRIIKLNDKLKK  310

Query  320   LNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
             LNS SSFLN+L LM++T HL ++AQR+  +C
Sbjct  311   LNSYSSFLNILNLMSLTWHLVYLAQRLPHIC  341



>ref|XP_006591921.1| PREDICTED: seed maturation protein PM27 isoform X1 [Glycine max]
Length=347

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 106/337 (31%), Positives = 163/337 (48%), Gaps = 46/337 (14%)
 Frame = -1

Query  1154  KAVVVEFEKDNNNGGGNTKVSISPQEAAQNSRLE---------KGYVLNAMEKISEKAEE  1002
             + VVVE+++    G  NTK+SISP++    +  +         K  +++AMEK    ++E
Sbjct  29    RVVVVEYDQ---GGHQNTKISISPEQPTHANLKDPICDAYGKCKHKIVDAMEK----SQE  81

Query  1001  VKQRFKDAAAVLPNVGEGISGHQeeeeevketakeaaekvktaakekvtekvKDRRKKEL  822
             V    KD  A        ++G  +E    K        +      +          K   
Sbjct  82    VIHEKKDEIAANKEAARQVAGKTKERVYDKARHVHEYAQNTVETAKNHIACNVSNAKDAF  141

Query  821   KDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPR  642
             K ++    E            ++L ++ G A++LG +TAYGMCVWV+FISSYV S A+ R
Sbjct  142   KRLIAGSLE-----------RQSLNSLMGVANMLGFSTAYGMCVWVTFISSYVQSRAMAR  190

Query  641   QQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVN  462
             QQ A VQ+K+YP+YF+AM YSIG A   H L       S+ ++    +NL+A+L+ +  N
Sbjct  191   QQFAVVQSKIYPVYFRAMSYSIGVALFAHVLAHRNTLLSNKSDLLQAYNLLASLVTLFFN  250

Query  461   LVYLEPRAAKvm-------------------vermkmekeegrgmngegsgggspgmMKL  339
              +YLEPRA K +                          + +               ++KL
Sbjct  251   SLYLEPRATKKLWFIQLMFERIKIEKEEGRGRSEDVSSRTKEPASTTADQDAVRTRIIKL  310

Query  338   SKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
             + +LKKLNS SSFLN+L LM++T HL ++AQR+  +C
Sbjct  311   NDKLKKLNSYSSFLNILNLMSLTWHLVYLAQRLPHIC  347



>gb|AHF21579.1| late embryogenesis abundant protein [Tamarix hispida]
Length=434

 Score =   156 bits (394),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/136 (53%), Positives = 97/136 (71%), Gaps = 2/136 (1%)
 Frame = -1

Query  833  KKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLST  654
            KKEL DI RRG EV+YD F YIFS E + ++     L+GLATAYG+ +WV+F+ S+VL++
Sbjct  217  KKELSDIARRGKEVIYDIFGYIFSIETVDSLTNVVQLMGLATAYGVSIWVTFVMSHVLAS  276

Query  653  ALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYL--GFNLVAAL  480
             LPRQQ   VQ+K+YP+YFK M   IGAA +GH LGQ +  +  +  A L  G+NL+++L
Sbjct  277  VLPRQQFGVVQSKIYPVYFKVMASGIGAALAGHLLGQRKKLFDDSNRAGLVQGYNLLSSL  336

Query  479  IMVLVNLVYLEPRAAK  432
            + VL NL+ LEPRA K
Sbjct  337  LFVLANLLILEPRATK  352



>ref|XP_011096288.1| PREDICTED: uncharacterized protein LOC105175521 [Sesamum indicum]
Length=520

 Score =   157 bits (397),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 92/227 (41%), Positives = 131/227 (58%), Gaps = 17/227 (7%)
 Frame = -1

Query  1094  SISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGI---SGHQeee  924
             S + QEAAQ +R            + E+AE+VK+   DA      V E     +  + E 
Sbjct  205   SKAKQEAAQKAR-----------GVKEQAEKVKRHVYDAVDAAKKVKEDTERETSRKMEG  253

Query  923   eevketakeaaekvktaakekvtekvKDRRKKELKDILRRGGEVLYDAFEYIFSPENLTA  744
              +   + K        + + + T +VK  R+KEL +ILR   EV  D F Y+  PE + +
Sbjct  254   AKEMVSEKAEEWMENASGRARETIRVKKERQKELSEILRNAREVAVDVFNYMLPPERVAS  313

Query  743   VFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAF  564
               G  HL+G A AYGMCVW++F SS+VL+ ALPRQQ A VQ+K+YP+YFKAM YS+G A 
Sbjct  314   FMGILHLMGFAAAYGMCVWITFASSHVLAGALPRQQFAMVQSKIYPVYFKAMAYSVGMAL  373

Query  563   SGHF---LGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
              GH    L Q +     +   + GFN++A+L M+LVNL+++EPRA+K
Sbjct  374   FGHLMMSLSQRKGFVPVSGGMFQGFNIMASLAMILVNLLFMEPRASK  420


 Score = 73.9 bits (180),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/109 (40%), Positives = 69/109 (63%), Gaps = 19/109 (17%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT-------------KAVVVEFEKDNNNGGGNTKVS  1092
             MMN LAL L+L +L  +G F+P+ +              + VVVE+EKD+    GNTKV 
Sbjct  1     MMNALALGLVLTSLVTAGFFNPSPEKQVSKEDVIVKEGHRVVVVEYEKDD----GNTKVL  56

Query  1091  ISPQEAAQNSRL-EKGYVLNAMEKISEKAEEVKQRFKD-AAAVLPNVGE  951
             ISPQE+  + +  E G+  NA +K+SEK E+ K++ K+ +++V+P+VG+
Sbjct  57    ISPQESLISHKFAETGFAANAKDKLSEKMEDAKEKIKEVSSSVVPDVGK  105



>ref|XP_010063755.1| PREDICTED: uncharacterized protein LOC104450764 [Eucalyptus grandis]
 gb|KCW71010.1| hypothetical protein EUGRSUZ_F04115 [Eucalyptus grandis]
Length=469

 Score =   156 bits (395),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 124/193 (64%), Gaps = 23/193 (12%)
 Frame = -1

Query  737  GTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSG  558
            G  HLLG ATAYG CVWV+F+SSYVL+ A+PRQQ   VQ+K+YP+YF+AM  SI  +  G
Sbjct  277  GLVHLLGFATAYGTCVWVTFVSSYVLAGAMPRQQFGMVQSKVYPVYFRAMFTSIALSLLG  336

Query  557  HFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvmvermkmekeegrgmng  378
            H LGQ R  +++  E   G NL+A+L +VL N++YLEPRA K+M E+MK+EKEEGRG   
Sbjct  337  HLLGQGRHLFANKPEMLQGLNLLASLPLVLANMLYLEPRATKIMFEKMKLEKEEGRGREP  396

Query  377  egsgggs-----------------------pgmMKLSKRLKKLNSQSSFLNVLTLMAMTL  267
              +   +                         + +L++RL+KLNS SS LN+ TLMA+T 
Sbjct  397  TETTRVTEPRPTPGETAALVQEDREGDALRARVTRLNERLRKLNSHSSLLNIATLMALTW  456

Query  266  HLAHIAQRVHTVC  228
            HL ++AQR+ T C
Sbjct  457  HLVYLAQRISTPC  469



>ref|XP_010912527.1| PREDICTED: uncharacterized protein LOC105038415 [Elaeis guineensis]
Length=441

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 3/134 (2%)
 Frame = -1

Query  833  KKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLST  654
            ++ L DI+RR  +V YDA  Y+ +PE  + V   A LLG ATAYG CVWV+F+SS+VL+T
Sbjct  207  RRNLTDIIRRARDVAYDATVYVGAPETASTVAAVAQLLGFATAYGTCVWVTFVSSHVLAT  266

Query  653  ALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIM  474
            ALPRQQ   VQ+KLYP+YF+ + Y +G A+  HFLGQ      +  E   G+NL+ + ++
Sbjct  267  ALPRQQFGLVQSKLYPVYFRVVAYGVGVAWLAHFLGQDG---RAVAERLQGYNLLGSFVL  323

Query  473  VLVNLVYLEPRAAK  432
            VLVN+++LEP+A K
Sbjct  324  VLVNMLFLEPKATK  337


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  344  KLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
            KL++RLK LN+ SSF+NVL+LM +T HL H+A RV T C
Sbjct  403  KLNERLKVLNNYSSFINVLSLMGLTWHLVHLAHRVRTSC  441



>emb|CDP10676.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   147 bits (372),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = -1

Query  815  ILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQ  636
            ILRRG EV+Y  F Y+FS E+L        LLGLA AYGM +WV+FISSYVL+ ALPRQQ
Sbjct  202  ILRRGREVVYGFFGYVFSRESLAFGMRILQLLGLAGAYGMSIWVTFISSYVLARALPRQQ  261

Query  635  IATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLV  456
             A +Q+K+YP+YF+AM YS+G    GH L + +   SSA +   GFNL+A+L+M+ +NL 
Sbjct  262  FAILQSKIYPVYFQAMAYSVGLVLVGHLLSRRKRVSSSAGDTLQGFNLLASLLMLSINLK  321

Query  455  YLEPRAAK  432
            YLEP A K
Sbjct  322  YLEPLATK  329


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 62/108 (57%), Gaps = 28/108 (26%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT--------------KAVVVEFEKDNNNGGGNTKV  1095
             MMNI+AL L+L TL  +G++SP  +               + VVVEFEKD+    GNTKV
Sbjct  1     MMNIVALCLVLTTLATAGVWSPTPEKVNNDKEDVILKEGHRTVVVEFEKDD----GNTKV  56

Query  1094  SISPQEAAQ--------NSRL-EKGYVLNAME-KISEKAEEVKQRFKD  981
             SISPQEA          +SR+ EKG   ++++ K+S+  E VK+  KD
Sbjct  57    SISPQEAVHEGFVHKPSSSRVDEKGPHDSSIKGKVSDSVENVKENLKD  104



>gb|KFK41626.1| hypothetical protein AALP_AA2G152200 [Arabis alpina]
Length=470

 Score =   145 bits (365),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 113/180 (63%), Gaps = 3/180 (2%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             SP  + +V G   L  +A A+G CVWV+F+SSYVL++ L RQQ   VQ+KLYP+YFKA+
Sbjct  294  LSPTKVASVIG---LTAIAAAFGSCVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKAI  350

Query  587  GYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvmvermkm  408
               I     GH L + R   + ATE + G NL+A+  M+  N  ++EPRA K M ERMK 
Sbjct  351  SVGILVGLLGHVLSRRRKLLTDATEMWQGVNLLASFFMIEANKSFVEPRATKAMFERMKA  410

Query  407  ekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
            EKEEGRG            +  LS+RL KLN+ SS+LN+LTLM++T H  H+ QR+ T C
Sbjct  411  EKEEGRGGERTSEQEVRRKLENLSERLSKLNTYSSWLNILTLMSLTWHFVHLGQRLGTAC  470



>ref|XP_008807668.1| PREDICTED: uncharacterized protein LOC103719958 [Phoenix dactylifera]
Length=436

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 91/134 (68%), Gaps = 3/134 (2%)
 Frame = -1

Query  833  KKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLST  654
            ++ L DI++R  +V YDA  Y+ +PE  +     A LLG ATAYG CVWV+F+SS+VL+ 
Sbjct  204  RRNLTDIIQRARDVAYDAIVYVGAPETASTAAAVAQLLGFATAYGTCVWVTFVSSHVLAA  263

Query  653  ALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIM  474
            ALPRQQ   +Q+KLYP+YF+ + Y +G A+  HF GQ R    +  E   G+NL+ + ++
Sbjct  264  ALPRQQFGLMQSKLYPVYFRVVAYGVGVAWLAHFFGQGR---GAVAERLQGYNLLGSFVL  320

Query  473  VLVNLVYLEPRAAK  432
            VL N+++LEP+A K
Sbjct  321  VLANMLFLEPKATK  334


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  344  KLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
            KL+KRLK LN+ SSFLNVLTLM +T HL H+A RV T C
Sbjct  398  KLNKRLKMLNNYSSFLNVLTLMGLTWHLVHLAHRVQTSC  436



>emb|CAN77279.1| hypothetical protein VITISV_037453 [Vitis vinifera]
Length=345

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 127/226 (56%), Gaps = 27/226 (12%)
 Frame = -1

Query  836  RKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLS  657
            +KK   D + R    +YD   Y+ S + + ++    H+LG ATAYG+CVWV+F SS+VL+
Sbjct  124  QKKGQHDFINR----VYDVVNYMLSTDAIGSLTCVIHILGFATAYGVCVWVTFFSSFVLA  179

Query  656  TALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALI  477
             ALP QQ   VQ+K+YP YFK M   +G A  GH L Q         + + G  L+A L 
Sbjct  180  GALPNQQFGIVQSKIYPFYFKIMASCVGLALLGHALSQGEKVLLGKPDLFQGHALLATLH  239

Query  476  MVLVNLVYLEPRAAKvmvermkmekeegrgmngeg-----------------------sg  366
            ++L+NL+YLEPRA KVM ER+++E EE +G                              
Sbjct  240  IILINLLYLEPRATKVMFERIRVENEERKGQESSRVEPGKEGEPTTGASGPQVMGRLDQE  299

Query  365  ggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
              +  +++L++ LKKLN+ SSFLN+LTLM + LHL ++  R++  C
Sbjct  300  TVNNQILELNEMLKKLNAYSSFLNILTLMVLKLHLVYLVHRLYMTC  345



>ref|XP_010415942.1| PREDICTED: uncharacterized protein LOC104701885 isoform X2 [Camelina 
sativa]
Length=462

 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 107/181 (59%), Gaps = 4/181 (2%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             SP  + +V G   L G+A A+G CVWV+F+SSYVL++ L RQQ   VQ+KLYP+YFKA 
Sbjct  285  LSPTKVASVVG---LTGIAAAFGTCVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKAT  341

Query  587  GYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvm-vermk  411
               I     GH L + R   + ATE + G NL+++  M+  N  ++EPRA K M      
Sbjct  342  SVGILVGLLGHVLSRRRKLLTDATEMWQGVNLLSSFFMIEANKSFVEPRATKAMFERMKA  401

Query  410  mekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTV  231
             ++E   G            + KLS+RL KLN+ SS+LN+LTLM++T H  ++ QR+ T 
Sbjct  402  EKEEGRGGERTSSEQELRRKLEKLSERLSKLNTYSSWLNILTLMSLTWHFVYLGQRLGTA  461

Query  230  C  228
            C
Sbjct  462  C  462


 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 60/115 (52%), Gaps = 27/115 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNA------------------DTKAVVVEFEKDNNNGGG  1107
             MMN+LALSL+L TL A+ ++SP+                     + VVVE+++D   G  
Sbjct  1     MMNLLALSLVLSTLLAAEVWSPSPAMTTNHGAASQGDIIVKDGHRVVVVEYDRD---GKT  57

Query  1106  NTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             NT+VSISP  A Q      G   N   K     +  K+R K+ A+ LP+VG+GIS
Sbjct  58    NTRVSISPPSADQ------GEGDNEEGKGGSLFKNAKERVKETASHLPHVGQGIS  106



>dbj|BAJ91683.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07387.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=584

 Score =   141 bits (355),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 91/135 (67%), Gaps = 5/135 (4%)
 Frame = -1

Query  830  KELKDILRRGGEVLYDAFEYIFSPENLTAVFGTA--HLLGLATAYGMCVWVSFISSYVLS  657
            K L DI RR  EV  DA  Y+       A   TA  HLLG ATAYG CVWV+F+SS+VL+
Sbjct  331  KNLTDIARRAQEVASDATSYLLGAPMEAARTATAVMHLLGFATAYGACVWVTFVSSHVLA  390

Query  656  TALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALI  477
             +LPRQQ+  VQ+KLYP+YF+AM Y +G A + H LG+ R  +++  ++   FNL++AL 
Sbjct  391  ASLPRQQLGVVQSKLYPVYFRAMAYCVGLALAAHLLGRERSSFAARAQS---FNLLSALG  447

Query  476  MVLVNLVYLEPRAAK  432
            +VL N++ LEP+A K
Sbjct  448  LVLANMLLLEPKATK  462



>gb|EMT04172.1| hypothetical protein F775_30700 [Aegilops tauschii]
Length=558

 Score =   140 bits (353),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 91/135 (67%), Gaps = 5/135 (4%)
 Frame = -1

Query  830  KELKDILRRGGEVLYDAFEYIFSPENLTAVFGTA--HLLGLATAYGMCVWVSFISSYVLS  657
            K L DI RR  EV  DA  Y+       A   TA  HLLG ATAYG CVWV+F+SS+VL+
Sbjct  297  KNLTDIARRAQEVASDAAGYLLGAPMEAARTATAVMHLLGFATAYGACVWVTFVSSHVLA  356

Query  656  TALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALI  477
             +LPRQQ+  VQ+KLYP+YF+AM Y +G A + H LG+ R  +++  ++   FNL++AL 
Sbjct  357  ASLPRQQLGVVQSKLYPVYFRAMAYCVGLALAAHLLGRERSSFAARAQS---FNLLSALG  413

Query  476  MVLVNLVYLEPRAAK  432
            +VL N++ LEP+A K
Sbjct  414  LVLANMLLLEPKATK  428



>ref|XP_006859142.1| hypothetical protein AMTR_s00070p00109270 [Amborella trichopoda]
 gb|ERN20609.1| hypothetical protein AMTR_s00070p00109270 [Amborella trichopoda]
Length=472

 Score =   139 bits (351),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 87/134 (65%), Gaps = 1/134 (1%)
 Frame = -1

Query  833  KKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLST  654
            +  L DI+ RG EV+ DA+ Y  SPE L +     H L    AYG+CVWV+F+ S+VLS 
Sbjct  249  RHNLTDIIHRGWEVIPDAWLYAISPETLVSYMVVIHTLSFGVAYGVCVWVTFVLSHVLSQ  308

Query  653  ALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIM  474
            ALPRQQ A VQ+K+YP+YF+ M YS+G  F  HF  +  W  SS  E     NL+A L +
Sbjct  309  ALPRQQFALVQSKIYPVYFRTMMYSLGLCFLTHFF-RHPWRNSSIAEKLQSHNLLACLGL  367

Query  473  VLVNLVYLEPRAAK  432
            VLVN++YLEP+A K
Sbjct  368  VLVNMLYLEPQATK  381


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 58/105 (55%), Gaps = 17/105 (16%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSP--------NADTKAVVVEFEKDNNNGGGNTKVSISPQE  1077
             MM+ +AL  ++ +L A+G++SP            + +VVE+E++        K+      
Sbjct  1     MMHAVALGFVITSLAAAGVWSPPPPQPNTVKEGHRVIVVEYERELPQHTQQHKI------  54

Query  1076  AAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
              A  S  EK  +L   + ++EK   +K++++DAA VLPN+G+G+S
Sbjct  55    PADYSDREKSALLGKEKGVAEK---LKEKYRDAACVLPNLGQGLS  96



>ref|XP_010415941.1| PREDICTED: uncharacterized protein LOC104701885 isoform X1 [Camelina 
sativa]
Length=462

 Score =   139 bits (350),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 106/181 (59%), Gaps = 4/181 (2%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             SP  + +V G   L G+A A+G CVWV+F+SSYVL++ L RQQ   VQ+KLYP+YFKA 
Sbjct  285  LSPTKVASVVG---LTGIAAAFGTCVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKAT  341

Query  587  GYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvm-vermk  411
               I     GH L + R   + ATE + G NL+++  M+  N  ++EPRA K M      
Sbjct  342  SVGILVGLLGHVLSRRRKLLTDATEMWQGVNLLSSFFMIEANKSFVEPRATKAMFERMKA  401

Query  410  mekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTV  231
             ++E   G            + KLS+RL KLN+ SS+LN+LTLM++T H  ++ QR+   
Sbjct  402  EKEEGRGGERTSSEQELRRKLEKLSERLSKLNTYSSWLNILTLMSLTWHFVYLGQRLGAA  461

Query  230  C  228
            C
Sbjct  462  C  462


 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 60/115 (52%), Gaps = 27/115 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNA------------------DTKAVVVEFEKDNNNGGG  1107
             MMN+LALSL+L TL A+ ++SP+                     + VVVE+++D   G  
Sbjct  1     MMNLLALSLVLSTLLAAEVWSPSPAMTTNHGAASQGDIIVKDGHRVVVVEYDRD---GKT  57

Query  1106  NTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             NT+VSISP  A Q      G   N   K     +  K+R K+ A+ LP+VG+GIS
Sbjct  58    NTRVSISPPSADQ------GEGDNEEGKGGSLFKNAKERVKETASHLPHVGQGIS  106



>ref|XP_010428064.1| PREDICTED: uncharacterized protein LOC104712790 [Camelina sativa]
Length=462

 Score =   139 bits (349),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 106/181 (59%), Gaps = 4/181 (2%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             SP  + +V G   L  +A A+G CVWV+F+SSYVL++ L RQQ   VQ+KLYP+YFKA 
Sbjct  285  LSPTKVASVMG---LTAIAAAFGTCVWVTFVSSYVLASVLRRQQFGVVQSKLYPVYFKAT  341

Query  587  GYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvm-vermk  411
               I     GH L + R   + ATE + G NL+++  M+  N  ++EPRA K M      
Sbjct  342  SVGILVGLLGHVLSRRRKLLTDATEMWQGVNLLSSFFMIEANKSFVEPRATKAMFERMKA  401

Query  410  mekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTV  231
             ++E   G            + KLS+RL KLN+ SS+LN+LTLM++T H  ++ QR+ T 
Sbjct  402  EKEEGRGGERTSSEQELRRKLEKLSERLSKLNTYSSWLNILTLMSLTWHFVYLGQRLGTA  461

Query  230  C  228
            C
Sbjct  462  C  462


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 61/115 (53%), Gaps = 27/115 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNA------------------DTKAVVVEFEKDNNNGGG  1107
             MMN+LALSL+L TL A+ ++SP+                     + VVVE+++D   G  
Sbjct  1     MMNLLALSLVLSTLLAAEVWSPSPAMTTNHGAASEGDVIVKDGHRVVVVEYDRD---GKT  57

Query  1106  NTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             NT+VSISP  A      ++G   N   K     +  K+R K+ A+ LP+VG+GIS
Sbjct  58    NTRVSISPPSA------DEGEGDNEEGKGGSLFKNAKERVKETASHLPHVGQGIS  106



>ref|XP_002521819.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40629.1| conserved hypothetical protein [Ricinus communis]
Length=494

 Score =   139 bits (349),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 108/198 (55%), Gaps = 22/198 (11%)
 Frame = -1

Query  773  YIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFK  594
            Y+ S E + ++ G  +LLG ATAYGM VWV+FISSYVL+ AL R Q   VQ+K+YP+YF+
Sbjct  293  YMGSTEGVKSLMGVINLLGFATAYGMSVWVTFISSYVLANALTRHQFGVVQSKIYPVYFR  352

Query  593  AMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvmverm  414
            AM YSIG A  GH +G     +S   E +  FNL+A++  VL N +YLEP A K      
Sbjct  353  AMAYSIGVALLGHLVGHRNLAFSRKAEMFQVFNLIASISAVLTNAIYLEPLATKEEGRGR  412

Query  413  kmekeegrgmngeg----------------------sgggspgmMKLSKRLKKLNSQSSF  300
            +    E      E                       +        ++ +  ++LNS SSF
Sbjct  413  ENLAAESNKGEQEQLLRDVPAATAAGAAEATTATRENTEQQETKSRMVRLNERLNSCSSF  472

Query  299  LNVLTLMAMTLHLAHIAQ  246
            LNV+TLM++T HL +++Q
Sbjct  473  LNVVTLMSLTWHLVYLSQ  490


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 58/117 (50%), Gaps = 31/117 (26%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSP---------NADTKAVVVE-------FEKDNNNGGGNT  1101
             M+N+LAL L+  +L  + ++SP         N   + V+V+        E  +  G  NT
Sbjct  1     MINLLALCLVFTSLLTAEVYSPSPTTPKQQDNQKKEDVIVKEGHRVVVVETYDEGGQHNT  60

Query  1100  KVSISPQE----AAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             KVSISP +    AAQ+ +   G+V N            K + K AA VLPN+G+GIS
Sbjct  61    KVSISPPQDPISAAQDGKFPSGFVDN-----------TKGKIKHAADVLPNIGQGIS  106



>gb|EMS55518.1| hypothetical protein TRIUR3_20741 [Triticum urartu]
Length=612

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 90/135 (67%), Gaps = 5/135 (4%)
 Frame = -1

Query  830  KELKDILRRGGEVLYDAFEYIFSPENLTAVFGTA--HLLGLATAYGMCVWVSFISSYVLS  657
            K L DI RR  EV  DA  Y+       A   TA  HLLG ATAYG CVWV+F+SS+VL+
Sbjct  359  KNLTDIARRAREVASDAAGYLLGAPMEAARTATAVMHLLGFATAYGACVWVTFVSSHVLA  418

Query  656  TALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALI  477
             +LPRQQ+  VQ+KLYP+YF+AM Y +G A + H LG+ R  +++  +    FNL++AL 
Sbjct  419  ASLPRQQLGVVQSKLYPVYFRAMAYCVGLALAAHLLGRERSSFAARAQT---FNLLSALG  475

Query  476  MVLVNLVYLEPRAAK  432
            +VL N++ LEP+A K
Sbjct  476  LVLANMLLLEPKATK  490



>ref|XP_010431488.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104715813 
[Camelina sativa]
Length=345

 Score =   136 bits (343),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 105/181 (58%), Gaps = 4/181 (2%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             SP  + +V G   L  +A A+G CVWV+F+SSYVL++ L RQQ   VQ+KLYP+YFKA 
Sbjct  168  LSPTKVASVVG---LTAIAAAFGTCVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKAT  224

Query  587  GYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvm-vermk  411
               I     GH L + R   + ATE + G NL+++  M+  N  ++EPRA K M      
Sbjct  225  SVGILVGLLGHVLSRRRKLLTDATEMWQGVNLLSSFFMIEANKSFVEPRATKAMFERMKA  284

Query  410  mekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTV  231
             ++E   G            + KLS+RL KLN+ SS+LN+LTLM++T H  ++ QR+   
Sbjct  285  EKEEGRGGERTTSEQELRRKLEKLSERLSKLNTYSSWLNILTLMSLTWHFVYLGQRLGNA  344

Query  230  C  228
            C
Sbjct  345  C  345



>ref|XP_011074959.1| PREDICTED: uncharacterized protein LOC105159552 [Sesamum indicum]
Length=493

 Score =   137 bits (346),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 94/143 (66%), Gaps = 11/143 (8%)
 Frame = -1

Query  842  DRRKKE----LKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFI  675
            DR KK+    LK I +RGG VL     YI  P  + +V G  HLLG A AYGM +WV+F 
Sbjct  247  DRAKKQGHKGLKGIFQRGGGVLG----YIGLPVRMDSVAGVLHLLGFAAAYGMGLWVTFA  302

Query  674  SSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYL--G  501
            S+YVL+ +LPR Q A VQ+K+YP+YFKAM YS+G A  GH + Q R   S  +   L   
Sbjct  303  SNYVLAGSLPRYQFAMVQSKIYPVYFKAMAYSVGTALLGHLMSQ-RIKLSPLSMGMLLAA  361

Query  500  FNLVAALIMVLVNLVYLEPRAAK  432
            FNL+A+L+M LVNL+YLEPRA K
Sbjct  362  FNLMASLLMTLVNLLYLEPRATK  384


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 61/112 (54%), Gaps = 24/112 (21%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSP---NADTK--------------AVVVEFEKDNNNGGGN  1104
             MMN LAL L+  +L  +G+ +P   N ++K               +V+EFEKD+    GN
Sbjct  1     MMNALALFLVFTSLVRAGVLTPTPENHNSKDDVAVKQGHTNTGDGLVIEFEKDD----GN  56

Query  1103  TKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAA-VLPNVGE  951
             TKVSISP+++  +   +     N  EK+  K EE K++ K+AA+ VL   GE
Sbjct  57    TKVSISPKDS--HPPHDGVDTANLEEKLYGKMEEAKEKIKEAASTVLSQDGE  106



>ref|XP_010645833.1| PREDICTED: uncharacterized protein LOC100256187 [Vitis vinifera]
Length=491

 Score =   137 bits (345),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 127/226 (56%), Gaps = 27/226 (12%)
 Frame = -1

Query  836  RKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLS  657
            +KK   D + R    +YD   Y+ S + + ++    H+LG ATAYG+ VWV+F SS+VL+
Sbjct  270  QKKGQHDFINR----VYDVVNYMLSTDAIGSLTCVIHILGFATAYGVRVWVTFFSSFVLA  325

Query  656  TALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALI  477
             ALP QQ A VQ+K+YP YFK M   +G A  GH L Q         + + G  L+A L 
Sbjct  326  GALPNQQFAIVQSKIYPFYFKTMASCVGLALLGHALSQGEKVLLGKPDLFQGHALLATLH  385

Query  476  MVLVNLVYLEPRAAKvmvermkmekeegrgmngeg-----------------------sg  366
            ++L+NL+YLEPRA KVM ER+++E EE +G                              
Sbjct  386  IILINLLYLEPRATKVMFERIRVENEERKGQESSRVEPGKEGEPTTGASDPQVMGRLDQE  445

Query  365  ggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
              +  +++L++ LKKLN+ SS LN+LTLM + LHL ++A R++  C
Sbjct  446  TVNNQILELNEMLKKLNAYSSLLNILTLMVLKLHLVYLAHRLYMTC  491


 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 61/117 (52%), Gaps = 31/117 (26%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNAD-----------------TKAVVVEFEKDNNNGGGN  1104
             MMN  AL L + +L A+ I+SPN D                 T+ VVVE++K+   G GN
Sbjct  1     MMNGFALFLAVSSLVAASIWSPNPDQKQKDYPGAEEVIVKEGTRVVVVEYDKE---GPGN  57

Query  1103  TKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGISGHQ  933
             TKVSIS QEA         +V     K  +K    K++ K+A  VLPN+G+G+S  Q
Sbjct  58    TKVSISTQEAH--------HVFQNAPKGEDK---FKEKVKEAFEVLPNMGQGLSRDQ  103



>ref|XP_009781129.1| PREDICTED: uncharacterized protein LOC104230092 [Nicotiana sylvestris]
Length=490

 Score =   137 bits (344),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 85/129 (66%), Gaps = 4/129 (3%)
 Frame = -1

Query  815  ILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQ  636
            ++RR      DA  YIFS +N  ++ G  H LG A +YG+C+WV+FISS +L+ A+P+QQ
Sbjct  257  VIRR---FFLDASAYIFSTKNFRSLMGMIHFLGFALSYGVCIWVTFISSNILAGAMPKQQ  313

Query  635  IATVQTKLYPLYFKAMGYSIGAAFSGHFLGQT-RWPYSSATEAYLGFNLVAALIMVLVNL  459
             A VQ+K+YPLYFK M Y +  AF GHF+ Q  R+ Y++  E   GF   A + M L+NL
Sbjct  314  FAMVQSKIYPLYFKTMAYGVATAFFGHFMSQRHRYYYANRAETIQGFLFFATICMTLINL  373

Query  458  VYLEPRAAK  432
              LEPRA+K
Sbjct  374  FVLEPRASK  382


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 60/104 (58%), Gaps = 16/104 (15%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADTK----------AVVVEFEKDNNNGGGNTKVSISP  1083
             MMNI A+ L+L TL  +G+FSP  + K           VVVE+E ++    GNTKVSISP
Sbjct  1     MMNIFAIFLVLTTLLTAGVFSPILEKKEEVIVKEGHRVVVVEYEPND----GNTKVSISP  56

Query  1082  QEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGE  951
             QE  Q + +  G V    ++IS+ A  VK + K+AA+ +   G+
Sbjct  57    QETDQKATV--GVVSGLKDRISDTAGTVKDKIKEAASFVEGGGK  98



>ref|XP_006302242.1| hypothetical protein CARUB_v10020268mg [Capsella rubella]
 gb|EOA35140.1| hypothetical protein CARUB_v10020268mg [Capsella rubella]
Length=458

 Score =   136 bits (343),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 106/182 (58%), Gaps = 4/182 (2%)
 Frame = -1

Query  770  IFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKA  591
            + SP  + +V G   L  ++ A+G CVWV+F+SSYVL++ L RQQ   VQ+KLYP+YFKA
Sbjct  280  MLSPTKIASVVG---LTAISAAFGTCVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKA  336

Query  590  MGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvm-verm  414
                I     GH L + R   + ATE + G NL+A+  M+  N  ++EPRA K M     
Sbjct  337  TSVGILVGLFGHVLSRRRKLLTDATEMWQGVNLLASFFMIEANKSFVEPRATKAMFERMK  396

Query  413  kmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHT  234
              ++E   G            + KLS+RL KLN+ SS+LN+LTLM++T H  ++ QR+  
Sbjct  397  AEKEEGRGGERTSSEQELRRKLEKLSERLSKLNTYSSWLNILTLMSLTWHFVYLGQRLGA  456

Query  233  VC  228
             C
Sbjct  457  AC  458



>ref|NP_177355.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
thaliana]
 gb|AAG51136.1|AC069273_7 hypothetical protein [Arabidopsis thaliana]
 gb|AEE35273.1| late embryogenesis abundant domain-containing protein [Arabidopsis 
thaliana]
Length=480

 Score =   136 bits (343),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 116/195 (59%), Gaps = 3/195 (2%)
 Frame = -1

Query  812  LRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQI  633
            ++ G      A     SP  + ++ G   L G+A A+G  VWV+F+SSYVL++ L RQQ 
Sbjct  289  VKNGAREFGSATAATLSPTKVASIVG---LTGIAAAFGTSVWVTFVSSYVLASVLGRQQF  345

Query  632  ATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVY  453
              VQ+KLYP+YFKA    I     GH L + R   + ATE + G NL+++  M+  N  +
Sbjct  346  GVVQSKLYPVYFKATSVGILVGLFGHVLSRRRKLLTDATEMWQGVNLLSSFFMIEANKSF  405

Query  452  LEPRAAKvmvermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAM  273
            +EPRA K M ERMK EKEEGRG            + +LS+RL KLN+ SS+LN+LTLM++
Sbjct  406  VEPRATKAMFERMKAEKEEGRGGERTSEQELRRKLEQLSERLSKLNTYSSWLNILTLMSL  465

Query  272  TLHLAHIAQRVHTVC  228
            T H  ++ QR+   C
Sbjct  466  TWHFVYLGQRLGAAC  480


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 59/116 (51%), Gaps = 27/116 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNA-------------------DTKAVVVEFEKDNNNGG  1110
             M N+LAL L+L TL A+ ++SP+                        VVVE+++D   G 
Sbjct  1     MTNLLALCLVLSTLLAAEVWSPSPAMTTHNTAVASEGEVIVKDGHHVVVVEYDRD---GK  57

Query  1109  GNTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
              NT+VSISP  A Q    E     N +E  +     VK++ K+ A+ LP+VG+GIS
Sbjct  58    TNTRVSISPPSADQGEEKE-----NEVEMGTSMFRNVKEKAKETASYLPHVGQGIS  108



>gb|KGN52683.1| hypothetical protein Csa_5G650480 [Cucumis sativus]
Length=377

 Score =   135 bits (340),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 123/381 (32%), Positives = 177/381 (46%), Gaps = 60/381 (16%)
 Frame = -1

Query  1208  LILITLGASGIFSP---------NADTKAVVVEFEKDNNNGGGNTKVSIS--PQEAAQNS  1062
             LI+ T  A+G++SP             + VVVE+   ++ G  NTKVSIS  P + A+NS
Sbjct  3     LIVTTFTAAGLWSPPPPPQNVIVKEGHRMVVVEY---DDQGQHNTKVSISSEPDQDAKNS  59

Query  1061  RLEKGYVL------NAMEKISEKAEEVKQRFKDAAAVLPNVGEGISGHQeeeeevketak  900
                +   L          K++   E+ K    + A    +VGE ++    +  + K    
Sbjct  60    ERHRTKDLICDVYGKCKHKVASAVEKAKVMVTETAQEAHDVGESVT-DAFDGAKDKLKEG  118

Query  899   eaaekvktaakekvtekvKDRRKKELKDILRRGGEVL-----------YDAFEYIFSPEN  753
                      ++E+   K  +R  KE  + ++ G   L           +   +Y+F   +
Sbjct  119   AKETLEMAKSREEKVVKGAERVAKETGEKIKTGENKLKENLMGLVDRGFKVIDYLF--RH  176

Query  752   LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIG  573
             L        LLG   A GM VWV+FISSYVL++ LPRQQ+  VQ+K+YP+YFKAM   IG
Sbjct  177   LGFGMDALGLLGFTMALGMGVWVTFISSYVLASVLPRQQLGVVQSKIYPVYFKAMASCIG  236

Query  572   AAFSGHFLGQTRW--PYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvm---------  426
              A  GH   +T W  P    +E   G+ LVAAL+M+  N +Y+EPRA KVM         
Sbjct  237   MALLGHLFSRTEWTFPIPKNSEVVQGYVLVAALLMIFANSLYMEPRATKVMFERLKIEKE  296

Query  425   ---------------vermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNV  291
                            V                        ++ L+KRLKKLNS SS LN+
Sbjct  297   EGRGIEDIAREETGNVIDNSPAITSSTPTQVVDREVVKSRIVGLNKRLKKLNSYSSLLNL  356

Query  290   LTLMAMTLHLAHIAQRVHTVC  228
             LTLMA+T HL +++QR+   C
Sbjct  357   LTLMALTWHLVYLSQRLCNPC  377



>gb|KHG00926.1| Transmembrane protein [Gossypium arboreum]
Length=271

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = -1

Query  785  DAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYP  606
            D  + + S E L  V G A+LLGLATAYGM VWV+FISSY+L+  LPR Q   VQ+K+YP
Sbjct  40   DGLKNMTSMEALNTVMGIANLLGLATAYGMSVWVTFISSYILAGQLPRLQFGVVQSKIYP  99

Query  605  LYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
            +YF+AM YSIG A  GH L   +   SS  E +   NL++ L MVLVN +YLEP+A K
Sbjct  100  VYFRAMAYSIGMALLGHLLWHRKRSISSPPEVFQAINLLSTLFMVLVNGLYLEPKATK  157


 Score = 51.2 bits (121),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  344  KLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
            +L++RLKKLN+ SS LN+LTLMA+T HL ++ QR+   C
Sbjct  233  RLNERLKKLNTNSSMLNILTLMALTWHLVYLGQRLTLNC  271



>ref|XP_009414887.1| PREDICTED: uncharacterized protein LOC103995882 [Musa acuminata 
subsp. malaccensis]
Length=487

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 85/131 (65%), Gaps = 3/131 (2%)
 Frame = -1

Query  824  LKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALP  645
            L DI+RR  EV +DA  Y+++PE   A     HLLG ATAYG  VWV+F+S  VL+TALP
Sbjct  261  LTDIIRRAKEVAFDAAVYVWAPETGQAAAAILHLLGFATAYGASVWVTFVSGNVLATALP  320

Query  644  RQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLV  465
            RQQ   VQ+KLYP+YF+ + YS       HF G+ R   +   E   G+NL  AL++VL+
Sbjct  321  RQQFGLVQSKLYPVYFRLVAYSTALTLVAHFFGRDRRILA---ERVQGYNLFGALVLVLI  377

Query  464  NLVYLEPRAAK  432
            N+ +LEP+A K
Sbjct  378  NMFFLEPKATK  388



>gb|AAO42139.1| unknown protein [Arabidopsis thaliana]
Length=480

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 116/195 (59%), Gaps = 3/195 (2%)
 Frame = -1

Query  812  LRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQI  633
            ++ G      A     SP  + ++ G   L G+A A+G  VWV+F+SSYVL++ L RQQ 
Sbjct  289  VKNGAREFGSATAATLSPTKVASIVG---LTGIAAAFGTSVWVTFVSSYVLASVLGRQQF  345

Query  632  ATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVY  453
              VQ+KLYP+YFKA    I     GH L + R   + ATE + G N++++  M+  N  +
Sbjct  346  GVVQSKLYPVYFKATSVGILVGLFGHVLSRRRKLLTDATEMWQGVNILSSFFMIEANKSF  405

Query  452  LEPRAAKvmvermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAM  273
            +EPRA K M ERMK EKEEGRG            + +LS+RL KLN+ SS+LN+LTLM++
Sbjct  406  VEPRATKAMFERMKAEKEEGRGGERTSEQELRRKLEQLSERLSKLNTYSSWLNILTLMSL  465

Query  272  TLHLAHIAQRVHTVC  228
            T H  ++ QR+   C
Sbjct  466  TWHFVYLGQRLGAAC  480


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 59/116 (51%), Gaps = 27/116 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNA-------------------DTKAVVVEFEKDNNNGG  1110
             M N+LAL L+L TL A+ ++SP+                        VVVE+++D   G 
Sbjct  1     MTNLLALCLVLSTLLAAEVWSPSPAMTTHNTAVASEGEVIVKDGHHVVVVEYDRD---GK  57

Query  1109  GNTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
              NT+VSISP  A Q    E     N +E  +     VK++ K+ A+ LP+VG+GIS
Sbjct  58    TNTRVSISPPSADQGEEKE-----NEVEMGTSMFRNVKEKAKETASYLPHVGQGIS  108



>emb|CBI35531.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 123/218 (56%), Gaps = 27/218 (12%)
 Frame = -1

Query  836  RKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLS  657
            +KK   D + R    +YD   Y+ S + + ++    H+LG ATAYG+CVWV+F SS+VL+
Sbjct  73   QKKGQHDFINR----VYDVVNYMLSTDAIGSLTCVIHILGFATAYGVCVWVTFFSSFVLA  128

Query  656  TALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALI  477
             ALP QQ   VQ+K+YP YFK M   +G A  GH L Q         + + G  L+A L 
Sbjct  129  GALPNQQFGIVQSKIYPFYFKIMASCVGLALLGHALSQGEKVLLGKPDLFQGHALLATLH  188

Query  476  MVLVNLVYLEPRAAKvmvermkmekeegrgmngeg-----------------------sg  366
            ++L+NL+YLEPRA KVM ER+++E EE +G                              
Sbjct  189  IILINLLYLEPRATKVMFERIRVENEERKGQESSRVEPGKEGEPTTGASGPQVMGRLDQE  248

Query  365  ggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHI  252
              +  +++L++ LKKLN+ SSFLN+LTLM + LHL ++
Sbjct  249  TVNNQILELNEMLKKLNAYSSFLNILTLMVLKLHLVYL  286



>ref|XP_002446504.1| hypothetical protein SORBIDRAFT_06g017050 [Sorghum bicolor]
 gb|EES10832.1| hypothetical protein SORBIDRAFT_06g017050 [Sorghum bicolor]
Length=574

 Score =   134 bits (337),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 90/136 (66%), Gaps = 5/136 (4%)
 Frame = -1

Query  833  KKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTA--HLLGLATAYGMCVWVSFISSYVL  660
            +K L DI RR  +V  DA  Y+       A   TA  HLLG ATAYG CVWV+F+SS+VL
Sbjct  316  RKNLTDIARRARDVASDAAAYLLGAPRDAARTATAVMHLLGFATAYGACVWVTFVSSHVL  375

Query  659  STALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAAL  480
            + ALPRQQ+  +Q+KL+P+YF+AM Y +G A + H LG+     +S  ++   FNL+AAL
Sbjct  376  AAALPRQQLGLLQSKLFPVYFRAMAYGVGLALAAHLLGRELRSVASRAQS---FNLLAAL  432

Query  479  IMVLVNLVYLEPRAAK  432
             +V+ N++ LEP+A K
Sbjct  433  GLVVANMLLLEPKATK  448



>ref|XP_006390707.1| hypothetical protein EUTSA_v10018523mg [Eutrema salsugineum]
 gb|ESQ27993.1| hypothetical protein EUTSA_v10018523mg [Eutrema salsugineum]
Length=456

 Score =   132 bits (333),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 105/182 (58%), Gaps = 4/182 (2%)
 Frame = -1

Query  770  IFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKA  591
            + SP+ + +V G   L  +A A+G CVWV+F+SSYVL++ L RQQ   VQ+KLYP+YFK 
Sbjct  278  VLSPKKVASVVG---LTAIAAAFGSCVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKT  334

Query  590  MGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvm-verm  414
                I     GH + +     + ATE + G NL+A+  M+  N  ++EPRA K M     
Sbjct  335  TSVGILVGLLGHVVSRRMKLLTDATEMWQGVNLLASFFMIEANKSFVEPRATKAMFERMK  394

Query  413  kmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHT  234
              ++E   G            + KLS+RL KLN+ SS+LN+LTLM++T H  ++ QR+  
Sbjct  395  AEKEEGKGGGERTSEQEVRRKLEKLSERLSKLNTYSSWLNILTLMSLTWHFVYLGQRLGA  454

Query  233  VC  228
             C
Sbjct  455  AC  456


 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 62/115 (54%), Gaps = 25/115 (22%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT------------------KAVVVEFEKDNNNGGG  1107
             M N+LAL L+L TL A+ ++SP+                     + VVVE+++D   G  
Sbjct  1     MTNLLALCLVLSTLLAAEVWSPSPAVSTHQTTTPEGDIIVKDGHRVVVVEYDRD---GKT  57

Query  1106  NTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             NT+VSISP  A Q  + E+    N    +  KA   K+R K+AA+ LPNVG+GIS
Sbjct  58    NTRVSISPPSADQG-QGEQKQEENEETTLFRKA---KERAKEAASYLPNVGQGIS  108



>ref|XP_002887412.1| hypothetical protein ARALYDRAFT_476340 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63671.1| hypothetical protein ARALYDRAFT_476340 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   133 bits (334),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 118/199 (59%), Gaps = 8/199 (4%)
 Frame = -1

Query  824  LKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALP  645
            +K++ R  G V         SP  + ++ G   L  +A A+G  VWV+F+SSYVL++ L 
Sbjct  277  VKNVAREFGSVTA----ATLSPTKVASILG---LTAIAAAFGTTVWVTFVSSYVLASVLG  329

Query  644  RQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLV  465
            RQQ   VQ+KLYP+YFKA    I     GH L + R   + ATE + G NL++A  M+  
Sbjct  330  RQQFGVVQSKLYPVYFKATSVGILVGLFGHVLSRRRKLLTDATEMWQGVNLLSAFFMIES  389

Query  464  NLVYLEPRAAKvmvermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLT  285
            N  ++EPRA K M ERMK EKEEGRG              +LS+RL KLN+ SS+LN+LT
Sbjct  390  NKSFVEPRATKAMFERMKAEKEEGRGERTSEQELRRKLE-QLSERLSKLNTYSSWLNILT  448

Query  284  LMAMTLHLAHIAQRVHTVC  228
            LM++T H  ++ QR+ T C
Sbjct  449  LMSLTWHFVYLGQRLGTAC  467


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 57/115 (50%), Gaps = 26/115 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT------------------KAVVVEFEKDNNNGGG  1107
             M N+LAL L L TL A+ ++SP+  T                  + VVVE+++D   G  
Sbjct  1     MTNLLALCLFLTTLLAAEVWSPSPATTTHRTPPSEGDVIVKDGHRVVVVEYDRD---GKT  57

Query  1106  NTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             NT+VSISP  A Q    E           +     VK++ K+ A+ LP+VG+GIS
Sbjct  58    NTRVSISPPSADQGEEKENEEEKG-----TSLIRNVKEKAKETASYLPHVGQGIS  107



>ref|XP_004141640.1| PREDICTED: uncharacterized protein LOC101208468 [Cucumis sativus]
Length=392

 Score =   132 bits (331),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 125/395 (32%), Positives = 184/395 (47%), Gaps = 73/395 (18%)
 Frame = -1

Query  1208  LILITLGASGIFSP---------NADTKAVVVEFEKDNNNGGGNTKVSIS--PQEAAQNS  1062
             LI+ T  A+G++SP             + VVVE+   ++ G  NTKVSIS  P + A+NS
Sbjct  3     LIVTTFTAAGLWSPPPPPQNVIVKEGHRMVVVEY---DDQGQHNTKVSISSEPDQDAKNS  59

Query  1061  RLEKGYVL------NAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS----GHQeeeeevk  912
                +   L          K++   E+ K    + A    +VGE ++    G +++ +E  
Sbjct  60    ERHRTKDLICDVYGKCKHKVASAVEKAKVMVTETAQEAHDVGESVTDAFDGAKDKLKEGA  119

Query  911   etakeaaekvktaakekvtekvKDRRKKELKD---ILRRGGEVL----------------  789
             +   + A+       ++  E  K R +K +K    + +  GE +                
Sbjct  120   KETFDEAKGKLKEGAKETLEMAKSREEKVVKGAERVAKETGEKIKTGENKLKENLMGLVD  179

Query  788   --YDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTK  615
               +   +Y+F   +L        LLG   A GM VWV+FISSYVL++ LPRQQ+  VQ+K
Sbjct  180   RGFKVIDYLF--RHLGFGMDALGLLGFTMALGMGVWVTFISSYVLASVLPRQQLGVVQSK  237

Query  614   LYPLYFKAMGYSIGAAFSGHFLGQTRW--PYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             +YP+YFKAM   IG A  GH   +T W  P    +E   G+ LVAAL+M+  N +Y+EPR
Sbjct  238   IYPVYFKAMASCIGMALLGHLFSRTEWTFPIPKNSEVVQGYVLVAALLMIFANSLYMEPR  297

Query  440   AAKvm------------------------vermkmekeegrgmngegsgggspgmMKLSK  333
             A KVM                        V                        ++ L+K
Sbjct  298   ATKVMFERLKIEKEEGRGIEDIAREETGNVIDNSPAITSSTPTQVVDREVVKSRIVGLNK  357

Query  332   RLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
             RLKKLNS SS LN+LTLMA+T HL +++QR+   C
Sbjct  358   RLKKLNSYSSLLNLLTLMALTWHLVYLSQRLCNPC  392



>ref|XP_006434684.1| hypothetical protein CICLE_v10001073mg [Citrus clementina]
 gb|ESR47924.1| hypothetical protein CICLE_v10001073mg [Citrus clementina]
Length=465

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 84/223 (38%), Positives = 118/223 (53%), Gaps = 38/223 (17%)
 Frame = -1

Query  800  GEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQ  621
            G+  Y    Y+  PE L A+ G  +LLG +TAYGM VWV+FISSYVL+ ALPR Q   VQ
Sbjct  248  GQYSYGFLRYLGIPETLNALMGVINLLGFSTAYGMSVWVTFISSYVLAGALPRHQFGMVQ  307

Query  620  TKLYPLYFKAMGYSIGAAFSGHFLGQTRWP--YSSATEAYLGFNLVAALIMVLVNLVYLE  447
            +K+YP+YF+ +  SIG A  GH       P  +S+    + GFNL+A+++MVL+N +YLE
Sbjct  308  SKIYPVYFRDIACSIGWALLGHM------PQLFSTKAGMFQGFNLLASILMVLINSIYLE  361

Query  446  PRAAK-----------------------vmvermkmekeegrgmngegsgggspgmMKLS  336
            P A K                         V   +      R   G      SPG  +L 
Sbjct  362  PLATKVMFERMKVEKEEGKGRESQIGETSRVTETEQGTATERRAEGPAPVPVSPGQEELR  421

Query  335  KRLKKLNSQ-------SSFLNVLTLMAMTLHLAHIAQRVHTVC  228
             ++ KL+ +       SS LN++TLM++T HL ++ Q +HT C
Sbjct  422  TKMVKLSERLKTLNTYSSILNLITLMSLTWHLVYLGQSLHTTC  464



>ref|XP_010095892.1| hypothetical protein L484_008289 [Morus notabilis]
 gb|EXB62486.1| hypothetical protein L484_008289 [Morus notabilis]
Length=486

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 107/201 (53%), Gaps = 20/201 (10%)
 Frame = -1

Query  779  FEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLY  600
            F  + + + L  V G  +L+  +TAYG  VW +FI SYVL+ ALPRQQ   VQ+K+YP+Y
Sbjct  283  FRELVTGKALNPVVGVVYLVTFSTAYGTAVWETFILSYVLAGALPRQQFGVVQSKIYPVY  342

Query  599  FKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK----  432
            F+ M + IG A  G  +      +SS  E +  FNL+A+L++V VN++YLEPRA K    
Sbjct  343  FRTMAWGIGTAVLGLLVTGRGKAFSSMAEKFQIFNLLASLVLVFVNMLYLEPRATKVMFE  402

Query  431  ----------------vmvermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSF  300
                                                       ++ L+ RLKKLN+ SSF
Sbjct  403  RMRVEKEEGRGREELPAEQPSAAEPAVSSMPAETAEQEAVRNRILSLNGRLKKLNTWSSF  462

Query  299  LNVLTLMAMTLHLAHIAQRVH  237
            LN+L+LM+++ H+ ++ QR+H
Sbjct  463  LNILSLMSLSWHVYYLGQRLH  483



>ref|XP_008361622.1| PREDICTED: uncharacterized protein LOC103425319 [Malus domestica]
Length=218

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 89/143 (62%), Gaps = 14/143 (10%)
 Frame = -1

Query  842  DRRKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYV  663
             +R  +LKD   +G E+ Y AF  I S + L  +   AHL GLATAYGMC+W++ +SS+V
Sbjct  80   QKRLHQLKD---KGRELWYGAFRSIASGDLLEGLMSVAHLFGLATAYGMCMWITLVSSHV  136

Query  662  LSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSS------ATEAYLG  501
            L+ +LP QQ   VQ+K+Y +YFKAM YS+  A  GH      W + S      + +    
Sbjct  137  LAGSLPPQQFGMVQSKIYKVYFKAMAYSVRMALLGHL-----WRHRSSLFRGKSADMLHN  191

Query  500  FNLVAALIMVLVNLVYLEPRAAK  432
            +NL+AAL M+L N++YLEPR+ K
Sbjct  192  YNLIAALSMILFNMMYLEPRSTK  214



>emb|CDY03662.1| BnaA02g15750D [Brassica napus]
Length=462

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 104/183 (57%), Gaps = 6/183 (3%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             SP  + +V G   L  +A A+G  VWV+F+SSYVL++ L RQQ   VQ+KLYP+YFKA 
Sbjct  283  LSPTKVASVVG---LTAIAAAFGTSVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKAT  339

Query  587  GYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKv---mver  417
               I     GH L + R   + ATE + G NL++A  M+  N  ++EPRA K     ++ 
Sbjct  340  SVGILVGLLGHVLSRRRKLLTDATEMWQGVNLLSAFFMIEANKSFVEPRATKAMFERMKA  399

Query  416  mkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVH  237
             K E   G G            + KLS+RL KLN+ SS+LN++ LM++T H  ++ QR+ 
Sbjct  400  EKEEGRGGGGGERTSEQEVRRKLEKLSERLSKLNTYSSWLNIMMLMSLTWHFVYLGQRLG  459

Query  236  TVC  228
              C
Sbjct  460  AAC  462


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 27/115 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT------------------KAVVVEFEKDNNNGGG  1107
             M N+LAL L+  TL A+ ++SP+                     + VVVE+++D   G  
Sbjct  1     MTNLLALCLVFSTLFAAEVWSPSPAVTTQQTVVSEDDVIVKDGHRVVVVEYDRD---GKT  57

Query  1106  NTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             NT+VSISP  A      ++G     +EK +      K++ K+ A+  PNVG+GIS
Sbjct  58    NTRVSISPPSA------DEGEQKQEVEKETTLFRHAKEKAKETASYFPNVGQGIS  106



>ref|XP_009127895.1| PREDICTED: uncharacterized protein LOC103852751 [Brassica rapa]
Length=462

 Score =   129 bits (324),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 104/183 (57%), Gaps = 6/183 (3%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             SP  + +V G   L  +A A+G  VWV+F+SSYVL++ L RQQ   VQ+KLYP+YFKA 
Sbjct  283  LSPTKVASVVG---LTAIAAAFGTSVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKAT  339

Query  587  GYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKv---mver  417
               I     GH L + R   + ATE + G NL++A  M+  N  ++EPRA K     ++ 
Sbjct  340  SVGILVGLLGHVLSRRRKLLTDATEMWQGVNLLSAFFMIEANKSFVEPRATKAMFERMKA  399

Query  416  mkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVH  237
             K E   G G            + KLS+RL KLN+ SS+LN++ LM++T H  ++ QR+ 
Sbjct  400  EKEEGRGGGGGERTSEQEVRRKLEKLSERLSKLNTYSSWLNIMMLMSLTWHFVYLGQRLG  459

Query  236  TVC  228
              C
Sbjct  460  AAC  462


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 27/115 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT------------------KAVVVEFEKDNNNGGG  1107
             M N+LAL L+  TL A+ ++SP+                     + VVVE+++D   G  
Sbjct  1     MTNLLALCLVFSTLFAAEVWSPSPAVTTQQTVVSEDDVIVKDGHRVVVVEYDRD---GKT  57

Query  1106  NTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             NT+VSISP  A      ++G     +EK +      K++ K+ A+  PNVG+GIS
Sbjct  58    NTRVSISPPSA------DEGEQKQEVEKETTLFRHAKEKAKETASYFPNVGQGIS  106



>ref|XP_006473884.1| PREDICTED: uncharacterized protein LOC102618133 [Citrus sinensis]
Length=524

 Score =   129 bits (325),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 117/223 (52%), Gaps = 38/223 (17%)
 Frame = -1

Query  800  GEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQ  621
            G+  Y    Y+  PE L A+ G  +LLG +TAYGM VWV+FISSYVL+ ALPR Q   VQ
Sbjct  307  GQYSYGFLRYLGIPETLNALMGVINLLGFSTAYGMSVWVTFISSYVLAGALPRHQFGMVQ  366

Query  620  TKLYPLYFKAMGYSIGAAFSGHFLGQTRWP--YSSATEAYLGFNLVAALIMVLVNLVYLE  447
            +K+YP+YF+A+  SIG A  GH       P  +SS    + GFNL+A+++MVL+N +YLE
Sbjct  367  SKIYPVYFRAIACSIGWALLGHM------PQLFSSKAGMFQGFNLLASILMVLINSIYLE  420

Query  446  PRAAK-----------------------vmvermkmekeegrgmngegsgggspgmMKLS  336
            P A K                         V   +      R   G      +PG  +L 
Sbjct  421  PLATKVMFERMKVEKEEGKGRESQIGETSRVTETEQGTATERRAEGPAPVPVNPGQEELR  480

Query  335  KRLKKLNSQSSFLN-------VLTLMAMTLHLAHIAQRVHTVC  228
             ++ KL+ +   LN       ++TLM++T HL ++ Q +HT C
Sbjct  481  TKMVKLSGRLKTLNTYSSVLNLITLMSLTWHLVYLGQSLHTTC  523



>emb|CDX82188.1| BnaC02g21020D [Brassica napus]
Length=460

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 103/181 (57%), Gaps = 4/181 (2%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             SP  + +V G   L  +A A+G  VWV+F+SSYVL++ L RQQ   VQ+KLYP+YFKA 
Sbjct  283  LSPTKVASVVG---LTAIAAAFGTSVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKAT  339

Query  587  GYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvm-vermk  411
               I     GH L + R   + ATE + G NL++A  M+  N  ++EPRA K M      
Sbjct  340  SVGILVGLLGHVLSRRRKLLTDATEMWQGVNLLSAFFMIEANKSFVEPRATKAMFERMKA  399

Query  410  mekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTV  231
             ++E   G            + +LS+RL KLN+ SS+LN++ LM++T H  ++ QR+   
Sbjct  400  EKEEGRGGGERTSEQEVRRKLERLSERLSKLNTYSSWLNIMMLMSLTWHFVYLGQRLGAA  459

Query  230  C  228
            C
Sbjct  460  C  460


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 27/115 (23%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT------------------KAVVVEFEKDNNNGGG  1107
             M N+LAL L+  TL A+ ++SP+                     + VVVE+++D   G  
Sbjct  1     MTNLLALCLVFSTLFAAEVWSPSPSVTTQQTVVSEEDVIVKDGHRVVVVEYDRD---GKT  57

Query  1106  NTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             NT+VSISP  A      ++G     +EK +      K++ K+ A+  PNVG+GIS
Sbjct  58    NTRVSISPPSA------DEGEQKQEVEKETTLFRHAKEKAKETASYFPNVGQGIS  106



>ref|XP_008361625.1| PREDICTED: seed biotin-containing protein SBP65-like [Malus domestica]
Length=486

 Score =   127 bits (320),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 89/142 (63%), Gaps = 14/142 (10%)
 Frame = -1

Query  839  RRKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVL  660
            +R  + +D +R   E  Y AF  I S + L  +   AHL GLATAYGMC+W++F+SS+VL
Sbjct  287  KRLHQSRDKVR---EFWYGAFRSIASGDLLEGLMSVAHLFGLATAYGMCMWITFVSSHVL  343

Query  659  STALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSS------ATEAYLGF  498
            + +LP QQ   VQ+K+Y +YFKAM YS+G A  GH      W + S      A +    +
Sbjct  344  AWSLPPQQFGMVQSKIYKVYFKAMAYSVGMALLGHL-----WRHRSSLFRGKAADMLQNY  398

Query  497  NLVAALIMVLVNLVYLEPRAAK  432
            NL+AAL M+L N++YLEPR+ K
Sbjct  399  NLIAALSMILFNMMYLEPRSTK  420



>ref|XP_003579779.1| PREDICTED: uncharacterized protein LOC100835682 [Brachypodium 
distachyon]
Length=588

 Score =   128 bits (322),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 90/135 (67%), Gaps = 5/135 (4%)
 Frame = -1

Query  830  KELKDILRRGGEVLYDAFEYIFSPENLTAVFGTA--HLLGLATAYGMCVWVSFISSYVLS  657
            K L DI+RR  +V  DA  Y+       A   TA  HLLG ATAYG CVWV+F+SS+VL+
Sbjct  337  KNLTDIVRRARDVASDAAVYLLGAPMEAARTATAVMHLLGFATAYGACVWVTFVSSHVLA  396

Query  656  TALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALI  477
             ALPRQQ+  +Q+KLYP+YF+AM Y +G A + H LG+ R   +S  ++   FNL+ AL 
Sbjct  397  AALPRQQLGVLQSKLYPVYFRAMAYGVGLALAAHLLGRERSSLASRAQS---FNLLGALG  453

Query  476  MVLVNLVYLEPRAAK  432
            +VL N++ LEP+A K
Sbjct  454  LVLANMLLLEPKATK  468


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = -1

Query  344  KLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC*TPC  216
            +L+KRLK+LNS SS  NVL+LMA+T HL H+A+R+ T   T C
Sbjct  548  RLNKRLKQLNSYSSLCNVLSLMALTWHLVHLARRLQTS--TAC  588



>ref|XP_009591281.1| PREDICTED: uncharacterized protein LOC104088327 [Nicotiana tomentosiformis]
Length=478

 Score =   127 bits (318),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = -1

Query  812  LRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQI  633
            L+  G+  Y       S +N  ++ G  HLLG A +YG+C+WV+FISS +L+ ALP+QQ 
Sbjct  243  LKVEGKRDYQIIRRFLSAKNFRSLMGMIHLLGFALSYGVCIWVTFISSNILARALPKQQF  302

Query  632  ATVQTKLYPLYFKAMGYSIGAAFSGHFLGQT-RWPYSSATEAYLGFNLVAALIMVLVNLV  456
            A VQ+K+YP+YFK + Y I  AF GHF+ Q  R+ Y++  E   GF  +A + M L+N  
Sbjct  303  AMVQSKIYPVYFKTLAYGITTAFLGHFMSQRHRYYYANRAETIQGFLCLATICMALINSF  362

Query  455  YLEPRAAK  432
             LEPRA+K
Sbjct  363  VLEPRASK  370


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 60/105 (57%), Gaps = 20/105 (19%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADTK----------AVVVEFEKDNNNGGGNTKVSISP  1083
             MMNI  ++L+L TL  +G+FSP  + K           VVVE+E ++    GNTKVSISP
Sbjct  1     MMNIFVITLVLTTLLTAGVFSPIPEKKEEVIVKEGHRVVVVEYEPND----GNTKVSISP  56

Query  1082  QEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEG  948
             QE  Q +    G V +  +KIS+ AE VK + K+A +     GEG
Sbjct  57    QETDQKATA--GVVSDVKDKISDTAEAVKDKIKEATS----FGEG  95



>ref|XP_008339201.1| PREDICTED: uncharacterized protein LOC103402237 [Malus domestica]
Length=527

 Score =   127 bits (319),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 89/142 (63%), Gaps = 14/142 (10%)
 Frame = -1

Query  839  RRKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVL  660
            +R  + +D +R   E  Y AF  I S + L  +   AHL GLATAYGMC+W++F+SS+VL
Sbjct  287  KRLHQSRDKVR---EFWYGAFRSIASGDLLEGLMSVAHLFGLATAYGMCMWITFVSSHVL  343

Query  659  STALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSS------ATEAYLGF  498
            + +LP QQ   VQ+K+Y +YFKAM YS+G A  GH      W + S      A +    +
Sbjct  344  AWSLPPQQFGMVQSKIYKVYFKAMAYSVGMALLGHL-----WRHRSSLFRGKAADMLQNY  398

Query  497  NLVAALIMVLVNLVYLEPRAAK  432
            NL+AAL M+L N++YLEPR+ K
Sbjct  399  NLIAALSMILFNMMYLEPRSTK  420



>ref|XP_008368140.1| PREDICTED: uncharacterized protein LOC103431746 [Malus domestica]
Length=536

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 89/142 (63%), Gaps = 14/142 (10%)
 Frame = -1

Query  839  RRKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVL  660
            +R  + +D +R   E  Y AF  I S + L  +   AHL GLATAYGMC+W++F+SS+VL
Sbjct  287  KRLHQSRDKVR---EFWYGAFRSIASGDLLEGLMSVAHLFGLATAYGMCMWITFVSSHVL  343

Query  659  STALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSS------ATEAYLGF  498
            + +LP QQ   VQ+K+Y +YFKAM YS+G A  GH      W + S      A +    +
Sbjct  344  AWSLPPQQFGMVQSKIYKVYFKAMAYSVGMALLGHL-----WRHRSSLFRGKAADMLQNY  398

Query  497  NLVAALIMVLVNLVYLEPRAAK  432
            NL+AAL M+L N++YLEPR+ K
Sbjct  399  NLIAALSMILFNMMYLEPRSTK  420



>ref|XP_008459625.1| PREDICTED: uncharacterized protein LOC103498695 [Cucumis melo]
Length=432

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/231 (39%), Positives = 122/231 (53%), Gaps = 32/231 (14%)
 Frame = -1

Query  842  DRRKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYV  663
            ++ K+ L  ++ RG +V+     Y+F   +L        LLG A A GM VWV+FISSYV
Sbjct  208  NKLKENLMGLVDRGFKVM----NYLF--RHLGVGMDALGLLGFAMALGMGVWVTFISSYV  261

Query  662  LSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRW--PYSSATEAYLGFNLV  489
            L++ LPRQQ+  VQ+K+YP+YFKAM   IG A  GH   +T W  P    +E   G+ LV
Sbjct  262  LASVLPRQQLGVVQSKIYPVYFKAMASCIGMALLGHLFSRTEWKFPIPKNSEVVQGYVLV  321

Query  488  AALIMVLVNLVYLEPRAAKvm------------------------vermkmekeegrgmn  381
            AAL+M+  N +Y+EPRA KVM                        V              
Sbjct  322  AALLMIFANSLYMEPRATKVMFERLKIEKEEGRGIEDIGREETVNVIDNSPAITSSTPTQ  381

Query  380  gegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
                      ++ L+KRLKKLNS SS LN+LTLMA+T HL +++QR+   C
Sbjct  382  IVDREVVKSRIVGLNKRLKKLNSYSSLLNLLTLMALTWHLVYLSQRLCNPC  432



>ref|XP_004162866.1| PREDICTED: uncharacterized protein LOC101231534 [Cucumis sativus]
Length=407

 Score =   124 bits (312),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 89/231 (39%), Positives = 122/231 (53%), Gaps = 32/231 (14%)
 Frame = -1

Query  842  DRRKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYV  663
            ++ K+ L  ++ RG +V+    +Y+F   +L        LLG   A GM VWV+FISSYV
Sbjct  183  NKLKENLMGLVDRGFKVI----DYLF--RHLGFGMDALGLLGFTMALGMGVWVTFISSYV  236

Query  662  LSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRW--PYSSATEAYLGFNLV  489
            L++ LPRQQ+  VQ+K+YP+YFKAM   IG A  GH   +T W  P    +E   G+ LV
Sbjct  237  LASVLPRQQLGVVQSKIYPVYFKAMASCIGMALLGHLFSRTEWTFPIPKNSEVVQGYVLV  296

Query  488  AALIMVLVNLVYLEPRAAKvm------------------------vermkmekeegrgmn  381
            AAL+M+  N +Y+EPRA KVM                        V              
Sbjct  297  AALLMIFANSLYMEPRATKVMFERLKIEKEEGRGIEDIAREETGNVIDSSPAITSSTPTQ  356

Query  380  gegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
                      ++ L+KRLKKLNS SS LN+LTLMA+T HL +++QR+   C
Sbjct  357  VVDREVVKSRIVGLNKRLKKLNSYSSLLNLLTLMALTWHLVYLSQRLCNPC  407



>ref|XP_010521158.1| PREDICTED: uncharacterized protein LOC104800129 isoform X1 [Tarenaya 
hassleriana]
Length=493

 Score =   125 bits (313),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 104/181 (57%), Gaps = 6/181 (3%)
 Frame = -1

Query  782  AFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPL  603
            A + + SP  +  V G   L  LA AYG C+WV+F+SSYVL+  L R Q   VQ+K+YP+
Sbjct  314  AAKEVMSPAKVGGVVG---LTALAMAYGTCIWVTFVSSYVLAGVLGRNQFGLVQSKVYPV  370

Query  602  YFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvmv  423
            YFK +   I     GH +G++R   + + + +   NL+ + +MV  N   L+PRA +   
Sbjct  371  YFKTVSLGILVGLVGHVIGRSRKLLTDSADMWQAMNLLTSFLMVEGNGSILDPRATR---  427

Query  422  ermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQR  243
               +  K E     G         + KLS+RL+KLN+ SS++N+LTLM++T HL +I QR
Sbjct  428  AMFERMKVEKEEGRGADEEETRQKLRKLSERLQKLNTYSSWINILTLMSLTWHLVYIGQR  487

Query  242  V  240
            +
Sbjct  488  L  488



>gb|EPS65890.1| hypothetical protein M569_08895 [Genlisea aurea]
Length=433

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 119/211 (56%), Gaps = 19/211 (9%)
 Frame = -1

Query  833  KKELKDILRRGGEVLYDAFEYIFSPENLTAVF----GTAHLLGLATAYGMCVWVSFISSY  666
            K+ELK+IL R  E+  D +EY  +P + +A F    GT +L+G + AYG CVWV+F SS 
Sbjct  216  KRELKEILNRFRELASDVYEYAAAPSSPSAAFDLLTGTLNLVGFSAAYGACVWVTFASSC  275

Query  665  VLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVA  486
            VLS ALPRQ  A  Q K+YP YFK   Y + AA SGH + +      +       +NLVA
Sbjct  276  VLSGALPRQHFAAAQGKIYPAYFKFQAYGVAAALSGHLMNR------NVGAKLQTWNLVA  329

Query  485  ALIMVLVNLVYLEPRAAKvmvermkm---------ekeegrgmngegsgggspgmMKLSK  333
            +L  +++NL+ +EP AA+   ER K                             +MKL++
Sbjct  330  SLAAIVLNLLRIEPLAARAAAERAKKLDIGKSSSSSSASVAETTAGRVSEQEAEVMKLNE  389

Query  332  RLKKLNSQSSFLNVLTLMAMTLHLAHIAQRV  240
             +++LNS SS LNV+ L+++T +L H+AQR+
Sbjct  390  DMRRLNSYSSMLNVVNLVSLTWYLLHLAQRL  420



>ref|XP_010521159.1| PREDICTED: uncharacterized protein LOC104800129 isoform X2 [Tarenaya 
hassleriana]
Length=489

 Score =   124 bits (312),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 104/181 (57%), Gaps = 6/181 (3%)
 Frame = -1

Query  782  AFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPL  603
            A + + SP  +  V G   L  LA AYG C+WV+F+SSYVL+  L R Q   VQ+K+YP+
Sbjct  310  AAKEVMSPAKVGGVVG---LTALAMAYGTCIWVTFVSSYVLAGVLGRNQFGLVQSKVYPV  366

Query  602  YFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvmv  423
            YFK +   I     GH +G++R   + + + +   NL+ + +MV  N   L+PRA +   
Sbjct  367  YFKTVSLGILVGLVGHVIGRSRKLLTDSADMWQAMNLLTSFLMVEGNGSILDPRATR---  423

Query  422  ermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQR  243
               +  K E     G         + KLS+RL+KLN+ SS++N+LTLM++T HL +I QR
Sbjct  424  AMFERMKVEKEEGRGADEEETRQKLRKLSERLQKLNTYSSWINILTLMSLTWHLVYIGQR  483

Query  242  V  240
            +
Sbjct  484  L  484



>ref|XP_008352801.1| PREDICTED: uncharacterized protein LOC103416320 [Malus domestica]
Length=555

 Score =   125 bits (313),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 88/142 (62%), Gaps = 14/142 (10%)
 Frame = -1

Query  839  RRKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVL  660
            +R  + +D +R   E  Y AF  I S + L  +   AHL GLATAYGMC+W++F+SS+VL
Sbjct  287  KRLHQSRDKVR---EFWYGAFRSIASGDLLEGLMSVAHLFGLATAYGMCMWITFVSSHVL  343

Query  659  STALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSS------ATEAYLGF  498
            + +LP QQ   VQ+K+Y +YFKAM YS+G A  GH      W + S      A +    +
Sbjct  344  AWSLPPQQFGMVQSKIYKVYFKAMAYSVGMALLGHL-----WRHRSSLFRGKAADMLQNY  398

Query  497  NLVAALIMVLVNLVYLEPRAAK  432
            NL+AAL M+  N++YLEPR+ K
Sbjct  399  NLIAALSMIXXNMMYLEPRSTK  420



>ref|XP_009362438.1| PREDICTED: uncharacterized protein LOC103952558 [Pyrus x bretschneideri]
Length=535

 Score =   124 bits (312),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 87/142 (61%), Gaps = 14/142 (10%)
 Frame = -1

Query  839  RRKKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVL  660
            +R  +L+D  R   E  Y AF  I S + L  +   AHL GLATAYGMC+W++F SS+VL
Sbjct  296  KRLHQLRDKER---EFWYGAFRSIASGDLLEGLMSVAHLFGLATAYGMCMWITFASSHVL  352

Query  659  STALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSS------ATEAYLGF  498
            + +LP QQ   VQ+K+Y +YFKAM YS+G A  GH      W + S      + +    +
Sbjct  353  AGSLPPQQFGMVQSKIYKVYFKAMAYSVGMALLGHL-----WRHRSSLFRGKSADMLQNY  407

Query  497  NLVAALIMVLVNLVYLEPRAAK  432
            NL+ AL M+L N++YLEPR+ K
Sbjct  408  NLIVALSMILFNMMYLEPRSTK  429



>ref|XP_006356548.1| PREDICTED: uncharacterized protein LOC102585078 [Solanum tuberosum]
Length=443

 Score =   120 bits (301),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 73/114 (64%), Gaps = 0/114 (0%)
 Frame = -1

Query  773  YIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFK  594
            YIFS ++  ++ G  HLLG A +YG+ VW++FISS +L+ ALP+QQ A VQ+K+YP YFK
Sbjct  224  YIFSAKSFRSLMGIIHLLGFALSYGVSVWMTFISSNILARALPKQQFAMVQSKIYPAYFK  283

Query  593  AMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
             M Y I  AF GH L Q    Y++ TE   G   +A   M L N  YLEPRA K
Sbjct  284  TMYYGIATAFLGHMLSQMLPYYANRTEKIQGLIFLAIFSMTLFNCFYLEPRATK  337


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 44/82 (54%), Gaps = 14/82 (17%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADTK----------AVVVEFEKDNNNGGGNTKVSISP  1083
             MMN+ A+SL+L TL  +G+FSPN + K           VVVE+E ++    G TKVSISP
Sbjct  1     MMNVFAISLVLTTLVTAGVFSPNPEKKDDVIVKDGHRVVVVEYEPND----GQTKVSISP  56

Query  1082  QEAAQNSRLEKGYVLNAMEKIS  1017
              E     +     V +   K+S
Sbjct  57    PETEHKEKTGHVSVSDVKNKLS  78



>gb|KFK44353.1| hypothetical protein AALP_AA1G246500 [Arabis alpina]
Length=369

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/216 (32%), Positives = 109/216 (50%), Gaps = 25/216 (12%)
 Frame = -1

Query  821  KDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPR  642
            K+  RR G V+ +A +       LT +     L+G+ATAYGMCVWV+ +S Y+L++ L R
Sbjct  161  KNASRRLGTVVAEALK-------LTKIGSVVSLMGIATAYGMCVWVTVVSRYLLASVLGR  213

Query  641  QQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVN  462
            QQ   VQ+K+YP+YFKA+  +I     GH + + R   + A E +   NL+++++MV  N
Sbjct  214  QQSDVVQSKVYPVYFKAISVAILLGLLGHVISRRRKVLTDALEMWQAVNLLSSILMVEAN  273

Query  461  LVYLEPRAAKv------------------mvermkmekeegrgmngegsgggspgmMKLS  336
              ++E RA K                               + +           + KL+
Sbjct  274  ASFVESRAIKTLFELIKAEKEDGRGLGGSESSETAARTSAKKVLEKTEDVTVKQRLAKLT  333

Query  335  KRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
            +RL +LNS S  LN+LTLM++T H  ++  R+   C
Sbjct  334  ERLSRLNSYSWRLNILTLMSLTWHFVYLGHRLSLTC  369



>ref|NP_173674.1| Late embryogenesis abundant protein (LEA) family protein [Arabidopsis 
thaliana]
 gb|AAF18519.1|AC006551_5 Similar to seed maturation protein PM27 [Arabidopsis thaliana]
 gb|AAX23755.1| hypothetical protein At1g22600 [Arabidopsis thaliana]
 gb|AAZ52683.1| hypothetical protein At1g22600 [Arabidopsis thaliana]
 gb|AEE30259.1| Late embryogenesis abundant protein (LEA) family protein [Arabidopsis 
thaliana]
Length=385

 Score =   117 bits (293),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 102/197 (52%), Gaps = 22/197 (11%)
 Frame = -1

Query  752  LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIG  573
            LT +     ++G+A AYGMCVWV+F+S YVL++ L  QQ   VQ+K+YP+YFKA+   I 
Sbjct  189  LTKIGSVVGIVGIAAAYGMCVWVTFVSGYVLASVLGEQQFGVVQSKMYPVYFKAVSVGIL  248

Query  572  AAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK-------------  432
                GH +G+ R  ++ A + +   NL+++++MV  N  ++  RA K             
Sbjct  249  VGLLGHVIGRRRKVFTDAVDMWQSVNLLSSILMVEANASFVYTRATKAMFELIKAEKEDG  308

Query  431  ---------vmvermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLM  279
                        E     + + +             + KLS+R++KLN+ SS LN+LTLM
Sbjct  309  RGFDTSDQSQSSESAGRTRGKKKVTEKTDEDVVKQRLTKLSERMRKLNAYSSRLNLLTLM  368

Query  278  AMTLHLAHIAQRVHTVC  228
            ++T H  ++  R+   C
Sbjct  369  SLTWHFVYLGYRLSLTC  385



>ref|XP_002893240.1| hypothetical protein ARALYDRAFT_472499 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69499.1| hypothetical protein ARALYDRAFT_472499 [Arabidopsis lyrata subsp. 
lyrata]
Length=379

 Score =   117 bits (293),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 101/196 (52%), Gaps = 21/196 (11%)
 Frame = -1

Query  752  LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIG  573
            LT +     ++G+A AYGMCVWV+F+S YVL++ L  QQ   VQ+K+YP+YFKA+   I 
Sbjct  184  LTKIGSVVGIVGIAAAYGMCVWVTFVSGYVLASVLGEQQFGVVQSKMYPVYFKAVTVGIL  243

Query  572  AAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKv------------  429
                GH + + R  ++ A + +   NL+A+++MV  N  +++PRA K             
Sbjct  244  VGLLGHVISRRRKVFTDAVDMWQAVNLLASILMVEANASFVDPRATKAMFELIKAEKEEG  303

Query  428  ---------mvermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMA  276
                       E     + + +             +  LS+R+ +LN+ SS LN+LTLM+
Sbjct  304  RGLDTSETQSSETAARTRGKKKVTEKMDQDAVKQRLTNLSERMYRLNAYSSRLNLLTLMS  363

Query  275  MTLHLAHIAQRVHTVC  228
            +T H  ++  R+   C
Sbjct  364  LTWHFVYLGDRLSLTC  379



>ref|XP_004516134.1| PREDICTED: uncharacterized protein LOC101512941 [Cicer arietinum]
Length=433

 Score =   117 bits (294),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 74/112 (66%), Gaps = 3/112 (3%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             S E++  +   A+LLG A+ YGM VW++F+SSYVLS  +PRQQ A VQ+K+YP+YF+AM
Sbjct  215  LSMESVANLMSVANLLGFASGYGMNVWITFVSSYVLSRVMPRQQFAVVQSKIYPVYFRAM  274

Query  587  GYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
            GY +  A  GH  G  R       +A    NL+A+L+ V VN VYLEPRA K
Sbjct  275  GYCLVIALLGHVFGHGRKHKGGVLQAS---NLLASLLTVFVNSVYLEPRATK  323


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 61/110 (55%), Gaps = 23/110 (21%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT----------KAVVVEFEKDNNNGGGNTKVSISP  1083
             MMNI+ALSL + +L AS IFSPN             + VVVE+++D   G  NTK+SISP
Sbjct  1     MMNIIALSLFITSLTASSIFSPNQKQAPNTIVKEGHRVVVVEYDQD---GYQNTKISISP  57

Query  1082  QEAAQNSRLEKGYVLNAMEKI-SEKAEEVKQRFKDAAAVLPNVGEGISGH  936
             ++             N    I S   E  K + K+AA+VLPN+G+GIS H
Sbjct  58    EQQQHQ---------NDFTNIDSSILENTKHKIKEAASVLPNMGQGISQH  98



>ref|XP_008368141.1| PREDICTED: transmembrane protein 205-like [Malus domestica]
Length=211

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 76/119 (64%), Gaps = 11/119 (9%)
 Frame = -1

Query  770  IFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKA  591
            I S + L  +   AHL GLATAYGMC+W++ +SS+VL+ +LP QQ   VQ+K+Y +YFKA
Sbjct  87   IASGDLLEGLMSVAHLFGLATAYGMCMWITLVSSHVLAGSLPPQQFGMVQSKIYKVYFKA  146

Query  590  MGYSIGAAFSGHFLGQTRWPYSS------ATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
            M YS+  A  GH      W + S      + +    +NL+AAL M+L N++YLEPR+ K
Sbjct  147  MAYSVRMALLGHL-----WRHRSSLFRGKSADMLHNYNLIAALSMILFNMMYLEPRSTK  200



>gb|KDP35105.1| hypothetical protein JCGZ_10947 [Jatropha curcas]
Length=497

 Score =   117 bits (293),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = -1

Query  791  LYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKL  612
            L  AF ++ S + +  + G  +LLG + AYGMC WV+FISSYVL+ AL RQQ   VQ+K+
Sbjct  270  LNRAFRFMGSQKGIHFLMGVINLLGFSIAYGMCFWVTFISSYVLANALNRQQFGLVQSKI  329

Query  611  YPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
            YP+YF+AMG+ I  A  GH +G+ ++ ++S  E +   NL+ ++++VL+N +YLEP A K
Sbjct  330  YPVYFRAMGFCIAVALFGHLIGRMKFSFTSKAEVFQAINLLLSVLLVLINALYLEPLATK  389


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  344  KLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVHTVC  228
            ++++RLKKLNS SSFLN+L LMA+T HL ++ Q +H  C
Sbjct  459  RVNERLKKLNSCSSFLNILILMALTWHLVYLGQWLHGTC  497



>ref|XP_007224898.1| hypothetical protein PRUPE_ppa022136mg [Prunus persica]
 gb|EMJ26097.1| hypothetical protein PRUPE_ppa022136mg [Prunus persica]
Length=496

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 81/134 (60%), Gaps = 0/134 (0%)
 Frame = -1

Query  833  KKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLST  654
            +K   ++ R+G E+ Y A       + L A+   A+L GLATAYG C+W++F+SS+VL  
Sbjct  263  QKRFHELGRKGREIWYGALRSTGLSDALDALMSVANLFGLATAYGTCMWITFVSSHVLLG  322

Query  653  ALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIM  474
             L  QQ   VQ+K+Y +YF+AM  S+G A  GH        ++        FNL+AAL+M
Sbjct  323  NLAPQQFGMVQSKIYRVYFRAMASSVGMALLGHLWRHGNKKFTGNMLQLQNFNLMAALLM  382

Query  473  VLVNLVYLEPRAAK  432
            + VN++YLEPR+ K
Sbjct  383  IFVNMLYLEPRSTK  396



>ref|XP_006305902.1| hypothetical protein CARUB_v10011076mg [Capsella rubella]
 gb|EOA38800.1| hypothetical protein CARUB_v10011076mg [Capsella rubella]
Length=382

 Score =   114 bits (286),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 109/196 (56%), Gaps = 21/196 (11%)
 Frame = -1

Query  752  LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIG  573
            LT +     L+G+A AYGMCVWV+F+S YVL++ L RQQ   VQ+K+YP+YFKA+   I 
Sbjct  187  LTKIGSVMGLVGIAAAYGMCVWVTFVSGYVLASVLGRQQFDVVQSKMYPVYFKAVSVGIL  246

Query  572  AAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAKvmvermkmekeeg  393
                GH + + R  ++ A + +   NL+++++MV  N  +++PR  K M ER+K EKEEG
Sbjct  247  IGLLGHVISRRRKVFTDAVDMWQAVNLLSSILMVEANASFVDPRVTKAMFERIKAEKEEG  306

Query  392  rgmngegsgggspgm---------------------MKLSKRLKKLNSQSSFLNVLTLMA  276
            RG++   S                             KLS+R   LN+ SS LN+LT M+
Sbjct  307  RGLDTSESHSSETAARTIGKKVREKMDEAGGVNQRLRKLSERHCTLNAYSSLLNLLTFMS  366

Query  275  MTLHLAHIAQRVHTVC  228
            +T H  ++  R+   C
Sbjct  367  LTWHFVYLGHRLSLTC  382



>ref|XP_010460015.1| PREDICTED: uncharacterized protein LOC104740962 [Camelina sativa]
Length=379

 Score =   114 bits (284),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 99/191 (52%), Gaps = 20/191 (10%)
 Frame = -1

Query  752  LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIG  573
            LT +     L+G+A AYGMCVWV+F+S YVL + L RQQ   VQ+K+YP+YFKA+   I 
Sbjct  186  LTKIGSVVGLVGIAAAYGMCVWVTFVSGYVLGSVLGRQQYDVVQSKMYPVYFKAVSVGIL  245

Query  572  AAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK-------------  432
             A  GH + + R  ++ A + +   NL+++++MV  N  +++PR  K             
Sbjct  246  IALLGHVISRRRKVFTDAVDMWQAVNLLSSILMVEANASFVDPRVTKAMFERIKAEKEDG  305

Query  431  -------vmvermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAM  273
                           +    +        G    + KLS+R  +LN+ SS LN+LTL+++
Sbjct  306  RGLDTSESQSSETAAKTIGKKIREKMDEDGVKQRLKKLSERHCRLNAYSSRLNLLTLISL  365

Query  272  TLHLAHIAQRV  240
            T H  ++  R+
Sbjct  366  TWHFVYLGHRL  376



>ref|XP_010498737.1| PREDICTED: uncharacterized protein LOC104776381 [Camelina sativa]
Length=379

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 100/192 (52%), Gaps = 20/192 (10%)
 Frame = -1

Query  752  LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIG  573
            LT +     L+G+A AYGMCVWV+F+S YVL + L RQQ   VQ+K+YP+YFKA+   I 
Sbjct  186  LTKIGSVVGLVGIAAAYGMCVWVTFVSGYVLGSVLGRQQYDVVQSKMYPVYFKAVSVGIL  245

Query  572  AAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK-------------  432
             A  GH + + R  ++ A + +   NL+++++MV  N  +++PR  K             
Sbjct  246  IALLGHVISRRRKVFTDAVDMWQAVNLLSSILMVEANASFVDPRVTKAIFERIKAGKEDG  305

Query  431  -------vmvermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAM  273
                           +    +        G    + KLS+R  +LN+ SS LN+LTL+++
Sbjct  306  RGLDTPDSQSSETAAQTIGKKIREKMDEDGVKQRLKKLSERHCRLNAYSSRLNLLTLISL  365

Query  272  TLHLAHIAQRVH  237
            T H  ++  R++
Sbjct  366  TWHFVYLGHRLN  377



>gb|AFW58284.1| hypothetical protein ZEAMMB73_800275 [Zea mays]
Length=579

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 88/135 (65%), Gaps = 5/135 (4%)
 Frame = -1

Query  830  KELKDILRRGGEVLYDAFEYIFSPENLTAVFGTA--HLLGLATAYGMCVWVSFISSYVLS  657
            K L DI RR   V  DA  Y+       A   TA  HLLG ATAYG CVWV+F+SS+VL+
Sbjct  328  KNLTDIARRARGVASDAAAYLLGAPREAARTATAVMHLLGFATAYGACVWVTFVSSHVLA  387

Query  656  TALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALI  477
             ALPRQQ+  VQ+KL+P+YF+A+ Y +G A + H LG+ R   +S  ++    NL+AAL 
Sbjct  388  AALPRQQLGVVQSKLFPVYFRALAYGVGLALAAHLLGRERGSLASRAQSL---NLLAALG  444

Query  476  MVLVNLVYLEPRAAK  432
            +VL N++ LEP+A +
Sbjct  445  LVLANMLLLEPKATR  459



>ref|XP_008219004.1| PREDICTED: uncharacterized protein LOC103319269 [Prunus mume]
Length=534

 Score =   113 bits (282),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 79/134 (59%), Gaps = 0/134 (0%)
 Frame = -1

Query  833  KKELKDILRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLST  654
            +K   ++ R+G E+ Y A       + L  +   A+L GLATAYG C+W++F+SS+VL  
Sbjct  301  QKRFHELGRKGREIWYGALRSTGLSDALDTLMSVANLFGLATAYGTCMWITFVSSHVLLG  360

Query  653  ALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIM  474
             L  QQ   VQ+K+Y +YF+AM  S+G A  GH        ++        FNL+AAL+M
Sbjct  361  NLAPQQFGMVQSKIYRVYFRAMASSVGMALLGHLWRHGNKKFTGNMLQLQNFNLMAALLM  420

Query  473  VLVNLVYLEPRAAK  432
            +  N++YLEPR+ K
Sbjct  421  IFANMLYLEPRSTK  434



>ref|XP_006416182.1| hypothetical protein EUTSA_v10008247mg [Eutrema salsugineum]
 gb|ESQ34535.1| hypothetical protein EUTSA_v10008247mg [Eutrema salsugineum]
Length=315

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 108/212 (51%), Gaps = 28/212 (13%)
 Frame = -1

Query  812  LRRGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQI  633
            +RR G  + +A +       LT +     L+G+A AYGMCVWV+ +S YV+ + L R+Q 
Sbjct  107  VRRLGTAVAEALK-------LTKIGSVVSLIGIAAAYGMCVWVTVVSRYVMVSVLGRKQF  159

Query  632  ATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVY  453
              VQTK+Y +YFKA+  +I     GH +G+ R   + A E +   NL +++++V  N  +
Sbjct  160  GVVQTKVYAVYFKAISVAILIGLLGHVIGRRRKVITDAVEMWQVVNLFSSILLVEANASF  219

Query  452  LEPRAAKvm---------------------vermkmekeegrgmngegsgggspgmMKLS  336
            +EPRA K M                      E       +          G +  + KL+
Sbjct  220  VEPRAIKTMFERIKVEKEEGRGVDTSESHSSEAAAQTCGKKVREKTMDEDGVNHKLTKLN  279

Query  335  KRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRV  240
            +RL +LN+ SS LN+LTLM++T H  ++  R+
Sbjct  280  ERLSRLNAYSSRLNLLTLMSLTWHFVYLGHRL  311



>ref|XP_010322771.1| PREDICTED: uncharacterized protein LOC101255207 [Solanum lycopersicum]
Length=447

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 72/124 (58%), Gaps = 0/124 (0%)
 Frame = -1

Query  803  GGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATV  624
            G     D   YIFS E+  ++ G  HL+G A +YG+  W++F+SS V++ ALP+QQ A  
Sbjct  219  GRRFFSDVSAYIFSAESFRSLMGIFHLMGFALSYGVSFWMTFVSSNVMARALPKQQFAMA  278

Query  623  QTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEP  444
            Q+K+YP YFK + Y I +AF GH   Q    Y++  E   G   V  L   L N  YLEP
Sbjct  279  QSKIYPAYFKTVCYGIASAFLGHMWSQNPPYYANIGETIQGLIFVLILSATLFNCFYLEP  338

Query  443  RAAK  432
            RA+K
Sbjct  339  RASK  342


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 54/92 (59%), Gaps = 16/92 (17%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADTK----------AVVVEFEKDNNNGGGNTKVSISP  1083
             MMN+ A+SL+L  L  +G+FSPN + K           VVVE+E +++   G TKVSISP
Sbjct  1     MMNVFAISLVLTALVTAGVFSPNPEKKDDVIVKEGHRVVVVEYEPNDH---GQTKVSISP  57

Query  1082  QEAAQNSRLEKGYVLNAMEKISEKAEEVKQRF  987
              E    ++ E    ++  +KIS KAE V+++ 
Sbjct  58    PETEHKAKAEH---VSVSDKISAKAEGVEEKI  86



>gb|KEH29295.1| late embryogenesis abundant protein (LEA) family protein [Medicago 
truncatula]
 gb|KEH29297.1| late embryogenesis abundant protein (LEA) family protein [Medicago 
truncatula]
Length=441

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 73/112 (65%), Gaps = 1/112 (1%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             S E + ++    +LLG ++ YGM VW++F+SSYVLS  +PRQQ A VQ+K+YP+YF+AM
Sbjct  223  LSMERVESLMSLLNLLGFSSGYGMNVWITFVSSYVLSRVMPRQQFAVVQSKIYPVYFRAM  282

Query  587  GYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
            GY +  A  GH  G      ++       +NL+A+L+ V VN VYLEPRA K
Sbjct  283  GYCLLVALLGHVFGHG-MRNNNGGGVMQSWNLLASLLTVFVNSVYLEPRATK  333


 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 62/111 (56%), Gaps = 28/111 (25%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT----------KAVVVEFEKDNNNGGGNTKVSISP  1083
             MMN+LALSL + +L  + IFSPN             K VVVE+++D   G  NTK+SI P
Sbjct  1     MMNLLALSLFITSLTTASIFSPNPKQQPNTIVKEGHKVVVVEYDQD---GYQNTKISILP  57

Query  1082  QEAAQNSR----LEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             ++   + +    ++ G++           E  K R K+AA+VLPN+G+GIS
Sbjct  58    EQQQTHQQDYTNMDSGFI-----------ENTKDRIKEAASVLPNMGQGIS  97



>ref|XP_010431487.1| PREDICTED: uncharacterized protein LOC104715812 [Camelina sativa]
Length=516

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 3/112 (3%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             SP  + +V G   L G+A A+G CVWV+F+SSYVL++ L RQQ   VQ+KLYP+YFKA 
Sbjct  284  LSPTKVASVVG---LTGIAAAFGTCVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKAT  340

Query  587  GYSIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
               I     GH L + R   + ATE + G NL+++  M+  N  ++EPRA K
Sbjct  341  SVGILVGLLGHVLSRRRKLLTDATEMWQGVNLLSSFFMIEANKSFVEPRATK  392


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 61/115 (53%), Gaps = 28/115 (24%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNA------------------DTKAVVVEFEKDNNNGGG  1107
             MMN+LALSL+L TL A+ ++SP+                     + VVVE+++D   G  
Sbjct  1     MMNLLALSLVLSTLLAAEVWSPSPAMTTNHGAASEGDIIVKDGHRVVVVEYDRD---GKT  57

Query  1106  NTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             NT+VSISP  A Q    E+G       K     +  K+R K+ A+ LP+VG+GIS
Sbjct  58    NTRVSISPPSADQEGDNEEG-------KGGSLFKNAKERVKETASHLPHVGQGIS  105



>emb|CDY69861.1| BnaCnng65680D [Brassica napus]
Length=392

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 83/349 (24%), Positives = 153/349 (44%), Gaps = 47/349 (13%)
 Frame = -1

Query  1154  KAVVVEFEKDNNNGGGNTKVSISPQEAAQNSRLEKGYVLNAMEK----------ISEKAE  1005
             + VVVE++ D   G  NT+V +SP E  Q    ++  +   +++          +S++ E
Sbjct  35    RVVVVEYDAD---GKTNTRVLMSPPERGQEQIGDQREMFRNVKRKVIETPSSLPVSDQVE  91

Query  1004  EVKQRFKDAAAVLPN-VGE------GISGHQeeeeevketakeaaekvktaakekvtekv  846
             E ++    A  ++ + +G+       + G  ++          A                
Sbjct  92    EERELHASAGEIICDAIGKCKNKVASVLGRVDDPTAHDTKETVARAARDVKETLAHEPHF  151

Query  845   KDRRKKELKDILRRGGEVLYDAF-------EYIFSPENLTAVFGTAHLLGLATAYGMCVW  687
              D + +E +  + +   VL  A          + +  NLT V     L+G+A A+GMCVW
Sbjct  152   ADHKAQETRPTMSKSQNVLVKAKLAVKRLGTAVTAAMNLTKVGSVVSLIGIAAAFGMCVW  211

Query  686   VSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY  507
             V+ +S Y+L++ L R + +  Q+K+Y +YFKA+   +     GH + + R   + A E +
Sbjct  212   VTVVSKYLLASVLGRHRFSVAQSKVYSVYFKAISVGLLVGLLGHVISRRRKVLTDAVEMW  271

Query  506   LGFNLVAALIMVLVNLVYLEPRAAK--------------------vmvermkmekeegrg  387
                NL+++++MV  N  ++EPRA K                                 + 
Sbjct  272   QAVNLLSSILMVEANASFVEPRAIKAMFERIKVEKEEGRGLDKSESHSSEAAARTCGKKV  331

Query  386   mngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRV  240
                      +  + KL++RL +LN+ SS LN+LTLM++T H  ++  R+
Sbjct  332   RYNMDEDAVNRRLKKLNERLSRLNAYSSRLNLLTLMSLTWHFVYLGHRL  380



>emb|CAH66906.1| H0823A09.7 [Oryza sativa Indica Group]
 emb|CAH67298.1| OSIGBa0102D10.1 [Oryza sativa Indica Group]
Length=524

 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 66/102 (65%), Gaps = 9/102 (9%)
 Frame = -1

Query  824  LKDILRRGGEVLYDAFEYIF------SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYV  663
            L DI RR  +V  DA  ++       +    TAV    HLLG A AYG  +WV+F+SSYV
Sbjct  278  LSDIARRARDVASDAAAHLLGGGPREAARTATAVM---HLLGFAAAYGASLWVTFVSSYV  334

Query  662  LSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR  537
            L+ ALPRQQ+A VQ+KL+P+YF+A+ Y +G A + H LG+ R
Sbjct  335  LAAALPRQQLAMVQSKLFPMYFRAVAYGVGLALAAHLLGRER  376



>emb|CAD41023.1| OSJNBb0086G13.7 [Oryza sativa Japonica Group]
 emb|CAE03212.2| OSJNBa0088K19.14 [Oryza sativa Japonica Group]
Length=524

 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 66/102 (65%), Gaps = 9/102 (9%)
 Frame = -1

Query  824  LKDILRRGGEVLYDAFEYIF------SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYV  663
            L DI RR  +V  DA  ++       +    TAV    HLLG A AYG  +WV+F+SSYV
Sbjct  278  LSDIARRARDVASDAAAHLLGGGPREAARTATAVM---HLLGFAAAYGASLWVTFVSSYV  334

Query  662  LSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR  537
            L+ ALPRQQ+A VQ+KL+P+YF+A+ Y +G A + H LG+ R
Sbjct  335  LAAALPRQQLAMVQSKLFPMYFRAVAYGVGLALAAHLLGRER  376



>gb|EAY94192.1| hypothetical protein OsI_15966 [Oryza sativa Indica Group]
Length=524

 Score =   104 bits (260),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 66/102 (65%), Gaps = 9/102 (9%)
 Frame = -1

Query  824  LKDILRRGGEVLYDAFEYIF------SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYV  663
            L DI RR  +V  DA  ++       +    TAV    HLLG A AYG  +WV+F+SSYV
Sbjct  278  LSDIARRARDVASDAAAHLLGGGPREAARTATAVM---HLLGFAAAYGASLWVTFVSSYV  334

Query  662  LSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR  537
            L+ ALPRQQ+A VQ+KL+P+YF+A+ Y +G A + H LG+ R
Sbjct  335  LAAALPRQQLAMVQSKLFPMYFRAVAYGVGLALAAHLLGRER  376



>ref|XP_010477518.1| PREDICTED: uncharacterized protein LOC104756605 [Camelina sativa]
Length=341

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 68/107 (64%), Gaps = 0/107 (0%)
 Frame = -1

Query  752  LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIG  573
            L+ +     L+G+A AYGMCVWV+F+S YVL + L R Q   VQ+K+YP+YFKA+   I 
Sbjct  186  LSKIGSVVGLVGIAAAYGMCVWVTFVSGYVLGSVLGRHQFGVVQSKMYPVYFKAVSVGIL  245

Query  572  AAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
             A  GH + + R  ++ A + +   NL+++++MV  N  +++PR  K
Sbjct  246  IALLGHVISRRRKVFTDAVDMWQAVNLLSSILMVEANASFVDPRVTK  292



>ref|XP_009103229.1| PREDICTED: uncharacterized protein LOC103829321 [Brassica rapa]
Length=384

 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 94/192 (49%), Gaps = 20/192 (10%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            N T V     L+G+A A+GMCVWV+ ++ Y+L++ L R +    Q+K+Y +YFKA+   +
Sbjct  189  NPTKVGSVVSLIGIAAAFGMCVWVTVVTKYLLASVLGRHRFGVAQSKVYSVYFKAISVGL  248

Query  575  GAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK------------  432
                 GH + Q R   + A E +   NL+++++MV  N  ++EPR  K            
Sbjct  249  LVGLLGHVISQRRKVLTDAVEMWQAVNLLSSILMVEANASFVEPRVIKAMFERIKVEKEE  308

Query  431  --------vmvermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMA  276
                                 +          +  + KL++RL +LN+ SS LN+LTLM+
Sbjct  309  GRGLDKSESHSSEAAARTCGKKVRYNMDEDAVNRRLKKLNERLSRLNAYSSRLNLLTLMS  368

Query  275  MTLHLAHIAQRV  240
            +T H  ++  R+
Sbjct  369  LTWHFVYLGHRL  380



>emb|CDY25745.1| BnaA07g10370D [Brassica napus]
Length=384

 Score =   102 bits (254),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 94/192 (49%), Gaps = 20/192 (10%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            N T V     L+G+A A+GMCVWV+ ++ Y+L++ L R +    Q+K+Y +YFKA+   +
Sbjct  189  NPTKVGSVVSLIGIAAAFGMCVWVTVVTKYLLASVLGRHRFGVAQSKVYSVYFKAISVGL  248

Query  575  GAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK------------  432
                 GH + Q R   + A E +   NL+++++MV  N  ++EPR  K            
Sbjct  249  LVGLLGHVISQRRKVLTDAVEMWQAVNLLSSILMVEANASFVEPRVIKAMFERIKVEKEE  308

Query  431  --------vmvermkmekeegrgmngegsgggspgmMKLSKRLKKLNSQSSFLNVLTLMA  276
                                 +          +  + KL++RL +LN+ SS LN+LTLM+
Sbjct  309  GRGLDKSESHSSEAAARTCGKKVRYNMDEDAVNRRLKKLNERLSRLNAYSSRLNLLTLMS  368

Query  275  MTLHLAHIAQRV  240
            +T H  ++  R+
Sbjct  369  LTWHFVYLGHRL  380



>ref|XP_008663208.1| PREDICTED: transmembrane protein 205-like [Zea mays]
Length=217

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 74/99 (75%), Gaps = 3/99 (3%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HLLG ATAYG CVWV+F+SS+VL+ ALPRQQ+  VQ+KL+P+YF+A+ Y +G A + H L
Sbjct  2    HLLGFATAYGACVWVTFVSSHVLAAALPRQQLGVVQSKLFPVYFRALAYGVGLALAAHLL  61

Query  548  GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
            G+ R   +S  ++    NL+AAL +VL N++ LEP+A +
Sbjct  62   GRERGSLASRAQSL---NLLAALGLVLANMLLLEPKATR  97


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = -1

Query  344  KLSKRLKKLNSQSSFLNVLTLMAMTLHLAHIAQRVH--TVC  228
            +LS+RLK+LN  SS  NVL LM++T HL H+A+R+H  T C
Sbjct  177  RLSRRLKQLNGYSSLCNVLCLMSLTWHLVHLARRLHAGTAC  217



>ref|XP_010682507.1| PREDICTED: uncharacterized protein LOC104897327 [Beta vulgaris 
subsp. vulgaris]
Length=423

 Score = 96.7 bits (239),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 2/96 (2%)
 Frame = -1

Query  824  LKDILRRGGEVLYDAFEYIFS--PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            L DI++RG EVL+D   Y+F    E L+ +   + L+G++ AYG+ +WV+F+ S+VL+  
Sbjct  176  LFDIVKRGKEVLFDVIWYVFGMGREILSLIMSVSELIGMSIAYGVGIWVTFVMSHVLAGV  235

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQ  543
            LPRQQ   VQ+K+YP+YFK M  SIG +  G+ +G+
Sbjct  236  LPRQQFGIVQSKIYPVYFKVMIGSIGLSLVGYMMGE  271



>ref|XP_004299879.1| PREDICTED: uncharacterized protein LOC101292414 [Fragaria vesca 
subsp. vesca]
Length=573

 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 59/98 (60%), Gaps = 0/98 (0%)
 Frame = -1

Query  725  LLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLG  546
            L G ATAYGM +W++F SSYVLS  L   Q   VQ+K+Y +YF AM  ++G A  GH L 
Sbjct  375  LFGFATAYGMSMWITFASSYVLSRVLSPYQFGMVQSKIYKVYFAAMANTVGMALLGHLLN  434

Query  545  QTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
              R       +A   +NL+   +MVL N+ YLEP++ K
Sbjct  435  PRRKLTGRNVDALQNYNLMLVELMVLFNMFYLEPKSTK  472



>ref|XP_010474290.1| PREDICTED: uncharacterized protein LOC104753790, partial [Camelina 
sativa]
Length=362

 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = -1

Query  767  FSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
             SP  + +V G   L G+A A+G CVWV+F+SSYVL++ L RQQ   VQ+KLYP+YFKA 
Sbjct  284  LSPTKVASVVG---LTGIAAAFGTCVWVTFVSSYVLASVLGRQQFGVVQSKLYPVYFKAT  340

Query  587  GYSIGAAFSGHFLGQTR  537
               I     GH L + R
Sbjct  341  SVGILVGLLGHVLSRRR  357


 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 60/115 (52%), Gaps = 28/115 (24%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNA------------------DTKAVVVEFEKDNNNGGG  1107
             M N+LALSL+L TL A+ ++SP+                     + VVVE+++D   G  
Sbjct  1     MTNLLALSLVLSTLLAAEVWSPSPAMTTNHGAASQGDIIVKDGHRVVVVEYDRD---GKT  57

Query  1106  NTKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGIS  942
             NT+VSISP  A Q    E+G       K     +  K+R K+ A+ LP+VG+GIS
Sbjct  58    NTRVSISPPSADQEGDNEEG-------KGGSLFKNAKERVKETASHLPHVGQGIS  105



>gb|KDO38275.1| hypothetical protein CISIN_1g037813mg, partial [Citrus sinensis]
Length=371

 Score = 80.1 bits (196),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = -1

Query  800  GEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQ  621
            G+  Y    Y+  PE L A+ G  +LLG +TAYGM VWV+FISSYVL+ ALPR Q   VQ
Sbjct  307  GQYSYGFLRYLGIPETLNALMGVINLLGFSTAYGMSVWVTFISSYVLAGALPRHQFGMVQ  366

Query  620  TKLYP  606
            +K+YP
Sbjct  367  SKIYP  371



>gb|EYU22791.1| hypothetical protein MIMGU_mgv11b021530mg [Erythranthe guttata]
Length=171

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 69/109 (63%), Gaps = 19/109 (17%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNADT-------------KAVVVEFEKDNNNGGGNTKVS  1092
             MMN+LAL L+L +L  +G F+P+ +              + +VVE+EKD+    GNTKVS
Sbjct  1     MMNVLALGLVLTSLVTAGFFTPSPENQKLKDDVIVKEGHRVIVVEYEKDD----GNTKVS  56

Query  1091  ISPQEAAQNSRL-EKGYVLNAMEKISEKAEEVKQRFKDA-AAVLPNVGE  951
             ISPQ++    ++ EKG+  N ++K+SE+ E  K+  K+A ++++P VGE
Sbjct  57    ISPQDSQAPHKVGEKGFASNVLDKMSERMENAKEGIKEASSSIIPEVGE  105



>ref|XP_004495913.1| PREDICTED: transmembrane protein 205-like [Cicer arietinum]
Length=208

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 66/125 (53%), Gaps = 10/125 (8%)
 Frame = -1

Query  794  VLYDAFEYIFSPENL----TAV---FGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQ  636
            V++ A   IFSPE      TA+      AHLLG + A+G  +WV+FI   ++   LPR Q
Sbjct  11   VVFLAVGVIFSPETFGSKSTAISTYLKLAHLLGFSIAFGAALWVTFIGGIIMFKNLPRHQ  70

Query  635  IATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNL  459
               +Q+K++P YF  +G  I  A +  F     W  SS TE Y LGF L+++L   L NL
Sbjct  71   FGNLQSKMFPAYFSMVGVCIAVAVAS-FGYLHPWKTSSTTEKYQLGF-LLSSLAFNLANL  128

Query  458  VYLEP  444
                P
Sbjct  129  FVFTP  133



>ref|XP_002989961.1| hypothetical protein SELMODRAFT_428422 [Selaginella moellendorffii]
 gb|EFJ08974.1| hypothetical protein SELMODRAFT_428422 [Selaginella moellendorffii]
Length=544

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (58%), Gaps = 1/99 (1%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HL   ++ +G  +WV+FIS +VLS  + R Q A VQ+K++P+YF+ +G  I    + H L
Sbjct  371  HLFLFSSTFGSALWVTFISGFVLSNNISRHQFALVQSKIFPVYFRIVGSGIALLLATHIL  430

Query  548  GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
              +  P +  +E    +NL   L++ L+N   LEPR  K
Sbjct  431  LHSP-PGAHLSELLQCYNLAGCLVVTLLNTFLLEPRLTK  468



>ref|XP_002968913.1| hypothetical protein SELMODRAFT_440470 [Selaginella moellendorffii]
 gb|EFJ30029.1| hypothetical protein SELMODRAFT_440470 [Selaginella moellendorffii]
Length=544

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 57/99 (58%), Gaps = 1/99 (1%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HL   ++ +G  +WV+FIS +VLS  + R Q A VQ+K++P+YF+ +G  I    + H L
Sbjct  371  HLFLFSSTFGSALWVTFISGFVLSNNISRHQFALVQSKIFPVYFRIVGSGIALLLATHIL  430

Query  548  GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
              +  P +  +E    +NL   L++ L+N   LEPR  K
Sbjct  431  LHSP-PGAHLSELLQCYNLAGCLVVTLLNTFLLEPRLTK  468



>ref|XP_003591427.1| Transmembrane protein [Medicago truncatula]
 gb|AES61678.1| late embryogenesis abundant protein (LEA) family protein [Medicago 
truncatula]
Length=208

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 64/125 (51%), Gaps = 10/125 (8%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN-------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQ  636
            V++ A   IFSPE        L+     AHLLG + A+G  +WV+FI   ++   LPR Q
Sbjct  11   VVFLAIGVIFSPETFGSKSTTLSTYIKLAHLLGFSIAFGAALWVTFIGGIIMFKNLPRHQ  70

Query  635  IATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNL  459
               +Q+K++P YF  +G  I    +  F     W  SS ++ Y LGF L++AL   L NL
Sbjct  71   FGNLQSKMFPAYFSMVGVCIAVTVAS-FGYLHPWKTSSTSQRYQLGF-LISALAFNLTNL  128

Query  458  VYLEP  444
                P
Sbjct  129  FVFTP  133



>gb|AFK35536.1| unknown [Medicago truncatula]
Length=235

 Score = 71.6 bits (174),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 64/125 (51%), Gaps = 10/125 (8%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN-------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQ  636
            V++ A   IFSPE        L+     AHLLG + A+G  +WV+FI   ++   LPR Q
Sbjct  11   VVFLAIGVIFSPETFGSKSTTLSTYIKLAHLLGFSIAFGAALWVTFIGGIIMFKNLPRHQ  70

Query  635  IATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNL  459
               +Q+K++P YF  +G  I A     F     W  SS ++ Y LGF L++AL   L NL
Sbjct  71   FGNLQSKMFPAYFSMVGVCI-AVTEASFGYLHPWKTSSTSQRYQLGF-LISALAFNLTNL  128

Query  458  VYLEP  444
                P
Sbjct  129  FVFTP  133



>ref|XP_002275502.1| PREDICTED: transmembrane protein 205 [Vitis vinifera]
 emb|CAN73725.1| hypothetical protein VITISV_016653 [Vitis vinifera]
 emb|CBI36931.3| unnamed protein product [Vitis vinifera]
Length=213

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 64/133 (48%), Gaps = 17/133 (13%)
 Frame = -1

Query  800  GEVLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLS  657
            G V + A   IFSPE             LTA    AHLL  ATA+G  +WV+FI   ++ 
Sbjct  9    GAVTFLAVGVIFSPETFGSKSDGSHSSKLTAALKLAHLLCFATAWGAALWVTFIGGIIMF  68

Query  656  TALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAA  483
              LPR     +Q+K++P YF  +G  +  A S    G    W  SS  E Y LGF L++A
Sbjct  69   KNLPRHTFGNLQSKMFPAYFSMVG--VCCAVSTASFGYLHPWKSSSTAEKYQLGF-LLSA  125

Query  482  LIMVLVNLVYLEP  444
                L NL+   P
Sbjct  126  FAFNLTNLLVFTP  138



>ref|XP_010038275.1| PREDICTED: transmembrane protein 205-like [Eucalyptus grandis]
 gb|KCW50099.1| hypothetical protein EUGRSUZ_K03533 [Eucalyptus grandis]
Length=213

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 64/131 (49%), Gaps = 17/131 (13%)
 Frame = -1

Query  794  VLYDAFEYIFSPENL------------TAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE                +   AHLLG ATA+G  +WV+FI   ++   
Sbjct  11   VAFLAVGVIFSPETFGSTSDGSKSPTAATLLKLAHLLGFATAWGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAALI  477
            LPR Q   +Q+K++P YF  +G  +  A S    G    W  SS+TE Y LGF L++A  
Sbjct  71   LPRHQFGNLQSKMFPAYFTMVG--VCCAMSVASFGYLHPWKSSSSTEKYQLGF-LLSAFA  127

Query  476  MVLVNLVYLEP  444
              L NL    P
Sbjct  128  FNLTNLFVFTP  138



>ref|XP_007145160.1| hypothetical protein PHAVU_007G215400g [Phaseolus vulgaris]
 gb|ESW17154.1| hypothetical protein PHAVU_007G215400g [Phaseolus vulgaris]
Length=208

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 66/127 (52%), Gaps = 14/127 (11%)
 Frame = -1

Query  794  VLYDAFEYIFSPENLTAVFGT-------AHLLGLATAYGMCVWVSFISSYVLSTALPRQQ  636
            V + A   IFSPE LT+   T       AHLL  +TA+G  +WV+FI   ++   LPR Q
Sbjct  11   VAFLAIGVIFSPETLTSKSTTLSTYLKLAHLLSFSTAFGAALWVTFIGGIIMFKNLPRHQ  70

Query  635  IATVQTKLYPLYFKAMG--YSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLV  465
               +Q+K++P YF  +G   +I  A  G+      W  SS TE Y LGF L+++    L 
Sbjct  71   FGNLQSKMFPAYFSMVGACCAISVASFGYL---HPWKTSSTTERYQLGF-LLSSFAFNLT  126

Query  464  NLVYLEP  444
            NL    P
Sbjct  127  NLFVFTP  133



>ref|XP_010559194.1| PREDICTED: transmembrane protein 205-like [Tarenaya hassleriana]
Length=213

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 5/109 (5%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P  +TA+   AHLL  +TA+G  +WV+FI   ++   LPR Q   +Q+K++P YF  +G
Sbjct  33   NPAKVTALLKLAHLLSFSTAWGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFTLVG  92

Query  584  YSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
              I  A S    G    W  SSA E Y LGF L++A    L NL+   P
Sbjct  93   --ICCAISLAAFGYLHPWKSSSAVEKYQLGF-LLSAFAFNLSNLLVFTP  138



>ref|XP_010521444.1| PREDICTED: transmembrane protein 205-like [Tarenaya hassleriana]
Length=213

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 60/109 (55%), Gaps = 5/109 (5%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P  +TA+   AHLL  +TA+G  +WV+FI   ++   LPR Q   +Q+K++P YF  +G
Sbjct  33   NPAKVTALLKLAHLLSFSTAWGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFTLVG  92

Query  584  YSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
              I  A S    G    W  SSA E Y LGF L++A    L NL+   P
Sbjct  93   --ICCAISLAAFGYLHPWKSSSAVEKYQLGF-LLSAFAFNLSNLLVFTP  138



>gb|KHG21214.1| Transmembrane protein [Gossypium arboreum]
Length=213

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 69/139 (50%), Gaps = 19/139 (14%)
 Frame = -1

Query  815  ILRRGGEVLYDAFEYIFSPE------------NLTAVFGTAHLLGLATAYGMCVWVSFIS  672
            I R    V + A   IFSPE            NL++    AHLL  +TA+G  +WV+FI 
Sbjct  4    ITRFLTAVAFLAVGVIFSPETFGSQSDGTKSPNLSSFIKLAHLLSFSTAWGAALWVTFIG  63

Query  671  SYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSAT--EAY-LG  501
              ++   LPR Q   +Q+K++P YF  +G  +  A S    G    P+ SAT  E Y LG
Sbjct  64   GIIMFKNLPRHQFGNLQSKMFPAYFSMVG--VCCAISVAAFGYLH-PWKSATMPEKYQLG  120

Query  500  FNLVAALIMVLVNLVYLEP  444
            F LV+A +  L NL    P
Sbjct  121  F-LVSAFVFNLSNLFVFTP  138



>gb|EYU46797.1| hypothetical protein MIMGU_mgv1a013677mg [Erythranthe guttata]
Length=213

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 63/130 (48%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPENLTA------------VFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE   +            V   A+LL  +TA+G  +WV+FI   ++   
Sbjct  11   VAFLAIGVIFSPETFGSKSDGQKSPMFLTVLKLAYLLCFSTAWGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     A  G F     W  S ATE Y LGF L+AA   
Sbjct  71   LPRHQFGNLQSKMFPAYFSMVGVCCAVA-VGSFGYLHPWKTSGATEKYQLGF-LLAAFAF  128

Query  473  VLVNLVYLEP  444
             L NLV   P
Sbjct  129  NLSNLVIFTP  138



>gb|AHF21581.1| late embryogenesis abundant protein [Tamarix hispida]
Length=212

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 62/129 (48%), Gaps = 14/129 (11%)
 Frame = -1

Query  794  VLYDAFEYIFSPE-----------NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTAL  648
            V + A   IFSPE           NL  +    HLL  ATA+G  +WV+FI   ++   L
Sbjct  11   VAFLAVGIIFSPETFGSSNSFNSPNLLTILKLTHLLCFATAWGAALWVTFIGGIIMFKNL  70

Query  647  PRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMV  471
            PR Q   +Q+K++P YF  +G     +  G F     W  SS TE Y LGF L +A    
Sbjct  71   PRHQFGNLQSKMFPAYFILVGVCCALSM-GSFGYLHPWKLSSTTEQYQLGF-LASAFGFN  128

Query  470  LVNLVYLEP  444
            L+NL    P
Sbjct  129  LLNLFVFTP  137



>ref|XP_011079574.1| PREDICTED: transmembrane protein 205 [Sesamum indicum]
Length=213

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 61/130 (47%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L  +   AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VAFLAVGVIFSPETFGSKSDGYNSPLLITLLKLAHLLCFSTAWGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     A  G F     W  S A E Y LGF LV A   
Sbjct  71   LPRHQFGNLQSKMFPAYFSMVGVCCAIA-VGAFGYLHPWKTSGAAEKYQLGF-LVTAFAF  128

Query  473  VLVNLVYLEP  444
             L NL+   P
Sbjct  129  NLSNLIIFTP  138



>gb|KHF99197.1| Transmembrane protein [Gossypium arboreum]
Length=213

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 64/131 (49%), Gaps = 17/131 (13%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  ATA+G  +WV+FI   ++   
Sbjct  11   VAFFAVGVIFSPETFGSKSDDSISPILSTSIKLAHLLCFATAWGTALWVTFIGGILMFKY  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAALI  477
            LPR Q   +Q+K++P YF  +G  +  A S    G    W  ++ TE Y LGF LV+A  
Sbjct  71   LPRHQFGNLQSKMFPAYFSMVG--VCCAVSAAAFGYMHPWKSATTTEKYQLGF-LVSAFA  127

Query  476  MVLVNLVYLEP  444
              L+NL    P
Sbjct  128  FNLINLFVFTP  138



>ref|XP_008386731.1| PREDICTED: transmembrane protein 205 [Malus domestica]
Length=213

 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 64/130 (49%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VAFLAIGVIFSPETFGSKSDGLKSPTLSTYLKLAHLLCFSTAFGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G  +  + +G F     W  SS T+ Y LGF L+++   
Sbjct  71   LPRHQFGNLQSKMFPAYFTMVGICLAVS-AGSFGYLHPWSSSSVTDKYQLGF-LLSSFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLTNLFVFTP  138



>ref|XP_002967473.1| hypothetical protein SELMODRAFT_169057 [Selaginella moellendorffii]
 gb|EFJ32072.1| hypothetical protein SELMODRAFT_169057 [Selaginella moellendorffii]
Length=216

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (55%), Gaps = 1/99 (1%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HLLG ATA+G  +WV+FI   ++   LPR Q   +Q+KL+P+YF+ +     A   G F 
Sbjct  48   HLLGFATAWGTSLWVTFIGGIIMFKHLPRHQFGNLQSKLFPVYFEMLAVCSTACI-GAFS  106

Query  548  GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
                W  S++ E      LV +L+  L+NL+  EP   K
Sbjct  107  LLHPWGSSTSAEKMQLGALVFSLMATLLNLLVFEPMTIK  145



>ref|XP_004300464.1| PREDICTED: transmembrane protein 205-like [Fragaria vesca subsp. 
vesca]
Length=213

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 66/137 (48%), Gaps = 19/137 (14%)
 Frame = -1

Query  809  RRGGEVLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSY  666
            R    V + A   IFSPE             L+     AHLL  ATA+G  +WV+FI   
Sbjct  6    RSLAAVAFLAIGVIFSPETFGSKSDGPKSPALSTYLKLAHLLSFATAFGAALWVTFIGGI  65

Query  665  VLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEA---YLGFN  495
            ++   LPR Q   +Q+K++P YF  +G  I  A S    G    P+SS+T A    LGF 
Sbjct  66   IMFKNLPRHQFGNLQSKMFPAYFTMVG--ICCAISVASFGYLH-PWSSSTVADKYQLGF-  121

Query  494  LVAALIMVLVNLVYLEP  444
            L+++L   L NL    P
Sbjct  122  LISSLAFNLTNLFVFTP  138



>ref|NP_001235713.1| uncharacterized protein LOC100305973 [Glycine max]
 gb|ACU13921.1| unknown [Glycine max]
 gb|KHN30649.1| Transmembrane protein 205 [Glycine soja]
Length=208

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 62/125 (50%), Gaps = 10/125 (8%)
 Frame = -1

Query  794  VLYDAFEYIFSPENL-------TAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQ  636
            V + A   IFSPE L       +     AHLL  +TA+G  +WV+FI   ++   LPR Q
Sbjct  11   VAFLAIGVIFSPETLGSKSTTLSTYLKLAHLLCFSTAFGAALWVTFIGGIIMFKNLPRHQ  70

Query  635  IATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNL  459
               +Q+K++P YF  +G     + +  F     W  SS TE Y LGF L+++    L NL
Sbjct  71   FGNLQSKMFPAYFSMVGVCCAVSVAS-FGYLHPWKTSSTTERYQLGF-LLSSFAFNLTNL  128

Query  458  VYLEP  444
                P
Sbjct  129  FVFTP  133



>ref|XP_002960240.1| hypothetical protein SELMODRAFT_139492 [Selaginella moellendorffii]
 gb|EFJ37779.1| hypothetical protein SELMODRAFT_139492 [Selaginella moellendorffii]
Length=216

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 54/99 (55%), Gaps = 1/99 (1%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HLLG ATA+G  +WV+FI   ++   LPR Q   +Q+KL+P+YF+ +     A   G F 
Sbjct  48   HLLGFATAWGTSLWVTFIGGIIMFKHLPRHQFGNLQSKLFPVYFELLAVCSTACI-GAFS  106

Query  548  GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
                W  S++ E      LV +L+  L+NL+  EP   K
Sbjct  107  LLHPWGSSTSAEKMQLGALVFSLVGTLLNLLVFEPMTIK  145



>ref|XP_004229403.1| PREDICTED: transmembrane protein 205 [Solanum lycopersicum]
Length=213

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 3/107 (3%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGY  582
            P  L      AHLL  +TA+G  +WV+FI   ++   LPR Q   +Q+K++P YF  +G 
Sbjct  34   PPKLATFLKLAHLLCFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGV  93

Query  581  SIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
                +  G F     W  +SA+E Y LGF ++AA    L NL    P
Sbjct  94   CCAVS-VGSFGYLHPWKTASASEKYQLGF-ILAAFAFNLSNLFVFTP  138



>gb|KCW50100.1| hypothetical protein EUGRSUZ_K03533 [Eucalyptus grandis]
Length=214

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 65/132 (49%), Gaps = 18/132 (14%)
 Frame = -1

Query  794  VLYDAFEYIFSPENL------------TAVFGTAHLLGLATAYGMCVWVSFISSYVL-ST  654
            V + A   IFSPE                +   AHLLG ATA+G  +WV+FI   ++ + 
Sbjct  11   VAFLAVGVIFSPETFGSTSDGSKSPTAATLLKLAHLLGFATAWGAALWVTFIGGIIMFNR  70

Query  653  ALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAAL  480
             LPR Q   +Q+K++P YF  +G  +  A S    G    W  SS+TE Y LGF L++A 
Sbjct  71   NLPRHQFGNLQSKMFPAYFTMVG--VCCAMSVASFGYLHPWKSSSSTEKYQLGF-LLSAF  127

Query  479  IMVLVNLVYLEP  444
               L NL    P
Sbjct  128  AFNLTNLFVFTP  139



>ref|XP_010468945.1| PREDICTED: transmembrane protein 205-like [Camelina sativa]
Length=213

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 61/130 (47%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  ATA+G  +W +FI   ++   
Sbjct  11   VAFLAVGVIFSPETFGSLSNGENSAKLSIFLKLAHLLSFATAWGAALWATFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     + S  F     W  SSA E Y LGF L++A   
Sbjct  71   LPRHQFGNLQSKMFPAYFTLVGSCCAISLSA-FGYLHPWKSSSAVEKYQLGF-LLSAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLTNLFVFTP  138



>ref|XP_009594998.1| PREDICTED: transmembrane protein 205 [Nicotiana tomentosiformis]
Length=213

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V++ A   +FSPE             L  +   AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VVFLAIGVLFSPETFGSKSEGQHPPKLVTLLKLAHLLCFSTAFGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     +  G F     W  +SA E Y LGF ++AA   
Sbjct  71   LPRHQFGNLQSKMFPAYFSMVGVCCAVS-VGSFGYLHPWKAASAAEKYQLGF-ILAAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLSNLFVFTP  138



>ref|XP_008345233.1| PREDICTED: transmembrane protein 205-like [Malus domestica]
Length=213

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VAFLAIGVIFSPETFGSKSDGLKSPTLSTYLKLAHLLCFSTAFGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G  +  + +G F     W  SS  + Y LGF L++A   
Sbjct  71   LPRHQFGNLQSKMFPAYFTMVGICLAVS-AGSFGYLHPWSSSSVADKYQLGF-LLSAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLTNLFVFTP  138



>ref|XP_006444466.1| hypothetical protein CICLE_v10022218mg [Citrus clementina]
 ref|XP_006492313.1| PREDICTED: transmembrane protein 205-like [Citrus sinensis]
 gb|ESR57706.1| hypothetical protein CICLE_v10022218mg [Citrus clementina]
 gb|KDO87038.1| hypothetical protein CISIN_1g028150mg [Citrus sinensis]
Length=213

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 61/130 (47%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VAFLAIGVIFSPETFGSKSDGLNSSKLSPFLKLAHLLCFSTAWGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     A +  F     W  SS  E Y LGF L++A   
Sbjct  71   LPRHQFGNLQSKMFPAYFSLVGVCCSIAVAS-FAYLHPWKSSSTAEKYQLGF-LLSAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLTNLFVFTP  138



>ref|XP_008369056.1| PREDICTED: transmembrane protein 205-like [Malus domestica]
Length=213

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VAFLAIGVIFSPETFGSKSDGLKSPTLSTYLKLAHLLCFSTAFGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G  +  + +G F     W  SS  + Y LGF L++A   
Sbjct  71   LPRHQFGNLQSKMFPAYFTMVGICLAVS-AGSFGYLHPWSSSSVADKYQLGF-LLSAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLTNLFVFTP  138



>ref|XP_009788476.1| PREDICTED: transmembrane protein 205 [Nicotiana sylvestris]
Length=213

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 3/107 (3%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGY  582
            P  L  +   AHLL  +TA+G  +WV+FI   ++   LPR Q   +Q+K++P YF  +G 
Sbjct  34   PPKLVTLLKLAHLLCFSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGV  93

Query  581  SIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
                +  G F     W  +SA E Y LGF ++AA    L NL    P
Sbjct  94   CCAVS-VGSFGYLHPWKAASAAEKYQLGF-ILAAFAFNLSNLFVFTP  138



>ref|XP_009378694.1| PREDICTED: transmembrane protein 205-like isoform X1 [Pyrus x 
bretschneideri]
Length=213

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 64/130 (49%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VAFLAIGVIFSPETFGSKSHGLKSPILSTYLKLAHLLCFSTAFGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G  +  + +G F     W  SS  + Y LGF L+++L  
Sbjct  71   LPRHQFGNLQSKMFPAYFTMVGICLAVS-AGSFGYLHPWSSSSVADKYQLGF-LLSSLSF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLTNLFVFTP  138



>gb|KDP28239.1| hypothetical protein JCGZ_14010 [Jatropha curcas]
Length=209

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 62/126 (49%), Gaps = 11/126 (9%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN--------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQ  639
            V + A   IFSPE         L+     AHLL  +TA+G  +WV+FI   ++   LPR 
Sbjct  11   VAFLAIGVIFSPETFGSKSVSQLSTYLKLAHLLSFSTAFGAALWVTFIGGIIMFKNLPRH  70

Query  638  QIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVN  462
            Q   +Q+K++P YF  +G     +  G F     W  +S  E Y LGF L+++L   L N
Sbjct  71   QFGNLQSKMFPAYFWLVGVCCATS-VGSFGYLHPWKSASTAEKYQLGF-LLSSLAFNLAN  128

Query  461  LVYLEP  444
            L    P
Sbjct  129  LFVFTP  134



>ref|XP_006349201.1| PREDICTED: transmembrane protein 205-like [Solanum tuberosum]
Length=213

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 55/107 (51%), Gaps = 3/107 (3%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGY  582
            P  L      AHLL  +TA+G  +WV+FI   ++   LPR Q   +Q+K++P YF  +G 
Sbjct  34   PPKLATFLKLAHLLCYSTAFGAALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFSMVGV  93

Query  581  SIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
                +  G F     W  +SA+E Y LGF ++AA    L NL    P
Sbjct  94   CCAVS-VGSFGYLHPWKTASASEKYQLGF-ILAAFAFNLSNLFVFTP  138



>ref|XP_005405712.1| PREDICTED: transmembrane protein 205 isoform X1 [Chinchilla lanigera]
 ref|XP_005405713.1| PREDICTED: transmembrane protein 205 isoform X2 [Chinchilla lanigera]
 ref|XP_005405714.1| PREDICTED: transmembrane protein 205 isoform X3 [Chinchilla lanigera]
 ref|XP_005405715.1| PREDICTED: transmembrane protein 205 isoform X4 [Chinchilla lanigera]
 ref|XP_005405716.1| PREDICTED: transmembrane protein 205 isoform X5 [Chinchilla lanigera]
Length=189

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 55/100 (55%), Gaps = 5/100 (5%)
 Frame = -1

Query  734  TAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGH  555
             AHLL L+ A+GM +WV+F+S ++L   LPR     VQ++L+PLYF     S+G AF   
Sbjct  13   VAHLLVLSGAWGMQMWVTFVSGFLLFRNLPRHTFGLVQSRLFPLYFH---ISVGCAFVNL  69

Query  554  FLG--QTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
                 Q  W   +  EA     L  +L++  +N  +LEPR
Sbjct  70   CTAASQRAWVQFTFWEASQCCLLFLSLVLAAINARWLEPR  109



>ref|XP_007051074.1| Late embryogenesis abundant protein (LEA) family protein [Theobroma 
cacao]
 gb|EOX95231.1| Late embryogenesis abundant protein (LEA) family protein [Theobroma 
cacao]
Length=213

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 64/139 (46%), Gaps = 19/139 (14%)
 Frame = -1

Query  815  ILRRGGEVLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFIS  672
            I R    V + A   IFSPE             L+     AHLL  ATA+G  +WV+FI 
Sbjct  4    ITRFLTAVAFLAVGVIFSPETFGSKLDGPNSPKLSTFIKLAHLLSFATAWGAALWVTFIG  63

Query  671  SYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEA---YLG  501
              ++   LPR Q   +Q+K++P YF  +G     A +    G    P+ SAT A    LG
Sbjct  64   GIIMFKNLPRHQFGNLQSKMFPAYFSMVGVCCAIAVAA--FGYLH-PWKSATTAEKYQLG  120

Query  500  FNLVAALIMVLVNLVYLEP  444
            F LV+     L NL+   P
Sbjct  121  F-LVSGFAFNLSNLLVFTP  138



>ref|XP_010413270.1| PREDICTED: transmembrane protein 205-like isoform X1 [Camelina 
sativa]
 ref|XP_010413271.1| PREDICTED: transmembrane protein 205-like isoform X2 [Camelina 
sativa]
Length=213

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 61/130 (47%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  ATA+G  +W +F+   ++   
Sbjct  11   VAFLAVGVIFSPETFGSLSNGENSAKLSIFLKLAHLLSFATAWGAALWATFVGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     + S  F     W  SSA E Y LGF L++A   
Sbjct  71   LPRHQFGNLQSKMFPAYFTLVGSCCAISLSA-FGYLHPWKSSSAVEKYQLGF-LLSAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLTNLFVFTP  138



>gb|AFK37222.1| unknown [Lotus japonicus]
Length=208

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 10/125 (8%)
 Frame = -1

Query  794  VLYDAFEYIFSPENL-------TAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQ  636
            V + A   +FSPE L       +     AHLL  +TA+G  +WV+FI   ++   LPR Q
Sbjct  11   VTFLAVGVLFSPETLASKSTALSTYLKLAHLLSFSTAFGSALWVTFIGGIIMFKNLPRHQ  70

Query  635  IATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNL  459
               +Q+K++P YF  +G + GA     F     W  +S +E Y LGF L+++    L NL
Sbjct  71   FGNLQSKMFPAYFSLVG-TCGAIAVASFGYLHPWKTASTSERYQLGF-LLSSFAFNLTNL  128

Query  458  VYLEP  444
                P
Sbjct  129  FVFTP  133



>ref|XP_009339789.1| PREDICTED: transmembrane protein 205 [Pyrus x bretschneideri]
Length=213

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 63/130 (48%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VAFLAIGVIFSPETFGSKSDGLKSPTLSTYLKLAHLLCFSTAFGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G  +  + +G F     W  SS  + Y LGF L+++   
Sbjct  71   LPRHQFGNLQSKMFPAYFTMVGICLAVS-AGSFGYLHPWSSSSVADKYQLGF-LLSSFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLTNLFVFTP  138



>gb|AFK41050.1| unknown [Lotus japonicus]
Length=220

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 63/125 (50%), Gaps = 10/125 (8%)
 Frame = -1

Query  794  VLYDAFEYIFSPENL-------TAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQ  636
            V + A   +FSPE L       +     AHLL  +TA+G  +WV+FI   ++   LPR Q
Sbjct  11   VTFLAVGVLFSPETLASKSTALSTYLKLAHLLSFSTAFGSALWVTFIGGIIMFKNLPRHQ  70

Query  635  IATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNL  459
               +Q+K++P YF  +G + GA     F     W  +S +E Y LGF L+++    L NL
Sbjct  71   FGNLQSKMFPAYFSLVG-TCGAIAVASFGYLHPWKTASTSERYQLGF-LLSSFAFNLTNL  128

Query  458  VYLEP  444
                P
Sbjct  129  FVFTP  133



>ref|XP_010512647.1| PREDICTED: transmembrane protein 205-like [Camelina sativa]
Length=213

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 61/130 (47%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  +TA+G  +W +FI   ++   
Sbjct  11   VAFLAVGVIFSPETFGSLSNGENSAKLSIFLKLAHLLSFSTAWGAALWATFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     + S  F     W  SSA E Y LGF L++A   
Sbjct  71   LPRHQFGNLQSKMFPAYFTLVGSCCAISLSA-FGYLHPWKSSSAVEKYQLGF-LLSAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLTNLFIFTP  138



>ref|XP_006402366.1| hypothetical protein EUTSA_v10006236mg [Eutrema salsugineum]
 gb|ESQ43819.1| hypothetical protein EUTSA_v10006236mg [Eutrema salsugineum]
Length=213

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 58/122 (48%), Gaps = 15/122 (12%)
 Frame = -1

Query  770  IFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIAT  627
            IFSPE             L      +HLL  ATA+G  +W +FI   ++   LPR Q   
Sbjct  19   IFSPETFGSLSKGENSAKLLIFLKLSHLLSFATAWGAALWATFIGGIIMFKNLPRHQFGN  78

Query  626  VQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYL  450
            +Q+K++P YF  +G     + S  F     W  SSA E Y LGF L++A    L NL+  
Sbjct  79   LQSKMFPAYFTLVGSCCAISLSA-FGYLHPWKSSSAVEKYQLGF-LLSAFAFNLTNLLVF  136

Query  449  EP  444
             P
Sbjct  137  TP  138



>gb|KFK35427.1| hypothetical protein AALP_AA5G283100 [Arabis alpina]
Length=213

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 60/122 (49%), Gaps = 15/122 (12%)
 Frame = -1

Query  770  IFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIAT  627
            IFSPE+            L      +HLL  ATA+G  +W +FI   ++   LPR Q   
Sbjct  19   IFSPESFGSLSTGEYSAKLLIFMKLSHLLSFATAWGAALWATFIGGIIMFKNLPRHQFGN  78

Query  626  VQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYL  450
            +Q+K++P YF  +G     + S  F     W  SS+TE Y LGF L++A    L NL+  
Sbjct  79   LQSKMFPAYFTLVGSCCAISLSA-FGYLHPWKSSSSTEKYQLGF-LLSAFAFNLTNLLVF  136

Query  449  EP  444
             P
Sbjct  137  TP  138



>ref|XP_010095303.1| hypothetical protein L484_001912 [Morus notabilis]
 gb|EXB59332.1| hypothetical protein L484_001912 [Morus notabilis]
Length=213

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 62/131 (47%), Gaps = 17/131 (13%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V++ A   IFSPE             L+     AHLL  +TA+G  +WV+FI   +L   
Sbjct  11   VVFLAVGVIFSPETFGSKSDGLNSPKLSTYLKLAHLLSFSTAWGAALWVTFIGGIILFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAALI  477
            LPR Q   +Q+K++P YF  +G  +  A S    G    W  S   E Y LGF L++A  
Sbjct  71   LPRHQFGNLQSKMFPAYFSMVG--VCCAISVASFGYLHPWKSSDTAEKYQLGF-LLSAFA  127

Query  476  MVLVNLVYLEP  444
              L NL    P
Sbjct  128  FNLANLFVFTP  138



>ref|XP_009116920.1| PREDICTED: transmembrane protein 205 [Brassica rapa]
 emb|CDY11428.1| BnaA09g39940D [Brassica napus]
Length=213

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 58/122 (48%), Gaps = 15/122 (12%)
 Frame = -1

Query  770  IFSPENLTAV------------FGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIAT  627
            IFSPE   ++               AHLL  ATA+G  +W +FI   ++   LPR Q   
Sbjct  19   IFSPETFGSLSKGENPAKVLIFVKLAHLLSFATAWGAALWATFIGGIIMFKNLPRHQFGN  78

Query  626  VQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYL  450
            +Q+K++P YF  +G     + S  F     W  SS  E Y LGF LV+A    L NL+  
Sbjct  79   LQSKMFPAYFTLVGSCCAISLSA-FGYLHPWKSSSTVEKYQLGF-LVSAFAFNLTNLLVF  136

Query  449  EP  444
             P
Sbjct  137  TP  138



>ref|XP_008235189.1| PREDICTED: transmembrane protein 205 [Prunus mume]
Length=213

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 63/131 (48%), Gaps = 17/131 (13%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VAFLAIGVIFSPETFGSKSDGLNSPTLSTYLKLAHLLTFSTAFGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAALI  477
            LPR Q   +Q+K++P YF  +G  I  A S    G    W  SS  E Y LGF L+++L 
Sbjct  71   LPRHQFGNLQSKMFPAYFSMVG--ICCAVSVASFGYLHPWNSSSVAEKYQLGF-LLSSLA  127

Query  476  MVLVNLVYLEP  444
              L NL    P
Sbjct  128  FNLTNLFVFTP  138



>emb|CDX76644.1| BnaC08g32300D [Brassica napus]
Length=213

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 58/122 (48%), Gaps = 15/122 (12%)
 Frame = -1

Query  770  IFSPENLTAV------------FGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIAT  627
            IFSPE   ++               AHLL  ATA+G  +W +FI   ++   LPR Q   
Sbjct  19   IFSPETFGSLSKGENPAKVLIFVKLAHLLSFATAWGAALWATFIGGIIMFKNLPRHQFGN  78

Query  626  VQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYL  450
            +Q+K++P YF  +G     + S  F     W  SS  E Y LGF LV+A    L NL+  
Sbjct  79   LQSKMFPAYFTLVGSCCAISLSA-FGYLHPWKSSSIVEKYQLGF-LVSAFAFNLTNLLVF  136

Query  449  EP  444
             P
Sbjct  137  TP  138



>gb|EAW84194.1| MBC3205, isoform CRA_b, partial [Homo sapiens]
Length=113

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL  +    HLL L+ A+GM +WV+F+S ++L  +LPR     VQ+KL+P YF     S+
Sbjct  6    NLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   + L  +L +  VN  +LEPR
Sbjct  63   GCAFINLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPR  109



>ref|XP_007200488.1| hypothetical protein PRUPE_ppa011378mg [Prunus persica]
 gb|EMJ01687.1| hypothetical protein PRUPE_ppa011378mg [Prunus persica]
Length=213

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 63/131 (48%), Gaps = 17/131 (13%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VAFLAIGVIFSPETFGSKSDGLNSPTLSTYLKLAHLLTFSTAFGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAALI  477
            LPR Q   +Q+K++P YF  +G  I  A S    G    W  SS  E Y LGF L+++L 
Sbjct  71   LPRHQFGNLQSKMFPAYFSMVG--ICCAVSVASFGYLHPWNSSSVAEKYQLGF-LLSSLA  127

Query  476  MVLVNLVYLEP  444
              L NL    P
Sbjct  128  FNLTNLFVFTP  138



>ref|XP_010038276.1| PREDICTED: transmembrane protein 205-like [Eucalyptus grandis]
 gb|KCW50101.1| hypothetical protein EUGRSUZ_K03534 [Eucalyptus grandis]
Length=213

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 53/99 (54%), Gaps = 7/99 (7%)
 Frame = -1

Query  731  AHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFK--AMGYSIGAAFSG  558
             HLLG ATA+G   WV+FI   ++   LPR Q   +Q+K++P YF   A+  +I  A  G
Sbjct  44   GHLLGFATAWGAAPWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYFTMVAVCCAISVASFG  103

Query  557  HFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
            +      W  SS TE Y LGF L++A    L NL    P
Sbjct  104  YL---HPWKSSSTTEKYQLGF-LLSAFAFNLTNLFVFSP  138



>emb|CAB83108.1| putative protein [Arabidopsis thaliana]
Length=156

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 50/97 (52%), Gaps = 3/97 (3%)
 Frame = -1

Query  731  AHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHF  552
            AHLL  ATA+G  +W +FI   ++   LPR Q   +Q+KL+P YF  +G     + S  F
Sbjct  2    AHLLSFATAWGAALWATFIGGIIMFKNLPRHQFGNLQSKLFPAYFTLVGSCCAISLSA-F  60

Query  551  LGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
                 W  SS  E Y +GF L++A    L NL    P
Sbjct  61   GYLHPWKSSSTVEKYQIGF-LLSAFAFNLTNLFVFTP  96



>gb|EPS63239.1| hypothetical protein M569_11548 [Genlisea aurea]
Length=213

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 62/130 (48%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   +FSPE             +       HLL  +TA+G  +W +FI   ++   
Sbjct  11   VAFMAVGVVFSPETFGSKSEGQNSPVIVTYLKLIHLLCFSTAFGAALWTTFIGGIIMFKH  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P+YF  +G    A+ +G F     W  S + E Y LGF L+AA   
Sbjct  71   LPRHQFGNLQSKMFPVYFSLVGVCCAAS-AGAFGFLHPWKTSGSAEKYQLGF-LLAAFAF  128

Query  473  VLVNLVYLEP  444
             L NL+   P
Sbjct  129  NLSNLLIFTP  138



>ref|XP_006291839.1| hypothetical protein CARUB_v10018012mg [Capsella rubella]
 gb|EOA24737.1| hypothetical protein CARUB_v10018012mg [Capsella rubella]
Length=213

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 60/130 (46%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     +HLL  ATA+G  +W +FI   ++   
Sbjct  11   VAFLAVGVIFSPETFGSLSNGENSAKLSIFLKLSHLLSFATAWGAALWATFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     + S  F     W  SS  E Y LGF L++A   
Sbjct  71   LPRHQFGNLQSKMFPAYFTLVGSCCAISLSS-FGYLHPWKSSSTVEKYQLGF-LLSAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLTNLFVFTP  138



>ref|XP_010038277.1| PREDICTED: transmembrane protein 205-like [Eucalyptus grandis]
 gb|KCW50102.1| hypothetical protein EUGRSUZ_K035362 [Eucalyptus grandis]
Length=209

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 57/108 (53%), Gaps = 5/108 (5%)
 Frame = -1

Query  749  TAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGA  570
            TA+F  AHLLG ATA+G  +WV+FI   ++   + R+Q   +Q+K+ P YF  +  ++  
Sbjct  38   TAIFKLAHLLGFATAWGAALWVTFIGIVIMFKNVQRRQFGNLQSKMLPAYFTML--AVCC  95

Query  569  AFSGHFLGQTR-WPYSSATEAY-LGFNLVAALIMVLVNLVYLEPRAAK  432
            A S    G    W  SS  E Y LGF L++A    L NL    P   K
Sbjct  96   AISVASFGYLHPWKSSSTKEKYQLGF-LLSAFAFNLTNLFVFTPVTIK  142



>ref|XP_010259357.1| PREDICTED: transmembrane protein 205 [Nelumbo nucifera]
Length=213

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 62/131 (47%), Gaps = 17/131 (13%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + AF  +FSPE             LT     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VAFLAFGILFSPETFGSKSDGGYSSKLTITLKLAHLLCFSTAFGAALWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAALI  477
            LPR Q   +Q+K++P YF  +G  +  A S    G    W  SS  E Y  GF L+++  
Sbjct  71   LPRHQFGNLQSKMFPAYFSLVG--VCCAISVASFGYLHPWRSSSPAERYQFGF-LISSFA  127

Query  476  MVLVNLVYLEP  444
              + NL    P
Sbjct  128  FNIANLFVFTP  138



>ref|XP_010544979.1| PREDICTED: transmembrane protein 205 [Tarenaya hassleriana]
Length=215

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 61/132 (46%), Gaps = 17/132 (13%)
 Frame = -1

Query  794  VLYDAFEYIFSPENL--------------TAVFGTAHLLGLATAYGMCVWVSFISSYVLS  657
            V + A   IFSPE                +A+   AHLL  +TA+G  +W +F    ++ 
Sbjct  11   VAFLAMGVIFSPETFGSKSDGENPAKVTASALLKLAHLLSFSTAWGAALWATFFGGIIMF  70

Query  656  TALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAAL  480
              LPR Q   +Q+K++P YF  +G     + +  F     W  SSA E Y LGF L++A 
Sbjct  71   KNLPRHQFGNLQSKMFPAYFTLVGTCCAISLAA-FGYLHPWKSSSAVEKYQLGF-LLSAF  128

Query  479  IMVLVNLVYLEP  444
               L NL    P
Sbjct  129  AFNLANLFVFTP  140



>ref|XP_002515303.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47287.1| conserved hypothetical protein [Ricinus communis]
Length=209

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 61/126 (48%), Gaps = 11/126 (9%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN--------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQ  639
            V + A   IFSPE         L+     AHLL  +TA+G  +WV+FI   ++   LPR 
Sbjct  11   VAFLAIGIIFSPETFGSKSVGQLSTYLKLAHLLCFSTAFGAALWVTFIGGIIMFKNLPRH  70

Query  638  QIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVN  462
            Q   +Q+K++P YF  +G       +  F     W  +S  E Y LGF L+++L   L N
Sbjct  71   QFGNLQSKMFPAYFWLVGVCCAICVAS-FGYLHPWKSASTAEKYQLGF-LLSSLAFNLAN  128

Query  461  LVYLEP  444
            L    P
Sbjct  129  LFVFTP  134



>gb|AAL06485.1|AF411796_1 AT3g62580/T12C14_280 [Arabidopsis thaliana]
 gb|AAN46755.1| At3g62580/T12C14_280 [Arabidopsis thaliana]
Length=206

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 57/122 (47%), Gaps = 15/122 (12%)
 Frame = -1

Query  770  IFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIAT  627
            IFSPE             ++     AHLL  ATA+G  +W +FI   ++   LPR Q   
Sbjct  19   IFSPETFGSLTNGENSAKISIFLKLAHLLSFATAWGAALWATFIGGIIMFKNLPRHQFGN  78

Query  626  VQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYL  450
            +Q+KL+P YF  +G     + S  F     W  SS  E Y +GF L++A    L NL   
Sbjct  79   LQSKLFPAYFTLVGSCCAISLSA-FGYLHPWKSSSTVEKYQIGF-LLSAFAFNLTNLFVF  136

Query  449  EP  444
             P
Sbjct  137  TP  138



>ref|XP_002876679.1| hypothetical protein ARALYDRAFT_486758 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52938.1| hypothetical protein ARALYDRAFT_486758 [Arabidopsis lyrata subsp. 
lyrata]
Length=213

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 57/122 (47%), Gaps = 15/122 (12%)
 Frame = -1

Query  770  IFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIAT  627
            IFSPE             L+     AHLL  ATA+G  +W +FI   ++   LPR Q   
Sbjct  19   IFSPETFGSLSNGENSEKLSIFLKLAHLLSFATAWGAALWATFIGGIIMFKNLPRHQFGN  78

Query  626  VQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYL  450
            +Q+K++P YF  +G     + S  F     W  SS  + Y LGF L++A    L NL   
Sbjct  79   LQSKMFPAYFTLVGSCCAISLSA-FGYLHPWKSSSTVDKYQLGF-LLSAFAFNLTNLFVF  136

Query  449  EP  444
             P
Sbjct  137  TP  138



>ref|NP_567130.1| Late embryogenesis abundant protein (LEA) family protein [Arabidopsis 
thaliana]
 gb|AEE80366.1| Late embryogenesis abundant protein (LEA) family protein [Arabidopsis 
thaliana]
Length=213

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 57/122 (47%), Gaps = 15/122 (12%)
 Frame = -1

Query  770  IFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIAT  627
            IFSPE             ++     AHLL  ATA+G  +W +FI   ++   LPR Q   
Sbjct  19   IFSPETFGSLTNGENSAKISIFLKLAHLLSFATAWGAALWATFIGGIIMFKNLPRHQFGN  78

Query  626  VQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYL  450
            +Q+KL+P YF  +G     + S  F     W  SS  E Y +GF L++A    L NL   
Sbjct  79   LQSKLFPAYFTLVGSCCAISLSA-FGYLHPWKSSSTVEKYQIGF-LLSAFAFNLTNLFVF  136

Query  449  EP  444
             P
Sbjct  137  TP  138



>ref|XP_002302753.1| hypothetical protein POPTR_0002s19890g [Populus trichocarpa]
 ref|XP_011042228.1| PREDICTED: transmembrane protein 205 [Populus euphratica]
 gb|ABK94325.1| unknown [Populus trichocarpa]
 gb|EEE82026.1| hypothetical protein POPTR_0002s19890g [Populus trichocarpa]
Length=209

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 64/127 (50%), Gaps = 13/127 (10%)
 Frame = -1

Query  794  VLYDAFEYIFSPE--------NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQ  639
            + + A   +FSPE        +L+A    AHLL  +TA+G  +WV+FI   ++   LPR 
Sbjct  11   IAFFAIGVLFSPETFGSKSVTHLSAYLKLAHLLCFSTAFGSALWVTFIGGIIMFKNLPRH  70

Query  638  QIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAALIMVLV  465
            Q   +Q+K++P YF  +G  +  A S    G    W  +S  E Y LGF L+++    L 
Sbjct  71   QFGNLQSKMFPAYFLLVG--VCCAISVAAFGYLHPWKSASTAEKYQLGF-LLSSFAFNLT  127

Query  464  NLVYLEP  444
            NL    P
Sbjct  128  NLFVFTP  134



>ref|XP_004163149.1| PREDICTED: transmembrane protein 205-like isoform 2 [Cucumis 
sativus]
Length=209

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 62/130 (48%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V++ A   +FSPE             L+     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VVFLAIGVVFSPETFGSNSKTFNAPKLSMYLKLAHLLSYSTAWGASLWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     + +  F     W  +  +E Y LGF L++A   
Sbjct  71   LPRHQFGNLQSKMFPAYFSMVGICCATSVAA-FAYLHPWKSAETSERYQLGF-LISAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLANLFVFTP  138



>ref|XP_008451494.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane protein 205 [Cucumis 
melo]
Length=213

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 62/130 (48%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V++ A   +FSPE             L+     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VVFLAMGVVFSPETFGSNSKTFNAPKLSMYLKLAHLLSYSTAWGASLWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     + +  F     W  +  +E Y LGF L++A   
Sbjct  71   LPRHQFGNLQSKMFPAYFSMVGICCATSVAA-FAYLHPWKSAETSERYQLGF-LISAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLANLFVFTP  138



>ref|XP_009378695.1| PREDICTED: transmembrane protein 205-like isoform X2 [Pyrus x 
bretschneideri]
Length=187

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 65/135 (48%), Gaps = 15/135 (11%)
 Frame = -1

Query  809  RRGGEVLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSY  666
            R    V + A   IFSPE             L+     AHLL  +TA+G  +WV+FI   
Sbjct  6    RFLAAVAFLAIGVIFSPETFGSKSHGLKSPILSTYLKLAHLLCFSTAFGAALWVTFIGGI  65

Query  665  VLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLV  489
            ++   LPR Q   +Q+K++P YF  +G  +  + +G F     W  SS  + Y LGF L+
Sbjct  66   IMFKNLPRHQFGNLQSKMFPAYFTMVGICLAVS-AGSFGYLHPWSSSSVADKYQLGF-LL  123

Query  488  AALIMVLVNLVYLEP  444
            ++L   L NL    P
Sbjct  124  SSLSFNLTNLFVFTP  138



>ref|XP_004163148.1| PREDICTED: transmembrane protein 205-like isoform 1 [Cucumis 
sativus]
 gb|KGN45003.1| hypothetical protein Csa_7G407560 [Cucumis sativus]
Length=213

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 62/130 (48%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V++ A   +FSPE             L+     AHLL  +TA+G  +WV+FI   ++   
Sbjct  11   VVFLAIGVVFSPETFGSNSKTFNAPKLSMYLKLAHLLSYSTAWGASLWVTFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     + +  F     W  +  +E Y LGF L++A   
Sbjct  71   LPRHQFGNLQSKMFPAYFSMVGICCATSVAA-FAYLHPWKSAETSERYQLGF-LISAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLANLFVFTP  138



>ref|XP_003123224.2| PREDICTED: transmembrane protein 205 isoform 3 [Sus scrofa]
Length=199

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 65/124 (52%), Gaps = 8/124 (6%)
 Frame = -1

Query  806  RGGEVLYDAFEYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIAT  627
            RGG       E   +P +LT V    HLL L+ A+GM VWV+F+S ++L   LPR     
Sbjct  2    RGGAEEACKMEEGGNPGSLTKV---VHLLVLSGAWGMQVWVTFVSGFLLFRGLPRHTFGL  58

Query  626  VQTKLYPLYFKAMGYSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVY  453
            VQ+KL+P YF     S+G+AF    +   Q  W   +  EA     L+ +L +  +N  +
Sbjct  59   VQSKLFPFYFHI---SMGSAFINLCVLASQHAWAQLTFWEASQLCLLLVSLTLATINARW  115

Query  452  LEPR  441
            LEPR
Sbjct  116  LEPR  119



>ref|XP_006023565.1| PREDICTED: transmembrane protein 205-like [Alligator sinensis]
Length=142

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 37/106 (35%), Positives = 56/106 (53%), Gaps = 2/106 (2%)
 Frame = -1

Query  746  AVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKA-MGYSIGA  570
            ++ G AHL  LATA+GM VWV+FIS +VL+  + R     VQ+KL+P YF   +G S   
Sbjct  9    SLVGVAHLFVLATAWGMQVWVTFISGFVLARGVGRHVFGQVQSKLFPWYFHTLLGCSALN  68

Query  569  AFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
                   G+  W   S+ E    +    +L++  +N  +L P  A+
Sbjct  69   LALAAAAGRP-WHQLSSAETLQVWLFGGSLVLSGLNARWLAPATAR  113



>dbj|BAE87170.1| unnamed protein product [Macaca fascicularis]
Length=118

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL  +    HLL L+ A+GM +WV+F+S ++L   LPR      Q+KL+P YF     S+
Sbjct  6    NLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLAQSKLFPFYFH---ISM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   + L  +L +  VN  +LEPR
Sbjct  63   GCAFINLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPR  109



>ref|NP_001124814.1| transmembrane protein 205 [Pongo abelii]
 sp|Q5REM8.1|TM205_PONAB RecName: Full=Transmembrane protein 205 [Pongo abelii]
 emb|CAH89779.1| hypothetical protein [Pongo abelii]
Length=189

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL  +    HLL L+ A+GM +WV+F+S ++L  +LPR     VQ+KL+P YF     S+
Sbjct  6    NLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   + L  +L +  VN  +LEPR
Sbjct  63   GCAFVNLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPR  109



>ref|XP_010827125.1| PREDICTED: transmembrane protein 205-like [Bison bison bison]
Length=109

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 6/67 (9%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+FIS +VL   LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKV---VHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFH---  59

Query  584  YSIGAAF  564
             S+G AF
Sbjct  60   ISMGCAF  66



>ref|XP_005861438.1| PREDICTED: transmembrane protein 205 [Myotis brandtii]
 gb|EPQ04691.1| Transmembrane protein 205 [Myotis brandtii]
Length=189

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF    
Sbjct  6    NPASLTKV---VHLLVLSGAWGMQIWVTFVSGFLLFKGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFLGQTRWPYSSAT--EAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   + P+S  T  E      L  +L +  +N  +LEPR
Sbjct  61   -SMGCAFVNFCILFPQHPWSQLTFWETSQLCLLFLSLTLATINARWLEPR  109



>ref|XP_004060075.1| PREDICTED: transmembrane protein 205 isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004060076.1| PREDICTED: transmembrane protein 205 isoform 2 [Gorilla gorilla 
gorilla]
Length=189

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL  +    HLL L+ A+GM +WV+F+S ++L  +LPR     VQ+KL+P YF     S+
Sbjct  6    NLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   + L  +L +  VN  +LEPR
Sbjct  63   GCAFINLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPR  109



>ref|XP_006104631.1| PREDICTED: transmembrane protein 205 [Myotis lucifugus]
Length=189

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF    
Sbjct  6    NPASLTKV---VHLLVLSGAWGMQIWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFLGQTRWPYSSAT--EAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   + P+S  T  E      L  +L +  +N  +LEPR
Sbjct  61   -SMGCAFVNFCILFPQHPWSQLTFWETSQLCLLFLSLTLATINARWLEPR  109



>ref|NP_212133.1| transmembrane protein 205 [Homo sapiens]
 ref|NP_940938.1| transmembrane protein 205 [Homo sapiens]
 ref|NP_001138888.1| transmembrane protein 205 [Homo sapiens]
 ref|XP_003316118.1| PREDICTED: transmembrane protein 205 [Pan troglodytes]
 ref|XP_003316120.1| PREDICTED: transmembrane protein 205 [Pan troglodytes]
 ref|XP_003316121.1| PREDICTED: transmembrane protein 205 [Pan troglodytes]
 ref|XP_005259955.1| PREDICTED: transmembrane protein 205 isoform X1 [Homo sapiens]
 ref|XP_005259956.1| PREDICTED: transmembrane protein 205 isoform X2 [Homo sapiens]
 ref|XP_005259957.1| PREDICTED: transmembrane protein 205 isoform X3 [Homo sapiens]
 ref|XP_005259958.1| PREDICTED: transmembrane protein 205 isoform X4 [Homo sapiens]
 ref|XP_005259959.1| PREDICTED: transmembrane protein 205 isoform X5 [Homo sapiens]
 ref|XP_008954203.1| PREDICTED: transmembrane protein 205 [Pan paniscus]
 ref|XP_008954204.1| PREDICTED: transmembrane protein 205 [Pan paniscus]
 ref|XP_008954205.1| PREDICTED: transmembrane protein 205 [Pan paniscus]
 ref|XP_008954206.1| PREDICTED: transmembrane protein 205 [Pan paniscus]
 ref|XP_009433004.1| PREDICTED: transmembrane protein 205 [Pan troglodytes]
 sp|Q6UW68.1|TM205_HUMAN RecName: Full=Transmembrane protein 205 [Homo sapiens]
 gb|AAQ89308.1| MBC3205 [Homo sapiens]
 gb|AAH64948.1| Transmembrane protein 205 [Homo sapiens]
 gb|AAH91472.1| TMEM205 protein [Homo sapiens]
 gb|EAW84191.1| MBC3205, isoform CRA_a [Homo sapiens]
 gb|EAW84192.1| MBC3205, isoform CRA_a [Homo sapiens]
 gb|EAW84193.1| MBC3205, isoform CRA_a [Homo sapiens]
 gb|EAW84197.1| MBC3205, isoform CRA_a [Homo sapiens]
 dbj|BAF84668.1| unnamed protein product [Homo sapiens]
 gb|ADQ32606.1| MBC3205 [synthetic construct]
 gb|AIC53724.1| TMEM205, partial [synthetic construct]
Length=189

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL  +    HLL L+ A+GM +WV+F+S ++L  +LPR     VQ+KL+P YF     S+
Sbjct  6    NLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   + L  +L +  VN  +LEPR
Sbjct  63   GCAFINLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPR  109



>ref|XP_007460759.1| PREDICTED: transmembrane protein 205 [Lipotes vexillifer]
Length=189

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 6/67 (9%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +PE+LT V    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF    
Sbjct  6    NPESLTKV---VHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAF  564
             S+G AF
Sbjct  61   -SMGCAF  66



>ref|XP_010372011.1| PREDICTED: transmembrane protein 205 [Rhinopithecus roxellana]
 ref|XP_010372013.1| PREDICTED: transmembrane protein 205 [Rhinopithecus roxellana]
 ref|XP_010372014.1| PREDICTED: transmembrane protein 205 [Rhinopithecus roxellana]
Length=189

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL  +    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF     S+
Sbjct  6    NLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   + L  +L++  VN  +LEPR
Sbjct  63   GCAFINLCILASQHAWAQLTFWEASQLYLLFLSLMLATVNARWLEPR  109



>ref|XP_004277434.1| PREDICTED: transmembrane protein 205 [Orcinus orca]
 ref|XP_004316048.1| PREDICTED: transmembrane protein 205 [Tursiops truncatus]
Length=189

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 6/67 (9%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +PE+LT V    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF    
Sbjct  6    NPESLTKV---VHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAF  564
             S+G AF
Sbjct  61   -SMGCAF  66



>ref|XP_003123222.1| PREDICTED: transmembrane protein 205 isoform 1 [Sus scrofa]
 ref|XP_003123223.1| PREDICTED: transmembrane protein 205 isoform 2 [Sus scrofa]
Length=189

 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM VWV+F+S ++L   LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKV---VHLLVLSGAWGMQVWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G+AF    +   Q  W   +  EA     L+ +L +  +N  +LEPR
Sbjct  61   -SMGSAFINLCVLASQHAWAQLTFWEASQLCLLLVSLTLATINARWLEPR  109



>ref|XP_007168997.1| PREDICTED: transmembrane protein 205 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007168998.1| PREDICTED: transmembrane protein 205 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007168999.1| PREDICTED: transmembrane protein 205 isoform X3 [Balaenoptera 
acutorostrata scammoni]
Length=189

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 6/67 (9%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +PE+LT V    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF    
Sbjct  6    NPESLTKV---VHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAF  564
             S+G AF
Sbjct  61   -SMGCAF  66



>ref|XP_007106730.1| PREDICTED: transmembrane protein 205 isoform X1 [Physeter catodon]
 ref|XP_007106731.1| PREDICTED: transmembrane protein 205 isoform X2 [Physeter catodon]
Length=189

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 6/67 (9%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +PE+LT V    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF    
Sbjct  6    NPESLTKV---VHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAF  564
             S+G AF
Sbjct  61   -SMGCAF  66



>emb|CDP17085.1| unnamed protein product [Coffea canephora]
Length=217

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 60/134 (45%), Gaps = 19/134 (14%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN----------------LTAVFGTAHLLGLATAYGMCVWVSFISSYV  663
            V + A   IFSPE                 L +    AHLL  +TA+G  +WV+FI   +
Sbjct  11   VTFLAVGVIFSPETFGSTSPQDGQQHHLPKLLSFLKLAHLLCFSTAWGAALWVTFIGGII  70

Query  662  LSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVA  486
            +   LPR Q   +Q+K++P YF  +G       +  F     W  +S    Y LGF L+A
Sbjct  71   MFKNLPRHQFGNLQSKMFPAYFSMVGVCCAVCVAS-FAYLHPWKTASMAHKYQLGF-LLA  128

Query  485  ALIMVLVNLVYLEP  444
            A    L NL+   P
Sbjct  129  AFAFNLTNLLVFTP  142



>ref|XP_004008585.1| PREDICTED: transmembrane protein 205 isoform 1 [Ovis aries]
 ref|XP_004008586.1| PREDICTED: transmembrane protein 205 isoform 2 [Ovis aries]
Length=189

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 61/112 (54%), Gaps = 8/112 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+FIS +VL   LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKV---VHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAA  435
             S+G AF    +   Q  W   +  EA   F L+ +L +  VN  +LE R +
Sbjct  61   -SMGCAFVNLCILASQCTWAQLTFWEASQLFLLLLSLTLATVNARWLESRTS  111



>ref|XP_010914547.1| PREDICTED: transmembrane protein 205 [Elaeis guineensis]
Length=211

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 56/98 (57%), Gaps = 5/98 (5%)
 Frame = -1

Query  731  AHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS-GH  555
            AHLL  AT +G  +WV+FI   ++   LPR Q   +Q+K++P YF  M  S+ AA S   
Sbjct  42   AHLLCFATCWGAALWVTFIGGIIMFKYLPRHQFGNLQSKMFPAYF--MLISVCAAISVMA  99

Query  554  FLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
            F     W  +S+ E Y LGF L++AL+  L NL+   P
Sbjct  100  FAYLHPWKSASSLERYQLGF-LLSALLFNLSNLLVFTP  136



>ref|XP_006905911.1| PREDICTED: transmembrane protein 205 [Pteropus alecto]
 gb|ELK17820.1| Transmembrane protein 205 [Pteropus alecto]
Length=189

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+FIS ++L   LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKV---VHLLVLSGAWGMQMWVTFISGFLLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGH--FLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF      + Q  W   +  EA     L+ +L +  +N  +LEPR
Sbjct  61   -SMGCAFVNFCILVPQHAWVQLTFWEASQLCLLLLSLTLATINARWLEPR  109



>ref|XP_002761800.1| PREDICTED: transmembrane protein 205 [Callithrix jacchus]
 ref|XP_008985546.1| PREDICTED: transmembrane protein 205 [Callithrix jacchus]
 ref|XP_008985547.1| PREDICTED: transmembrane protein 205 [Callithrix jacchus]
 ref|XP_008985548.1| PREDICTED: transmembrane protein 205 [Callithrix jacchus]
Length=189

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL  +    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF     S+
Sbjct  6    NLEGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   + L  +L++  VN  +LEPR
Sbjct  63   GCAFINLCILALQHTWAQLTFWEASQLYLLFLSLMLATVNARWLEPR  109



>ref|XP_006291838.1| hypothetical protein CARUB_v10018012mg [Capsella rubella]
 gb|EOA24736.1| hypothetical protein CARUB_v10018012mg [Capsella rubella]
Length=166

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 60/130 (46%), Gaps = 15/130 (12%)
 Frame = -1

Query  794  VLYDAFEYIFSPEN------------LTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTA  651
            V + A   IFSPE             L+     +HLL  ATA+G  +W +FI   ++   
Sbjct  11   VAFLAVGVIFSPETFGSLSNGENSAKLSIFLKLSHLLSFATAWGAALWATFIGGIIMFKN  70

Query  650  LPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVAALIM  474
            LPR Q   +Q+K++P YF  +G     + S  F     W  SS  E Y LGF L++A   
Sbjct  71   LPRHQFGNLQSKMFPAYFTLVGSCCAISLSS-FGYLHPWKSSSTVEKYQLGF-LLSAFAF  128

Query  473  VLVNLVYLEP  444
             L NL    P
Sbjct  129  NLTNLFVFTP  138



>ref|XP_009393181.1| PREDICTED: transmembrane protein 205-like [Musa acuminata subsp. 
malaccensis]
Length=211

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 59/111 (53%), Gaps = 8/111 (7%)
 Frame = -1

Query  761  PENLTAVFGTA---HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKA  591
            PE+  AV   A   HLL  AT++G  +WV+FI   ++   LPR Q   +Q K++P YF  
Sbjct  29   PESPAAVVTAAKLCHLLAFATSWGTALWVTFIGGIIMFKNLPRHQFGNLQGKMFPAYF--  86

Query  590  MGYSIGAAFS-GHFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
            M  S+ AA S   F     W  +S  E Y LGF L++AL   L NL+   P
Sbjct  87   MVLSVCAAVSVAAFAYLHPWSLASPIERYQLGF-LLSALGFDLSNLIVFTP  136



>ref|XP_005682437.1| PREDICTED: transmembrane protein 205 isoform X1 [Capra hircus]
 ref|XP_005682438.1| PREDICTED: transmembrane protein 205 isoform X2 [Capra hircus]
 ref|XP_005682439.1| PREDICTED: transmembrane protein 205 isoform X3 [Capra hircus]
Length=189

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 61/112 (54%), Gaps = 8/112 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+FIS +VL   LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKV---VHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAA  435
             S+G AF    +   Q  W   +  EA   F L+ +L +  VN  +LE R +
Sbjct  61   -SMGCAFVNLCILASQCAWAQLTFWEASQLFLLLLSLTLATVNARWLESRTS  111



>ref|XP_006063973.1| PREDICTED: transmembrane protein 205 isoform X1 [Bubalus bubalis]
 ref|XP_006063974.1| PREDICTED: transmembrane protein 205 isoform X2 [Bubalus bubalis]
 ref|XP_006063975.1| PREDICTED: transmembrane protein 205 isoform X3 [Bubalus bubalis]
 ref|XP_010826625.1| PREDICTED: transmembrane protein 205 [Bison bison bison]
 ref|XP_010826626.1| PREDICTED: transmembrane protein 205 [Bison bison bison]
 ref|XP_010826627.1| PREDICTED: transmembrane protein 205 [Bison bison bison]
Length=189

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 60/110 (55%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+FIS +VL   LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKV---VHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   Q  W   +  EA   F L+ +L +  VN  +LE R
Sbjct  61   -SMGCAFVNLCILASQCSWAQLTFWEASQLFLLLLSLTLATVNARWLESR  109



>ref|XP_005970320.1| PREDICTED: ras-related protein Rab-3D-like isoform X2 [Pantholops 
hodgsonii]
 ref|XP_005970321.1| PREDICTED: ras-related protein Rab-3D-like isoform X3 [Pantholops 
hodgsonii]
 ref|XP_005970322.1| PREDICTED: ras-related protein Rab-3D-like isoform X4 [Pantholops 
hodgsonii]
 ref|XP_005970323.1| PREDICTED: ras-related protein Rab-3D-like isoform X5 [Pantholops 
hodgsonii]
Length=189

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 60/110 (55%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+FIS +VL   LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKV---VHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   Q  W   +  EA   F L+ +L +  VN  +LE R
Sbjct  61   -SMGCAFVNLCILASQCTWAQLTFWEASQLFLLLLSLTLATVNARWLESR  109



>ref|XP_005890840.1| PREDICTED: transmembrane protein 205 [Bos mutus]
 gb|ELR59984.1| Transmembrane protein 205 [Bos mutus]
Length=189

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 60/110 (55%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+FIS +VL   LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKVI---HLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   Q  W   +  EA   F L+ +L +  VN  +LE R
Sbjct  61   -SMGCAFVNLCILASQCSWAQLTFWEASQLFLLLLSLTLATVNARWLESR  109



>ref|XP_003941832.1| PREDICTED: transmembrane protein 205 [Saimiri boliviensis boliviensis]
 ref|XP_010327827.1| PREDICTED: transmembrane protein 205 [Saimiri boliviensis boliviensis]
Length=189

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL  +    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF     S+
Sbjct  6    NLGGLIKVVHLLVLSGAWGMQMWVTFVSGFLLFRRLPRHTFGLVQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   + L  +L +  VN  +LEPR
Sbjct  63   GCAFINLCILAPQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPR  109



>ref|XP_004748447.1| PREDICTED: transmembrane protein 205 isoform X1 [Mustela putorius 
furo]
 ref|XP_004748448.1| PREDICTED: transmembrane protein 205 isoform X2 [Mustela putorius 
furo]
 ref|XP_004748449.1| PREDICTED: transmembrane protein 205 isoform X3 [Mustela putorius 
furo]
 ref|XP_004748450.1| PREDICTED: transmembrane protein 205 isoform X4 [Mustela putorius 
furo]
 ref|XP_004748451.1| PREDICTED: transmembrane protein 205 isoform X5 [Mustela putorius 
furo]
 ref|XP_004748452.1| PREDICTED: transmembrane protein 205 isoform X6 [Mustela putorius 
furo]
 ref|XP_004824424.1| PREDICTED: transmembrane protein 205 isoform X2 [Mustela putorius 
furo]
 ref|XP_004824425.1| PREDICTED: transmembrane protein 205 isoform X3 [Mustela putorius 
furo]
 ref|XP_004824426.1| PREDICTED: transmembrane protein 205 isoform X4 [Mustela putorius 
furo]
 ref|XP_004824427.1| PREDICTED: transmembrane protein 205 isoform X5 [Mustela putorius 
furo]
 ref|XP_004824428.1| PREDICTED: transmembrane protein 205 isoform X6 [Mustela putorius 
furo]
 ref|XP_004824429.1| PREDICTED: transmembrane protein 205 isoform X7 [Mustela putorius 
furo]
Length=189

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT +    HLL L+ A+GM +WV+FIS ++L  +LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKM---VHLLVLSGAWGMQMWVTFISGFLLFRSLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   Q  W   +  EA     ++ +L M  VN  +LEPR
Sbjct  61   -SMGCAFINLCILASQHAWTQLTFWEAIQLCLMLLSLSMAAVNARWLEPR  109



>ref|XP_008797225.1| PREDICTED: transmembrane protein 205-like [Phoenix dactylifera]
Length=211

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 5/98 (5%)
 Frame = -1

Query  731  AHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS-GH  555
            AHLL  AT +G  +WV+FI   ++   LPR Q   +Q+K++P YF  M  S+ AA S   
Sbjct  42   AHLLCFATCWGSALWVTFIGGIIMFKYLPRHQFGNLQSKMFPAYF--MLISVCAAISVMA  99

Query  554  FLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
            F     W  +S+ E Y LGF L++AL   L NL+   P
Sbjct  100  FAYLHPWKSASSLERYQLGF-LLSALFFNLSNLLIFTP  136



>ref|XP_004824423.1| PREDICTED: transmembrane protein 205 isoform X1 [Mustela putorius 
furo]
Length=197

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 61/110 (55%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT +    HLL L+ A+GM +WV+FIS ++L  +LPR     VQ+KL+P YF    
Sbjct  14   NPGSLTKM---VHLLVLSGAWGMQMWVTFISGFLLFRSLPRHTFGLVQSKLFPFYFHI--  68

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   Q  W   +  EA     ++ +L M  VN  +LEPR
Sbjct  69   -SMGCAFINLCILASQHAWTQLTFWEAIQLCLMLLSLSMAAVNARWLEPR  117



>ref|NP_001032688.1| transmembrane protein 205 [Bos taurus]
 ref|XP_005208797.1| PREDICTED: transmembrane protein 205 isoform X1 [Bos taurus]
 ref|XP_005208798.1| PREDICTED: transmembrane protein 205 isoform X1 [Bos taurus]
 ref|XP_005208799.1| PREDICTED: transmembrane protein 205 isoform X1 [Bos taurus]
 sp|Q32L10.1|TM205_BOVIN RecName: Full=Transmembrane protein 205 [Bos taurus]
 gb|AAI09821.1| Transmembrane protein 205 [Bos taurus]
 tpg|DAA27928.1| TPA: transmembrane protein 205 [Bos taurus]
Length=189

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 6/67 (9%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+FIS +VL   LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKV---VHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAF  564
             S+G AF
Sbjct  61   -SMGCAF  66



>ref|XP_010679353.1| PREDICTED: transmembrane protein 205 [Beta vulgaris subsp. vulgaris]
Length=211

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 60/125 (48%), Gaps = 15/125 (12%)
 Frame = -1

Query  770  IFSPENL----------TAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQ  621
            IFSPE            +     +HLL  ++A+G  +W +FI   ++   LPR Q   +Q
Sbjct  19   IFSPETFKSDASNSSSLSTFLKLSHLLCFSSAWGAALWATFIGGIIMFKNLPRHQFGNLQ  78

Query  620  TKLYPLYFKAMGYSIGAAFSGHFLGQTR-WPYSSATEAY-LGFNLVAALIMVLVNLVYLE  447
            +K++P YF  +G  +  A S    G    W  SS+TE Y LGF L  A +  L NL+   
Sbjct  79   SKMFPAYFTLVG--VCCAISTASFGYLHPWKSSSSTEKYQLGF-LGFAFLFNLSNLLVFT  135

Query  446  PRAAK  432
            P   K
Sbjct  136  PMTIK  140



>gb|EDL25229.1| cDNA sequence BC010787, isoform CRA_c [Mus musculus]
Length=104

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = -1

Query  758  ENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYS  579
            E+  ++    HLL L+ A+GM VWV+FIS ++L  +LPR     VQ+K++P+YF     S
Sbjct  5    EDPGSLIKVIHLLVLSGAWGMQVWVTFISGFLLFRSLPRHTFGLVQSKVFPVYFHV---S  61

Query  578  IGAAF  564
            +G AF
Sbjct  62   LGCAF  66



>gb|EMS50621.1| hypothetical protein TRIUR3_30946 [Triticum urartu]
Length=206

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 55/98 (56%), Gaps = 5/98 (5%)
 Frame = -1

Query  731  AHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS-GH  555
            AH+L  ATA+G  +WV+FI   V+   LPR Q  ++Q K++P YF  M  S+ +A S   
Sbjct  45   AHVLCFATAWGAALWVTFIGGLVMFKHLPRHQFGSLQGKMFPAYF--MLISVCSAISVAA  102

Query  554  FLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
            F     W  +S  E Y LGF L+AAL   L NL+   P
Sbjct  103  FAYLNPWKTASTVERYQLGF-LLAALGFDLSNLLVFTP  139



>ref|NP_001181752.1| transmembrane protein 205 [Macaca mulatta]
 ref|XP_001104593.1| PREDICTED: transmembrane protein 205-like isoform 3 [Macaca mulatta]
 ref|XP_001104673.1| PREDICTED: transmembrane protein 205-like isoform 4 [Macaca mulatta]
 ref|XP_001104745.1| PREDICTED: transmembrane protein 205-like isoform 5 [Macaca mulatta]
 ref|XP_001104890.1| PREDICTED: transmembrane protein 205-like isoform 7 [Macaca mulatta]
 ref|XP_005588079.1| PREDICTED: transmembrane protein 205 isoform X1 [Macaca fascicularis]
 ref|XP_005588080.1| PREDICTED: transmembrane protein 205 isoform X2 [Macaca fascicularis]
 ref|XP_005588081.1| PREDICTED: transmembrane protein 205 isoform X3 [Macaca fascicularis]
 ref|XP_005588082.1| PREDICTED: transmembrane protein 205 isoform X4 [Macaca fascicularis]
 ref|XP_005588083.1| PREDICTED: transmembrane protein 205 isoform X5 [Macaca fascicularis]
 ref|XP_005588084.1| PREDICTED: transmembrane protein 205 isoform X6 [Macaca fascicularis]
 ref|XP_005588085.1| PREDICTED: transmembrane protein 205 isoform X7 [Macaca fascicularis]
 ref|XP_005588086.1| PREDICTED: transmembrane protein 205 isoform X8 [Macaca fascicularis]
 gb|EHH29645.1| Transmembrane protein 205 [Macaca mulatta]
 gb|EHH59216.1| Transmembrane protein 205 [Macaca fascicularis]
Length=189

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL  +    HLL L+ A+GM +WV+F+S ++L   LPR      Q+KL+P YF     S+
Sbjct  6    NLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLAQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   + L  +L +  VN  +LEPR
Sbjct  63   GCAFINLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPR  109



>ref|XP_007993494.1| PREDICTED: transmembrane protein 205 [Chlorocebus sabaeus]
 ref|XP_007993495.1| PREDICTED: transmembrane protein 205 [Chlorocebus sabaeus]
 ref|XP_007993496.1| PREDICTED: transmembrane protein 205 [Chlorocebus sabaeus]
Length=189

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL  +    HLL L+ A+GM +WV+F+S ++L   LPR      Q+KL+P YF     S+
Sbjct  6    NLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLAQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   + L  +L++  VN  +LEPR
Sbjct  63   GCAFINLCILASQHAWAQLTFWEASQLYLLFLSLMLATVNARWLEPR  109



>ref|XP_003914966.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_003914967.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_003914968.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_009191795.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_009191797.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_009191798.1| PREDICTED: transmembrane protein 205 [Papio anubis]
 ref|XP_009191799.1| PREDICTED: transmembrane protein 205 [Papio anubis]
Length=189

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL  +    HLL L+ A+GM +WV+F+S ++L   LPR      Q+KL+P YF     S+
Sbjct  6    NLGGLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLAQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   + L  +L +  VN  +LEPR
Sbjct  63   GCAFINLCILASQHAWAQLTFWEASQLYLLFLSLTLATVNARWLEPR  109



>ref|XP_004398961.1| PREDICTED: transmembrane protein 205 isoform 1 [Odobenus rosmarus 
divergens]
 ref|XP_004398962.1| PREDICTED: transmembrane protein 205 isoform 2 [Odobenus rosmarus 
divergens]
 ref|XP_004398963.1| PREDICTED: transmembrane protein 205 isoform 3 [Odobenus rosmarus 
divergens]
Length=189

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P  LT +    HLL L+ A+GM +WV+FIS ++L  +LPR     VQ+KL+P YF    
Sbjct  6    NPGGLTKM---VHLLVLSGAWGMQMWVTFISGFLLFRSLPRHTFGFVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   Q  W   +  EA     L+ +  +  +N  +LEPR
Sbjct  61   -SMGCAFINLCVLAPQHAWAQLTFWEASQLGLLLLSFALSTINARWLEPR  109



>gb|ABK26434.1| unknown [Picea sitchensis]
Length=220

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 49/96 (51%), Gaps = 1/96 (1%)
 Frame = -1

Query  731  AHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHF  552
            AHLL  ATA+G  +WV+FI   ++   LPR Q   +Q K++P YF +M    GA     F
Sbjct  51   AHLLSFATAFGSALWVTFIGGIIMFRNLPRHQFGNLQGKMFPAYF-SMVSVCGAICVAAF  109

Query  551  LGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEP  444
                 W  +S+ E      LV+ L+  L NL+   P
Sbjct  110  SLTHPWSSASSVEKLQTGLLVSFLVFTLSNLLIFTP  145



>ref|XP_006161572.1| PREDICTED: transmembrane protein 205 isoform X1 [Tupaia chinensis]
 ref|XP_006161573.1| PREDICTED: transmembrane protein 205 isoform X2 [Tupaia chinensis]
 ref|XP_006161574.1| PREDICTED: transmembrane protein 205 isoform X3 [Tupaia chinensis]
Length=189

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 54/98 (55%), Gaps = 5/98 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HLL LA A+GM +WV+F S ++L  ALPR     VQ+KL+P YF     S+G AF    +
Sbjct  15   HLLVLAGAWGMQMWVTFASGFLLFRALPRHTFGLVQSKLFPFYFHI---SMGCAFINLCI  71

Query  548  GQTR--WPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
               R  W   +  EA     L+ +L +  VN  +LEPR
Sbjct  72   LAPRHVWVQPTFWEASQLCLLLLSLTLATVNARWLEPR  109



>emb|CAN72243.1| hypothetical protein VITISV_022622 [Vitis vinifera]
Length=402

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 63/117 (54%), Gaps = 31/117 (26%)
 Frame = -1

Query  1232  MMNILALSLILITLGASGIFSPNAD-----------------TKAVVVEFEKDNNNGGGN  1104
             MMN  AL L + +L A+GI+SPN D                 T+ VVVE++K+   G GN
Sbjct  1     MMNGFALFLAVSSLVAAGIWSPNPDQKQKDYPGAEEVIVKEGTRVVVVEYDKE---GPGN  57

Query  1103  TKVSISPQEAAQNSRLEKGYVLNAMEKISEKAEEVKQRFKDAAAVLPNVGEGISGHQ  933
             TKVSIS QEA            +  +K  +  ++ K++ K+A  VLPN+G+G+S  Q
Sbjct  58    TKVSISTQEAH-----------HVFQKAPKGEDKFKEKVKEAFEVLPNMGQGLSRXQ  103



>ref|XP_003577242.1| PREDICTED: transmembrane protein 205-like [Brachypodium distachyon]
Length=214

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 54/98 (55%), Gaps = 5/98 (5%)
 Frame = -1

Query  731  AHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS-GH  555
            AHLL  ATA+G  +WV+F+   V+   LPR Q   +Q K++P YF  M  S+ +A S   
Sbjct  45   AHLLCFATAWGAALWVTFVGGVVMFKYLPRHQFGNLQGKMFPAYF--MLISMCSAISVAA  102

Query  554  FLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
            F     W  +S  E Y LGF L+AAL   L NL+   P
Sbjct  103  FAYLHPWKTASTIEHYQLGF-LLAALGFDLSNLLVFTP  139



>ref|XP_004378381.1| PREDICTED: transmembrane protein 205 [Trichechus manatus latirostris]
Length=189

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = -1

Query  758  ENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYS  579
             +L A+    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+PLYF     S
Sbjct  5    RDLGALTKVVHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPLYFHI---S  61

Query  578  IGAAF  564
            +G AF
Sbjct  62   MGCAF  66



>ref|XP_006744351.1| PREDICTED: transmembrane protein 205 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006744352.1| PREDICTED: transmembrane protein 205 isoform X2 [Leptonychotes 
weddellii]
Length=189

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 59/110 (54%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P  LT +    HLL L+ A+GM +WV+FIS ++L  +LPR     VQ+KL+P YF    
Sbjct  6    NPGGLTKM---VHLLVLSGAWGMQMWVTFISGFLLFRSLPRHTFGFVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   Q  W   +  EA     L+ +  +  VN  +LEPR
Sbjct  61   -SMGCAFINLCILAPQHAWAQLTFWEASQLGLLLLSFTLSTVNARWLEPR  109



>ref|XP_006663101.1| PREDICTED: transmembrane protein 205-like [Oryza brachyantha]
Length=207

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 5/98 (5%)
 Frame = -1

Query  731  AHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS-GH  555
            AH+L  ATA+G  +WV+FI   V+   LPR Q  ++Q K++P YF  M  S+ +A S   
Sbjct  38   AHVLCFATAWGASLWVTFIGGIVMFKHLPRHQFGSLQGKMFPAYF--MLISVCSAISVAA  95

Query  554  FLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
            F     W  +S  E Y LGF L++AL   L NL+   P
Sbjct  96   FAYLHPWKTASTIERYQLGF-LISALGFDLSNLLVFTP  132



>ref|XP_006875194.1| PREDICTED: transmembrane protein 205 [Chrysochloris asiatica]
Length=189

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 55/98 (56%), Gaps = 5/98 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P+YF+    S+G AF    +
Sbjct  15   HLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPVYFRI---SMGCAFINLCI  71

Query  548  --GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
               Q  W + +  E      L+  L +  +N  +LEPR
Sbjct  72   LAPQHAWAHLTFWETSQLCLLLLCLTLAAINAQWLEPR  109



>ref|XP_006262415.1| PREDICTED: transmembrane protein 205 [Alligator mississippiensis]
Length=187

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -1

Query  737  GTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFK  594
            G AHL  LATA+GM VWV+FIS +VL+  + R     VQ+KL+P YF 
Sbjct  12   GVAHLFVLATAWGMQVWVTFISGFVLARGVGRHVFGQVQSKLFPWYFH  59



>ref|NP_001068440.1| Os11g0673100 [Oryza sativa Japonica Group]
 gb|ABA95272.1| seed maturation protein PM27, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28803.1| Os11g0673100 [Oryza sativa Japonica Group]
 gb|EAY81824.1| hypothetical protein OsI_36996 [Oryza sativa Indica Group]
 dbj|BAG90937.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97623.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE65486.1| hypothetical protein OsJ_20902 [Oryza sativa Japonica Group]
Length=211

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 5/98 (5%)
 Frame = -1

Query  731  AHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS-GH  555
            AH+L  ATA+G  +WV+FI   V+   LPR Q  ++Q K++P YF  M  S+ +A S   
Sbjct  42   AHVLCFATAWGAALWVTFIGGIVMFKYLPRHQFGSLQGKMFPAYF--MLISVCSAISVAA  99

Query  554  FLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
            F     W  +S  E Y LGF L++AL   L NL+   P
Sbjct  100  FAYLHPWKTASTIERYQLGF-LISALGFDLSNLLVFTP  136



>ref|XP_002287805.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED95248.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=152

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 54/103 (52%), Gaps = 10/103 (10%)
 Frame = -1

Query  734  TAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGH  555
            T HLL  +T +G  V+ +F++   +   LPR+   ++Q+KL+PLYF+     IG      
Sbjct  1    TLHLLSFSTWFGTVVYTTFVAGITMFKNLPRRVFGSLQSKLFPLYFQLCTSMIGI----Q  56

Query  554  FLGQTRWP--YSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
             L  T  P   S  +E  LG +  A L+    NL+YLEP + +
Sbjct  57   ILTLTSMPDILSKVSEVSLGISFAATLL----NLLYLEPTSTQ  95



>gb|EMT31562.1| hypothetical protein F775_26736 [Aegilops tauschii]
Length=212

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 54/97 (56%), Gaps = 5/97 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS-GHF  552
            H+L  ATA+G  +WV+FI   V+   LPR Q  ++Q K++P YF  M  S+ +A S   F
Sbjct  44   HVLCFATAWGAALWVTFIGGIVMFKHLPRHQFGSLQGKMFPAYF--MLISVCSAISVAAF  101

Query  551  LGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
                 W  +S  E Y LGF L+AAL   L NL+   P
Sbjct  102  AYLNPWKTASTIERYQLGF-LLAALGFDLSNLLVFTP  137



>ref|XP_006855302.1| hypothetical protein AMTR_s00057p00058340 [Amborella trichopoda]
 gb|ERN16769.1| hypothetical protein AMTR_s00057p00058340 [Amborella trichopoda]
Length=210

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 61/134 (46%), Gaps = 12/134 (9%)
 Frame = -1

Query  815  ILRRGGEVLYDAFEYIFSPENLTAV---------FGTAHLLGLATAYGMCVWVSFISSYV  663
            I R    V + A   +FS +  T+             AHLL  +TA+G  +WV+FI   +
Sbjct  4    ITRFLAVVTFFAIGIVFSSQTFTSTNPSGVISSSLKLAHLLSFSTAWGAALWVTFIGGII  63

Query  662  LSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFLGQTRWPYSSATEAY-LGFNLVA  486
            +   LPR Q   +Q+K++P YF  +    GA     F     W  +S TE   LGF L +
Sbjct  64   MFKNLPRHQFGNLQSKMFPAYFSTVAVC-GAISVAAFAYLHPWKSASGTEKLQLGF-LSS  121

Query  485  ALIMVLVNLVYLEP  444
            + +  L NL    P
Sbjct  122  SFLFNLTNLFIFTP  135



>ref|NP_848692.2| transmembrane protein 205 isoform 2 [Mus musculus]
 ref|NP_001240797.1| transmembrane protein 205 isoform 2 [Mus musculus]
 ref|NP_001240798.1| transmembrane protein 205 isoform 2 [Mus musculus]
 ref|NP_001240799.1| transmembrane protein 205 isoform 2 [Mus musculus]
 sp|Q91XE8.1|TM205_MOUSE RecName: Full=Transmembrane protein 205 [Mus musculus]
 gb|AAH10787.1| Transmembrane protein 205 [Mus musculus]
 gb|EDL25225.1| cDNA sequence BC010787, isoform CRA_a [Mus musculus]
 gb|EDL25226.1| cDNA sequence BC010787, isoform CRA_a [Mus musculus]
 gb|EDL25228.1| cDNA sequence BC010787, isoform CRA_a [Mus musculus]
Length=189

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = -1

Query  758  ENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYS  579
            E+  ++    HLL L+ A+GM VWV+FIS ++L  +LPR     VQ+K++P+YF     S
Sbjct  5    EDPGSLIKVIHLLVLSGAWGMQVWVTFISGFLLFRSLPRHTFGLVQSKVFPVYFHV---S  61

Query  578  IGAAF  564
            +G AF
Sbjct  62   LGCAF  66



>ref|XP_001775467.1| predicted protein [Physcomitrella patens]
 gb|EDQ59664.1| predicted protein [Physcomitrella patens]
Length=214

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 48/101 (48%), Gaps = 5/101 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HLL  ATA+G  VW SFI   ++   LPR Q   +Q K++P YFK +        S    
Sbjct  46   HLLSFATAFGTAVWASFIGGIIMFKNLPRHQFGNLQAKMFPAYFKLLTVCCSLCVSAM--  103

Query  548  GQTRWPYSSAT--EAYLGFNLVAALIMVLVNLVYLEPRAAK  432
              T  P+ SAT  E      L  +L  V+ NL+  +P   K
Sbjct  104  -ATTHPWLSATRRERLQIVALGVSLFTVVFNLLVFQPLTVK  143



>ref|XP_005970319.1| PREDICTED: ras-related protein Rab-3D-like isoform X1 [Pantholops 
hodgsonii]
Length=320

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 6/67 (9%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+FIS +VL   LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKV---VHLLVLSGAWGMQMWVTFISGFVLFRGLPRHTFGLVQSKLFPFYFH---  59

Query  584  YSIGAAF  564
             S+G AF
Sbjct  60   ISMGCAF  66



>ref|XP_007079370.1| PREDICTED: transmembrane protein 205 isoform X2 [Panthera tigris 
altaica]
Length=196

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            N  ++    HLL L+ A+GM +WV+F+S ++L  +LPR     VQ+KL+P YF     S+
Sbjct  13   NPGSLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  69

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   F L  +L +  VN  +LEPR
Sbjct  70   GCAFINLCILAPQHAWAQLTFWEASQLFLLFLSLTLSTVNARWLEPR  116



>ref|XP_007079371.1| PREDICTED: transmembrane protein 205 isoform X3 [Panthera tigris 
altaica]
 ref|XP_007079372.1| PREDICTED: transmembrane protein 205 isoform X4 [Panthera tigris 
altaica]
Length=189

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            N  ++    HLL L+ A+GM +WV+F+S ++L  +LPR     VQ+KL+P YF     S+
Sbjct  6    NPGSLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   F L  +L +  VN  +LEPR
Sbjct  63   GCAFINLCILAPQHAWAQLTFWEASQLFLLFLSLTLSTVNARWLEPR  109



>ref|XP_008797440.1| PREDICTED: transmembrane protein 205-like [Phoenix dactylifera]
 ref|XP_008797441.1| PREDICTED: transmembrane protein 205-like [Phoenix dactylifera]
Length=211

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 54/98 (55%), Gaps = 5/98 (5%)
 Frame = -1

Query  731  AHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS-GH  555
            AHLL  AT +G  +WV+FI   ++   LPR Q   +Q+K++P YF  M  S+ AA S   
Sbjct  42   AHLLCFATCWGTALWVTFIGGIIMFKNLPRHQFGNLQSKMFPAYF--MVVSVCAAISVAA  99

Query  554  FLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
            F     W  +S+ E Y LGF L+++L   L NL    P
Sbjct  100  FAYLHPWKSASSLERYQLGF-LLSSLGFNLSNLFVFTP  136



>ref|NP_001240796.1| transmembrane protein 205 isoform 1 [Mus musculus]
Length=245

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = -1

Query  758  ENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYS  579
            E+  ++    HLL L+ A+GM VWV+FIS ++L  +LPR     VQ+K++P+YF     S
Sbjct  61   EDPGSLIKVIHLLVLSGAWGMQVWVTFISGFLLFRSLPRHTFGLVQSKVFPVYFHV---S  117

Query  578  IGAAF  564
            +G AF
Sbjct  118  LGCAF  122



>ref|XP_006928488.1| PREDICTED: transmembrane protein 205 isoform X3 [Felis catus]
 ref|XP_006928489.1| PREDICTED: transmembrane protein 205 isoform X4 [Felis catus]
Length=189

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            N  ++    HLL L+ A+GM +WV+F+S ++L  +LPR     VQ+KL+P YF     S+
Sbjct  6    NPGSLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   F L  +L +  +N  +LEPR
Sbjct  63   GCAFINLCILAPQHAWAQLTFWEASQLFLLFLSLTLSTINARWLEPR  109



>ref|XP_003981931.2| PREDICTED: transmembrane protein 205 isoform X1 [Felis catus]
Length=196

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            N  ++    HLL L+ A+GM +WV+F+S ++L  +LPR     VQ+KL+P YF     S+
Sbjct  13   NPGSLIKMVHLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SM  69

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            G AF    +   Q  W   +  EA   F L  +L +  +N  +LEPR
Sbjct  70   GCAFINLCILAPQHAWAQLTFWEASQLFLLFLSLTLSTINARWLEPR  116



>ref|XP_004595566.1| PREDICTED: transmembrane protein 205 [Ochotona princeps]
Length=189

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAF  564
            HLL L+ A+GM VWV+F S ++L  ALPR     VQ+KL+P YF     S+G AF
Sbjct  15   HLLALSGAWGMQVWVTFASGFLLFRALPRHTFGQVQSKLFPYYFYI---SVGCAF  66



>ref|XP_007079369.1| PREDICTED: transmembrane protein 205 isoform X1 [Panthera tigris 
altaica]
Length=199

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 55/98 (56%), Gaps = 5/98 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HLL L+ A+GM +WV+F+S ++L  +LPR     VQ+KL+P YF     S+G AF    +
Sbjct  25   HLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SMGCAFINLCI  81

Query  548  --GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
               Q  W   +  EA   F L  +L +  VN  +LEPR
Sbjct  82   LAPQHAWAQLTFWEASQLFLLFLSLTLSTVNARWLEPR  119



>ref|XP_001754410.1| predicted protein [Physcomitrella patens]
 gb|EDQ80860.1| predicted protein [Physcomitrella patens]
Length=152

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 11/100 (11%)
 Frame = -1

Query  725  LLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM--GYSIGAAFSGHF  552
            LL  A  +G  +W++FIS  +LS  +PR+Q   VQTK++P Y K++  G S  A FS   
Sbjct  1    LLTYAVTFGSAIWMTFISGRILSRTIPREQFRNVQTKMFPYYLKSLVAGQSALALFSVLT  60

Query  551  LGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAAK  432
             G ++W       + LGF L+        N   LEP+  K
Sbjct  61   RGSSKW-------SLLGFVLLIG--SAAYNAFVLEPKTTK  91



>ref|XP_006928487.1| PREDICTED: transmembrane protein 205 isoform X2 [Felis catus]
Length=199

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 5/98 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HLL L+ A+GM +WV+F+S ++L  +LPR     VQ+KL+P YF     S+G AF    +
Sbjct  25   HLLVLSGAWGMQMWVTFVSGFLLFRSLPRHTFGLVQSKLFPFYFHI---SMGCAFINLCI  81

Query  548  --GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
               Q  W   +  EA   F L  +L +  +N  +LEPR
Sbjct  82   LAPQHAWAQLTFWEASQLFLLFLSLTLSTINARWLEPR  119



>ref|XP_004716881.1| PREDICTED: transmembrane protein 205 [Echinops telfairi]
Length=191

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 58/114 (51%), Gaps = 8/114 (7%)
 Frame = -1

Query  776  EYIFSPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYF  597
            E + +P  L  V    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF
Sbjct  2    EEVGAPGGLAKV---VHLLVLSGAWGMQIWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYF  58

Query  596  KAMGYSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
                 S+G A     +   Q  W   +  EA     L+  L +  +N  +LEPR
Sbjct  59   HI---SMGCALVNLCILASQCAWTQLTFWEASQLGLLLLCLTLAAINGRWLEPR  109



>ref|XP_006664096.1| PREDICTED: transmembrane protein 205-like [Oryza brachyantha]
Length=212

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 53/99 (54%), Gaps = 5/99 (5%)
 Frame = -1

Query  734  TAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS-G  558
             AHLL  AT++G  +W +FI   ++   LPR Q   +Q +++P YF  M  S+ AA S  
Sbjct  42   VAHLLCFATSWGAALWATFIGGIIMFKNLPRHQFGNLQARMFPAYF--MLISVCAAVSVA  99

Query  557  HFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
             F     W  +S  E Y LGF L+AAL   L NL+   P
Sbjct  100  AFAYLHPWKAASTVERYQLGF-LLAALGFDLSNLLVFTP  137



>ref|XP_010976605.1| PREDICTED: transmembrane protein 205 [Camelus dromedarius]
 ref|XP_010976606.1| PREDICTED: transmembrane protein 205 [Camelus dromedarius]
Length=189

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 6/66 (9%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGY  582
            P +LT V    HLL L+ A+GM VWV+FIS ++L   LPR     VQ+KL+P YF     
Sbjct  7    PGSLTKV---VHLLVLSGAWGMQVWVTFISGFLLFRGLPRHTFGLVQSKLFPFYFHI---  60

Query  581  SIGAAF  564
            S+  AF
Sbjct  61   SMSCAF  66



>ref|XP_008156250.1| PREDICTED: transmembrane protein 205 [Eptesicus fuscus]
Length=189

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 6/66 (9%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGY  582
            P +LT V    HLL L+ A+GM +WV+F S ++L   LPR     VQ+KL+P YF     
Sbjct  7    PASLTKV---VHLLVLSGAWGMQMWVTFFSGFLLFRGLPRHTFGLVQSKLFPFYFHI---  60

Query  581  SIGAAF  564
            S+G AF
Sbjct  61   SMGCAF  66



>ref|XP_533912.2| PREDICTED: transmembrane protein 205 [Canis lupus familiaris]
Length=189

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (53%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT +    HLL L+ A+GM +WV+FIS + L   LPR     VQ+KL+PLYF    
Sbjct  6    NPGSLTKM---VHLLVLSGAWGMQMWVTFISGFQLFRNLPRHTFGLVQSKLFPLYFHI--  60

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   Q  W   +  E      L  +L +  +N  +LEPR
Sbjct  61   -SMGCAFINLCILASQHAWAQLTFWETSQLCLLFLSLTLSTINARWLEPR  109



>ref|XP_003413409.1| PREDICTED: transmembrane protein 205 [Loxodonta africana]
 ref|XP_010591634.1| PREDICTED: transmembrane protein 205 [Loxodonta africana]
Length=189

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 58/109 (53%), Gaps = 8/109 (7%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGY  582
            P  LT V    HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF     
Sbjct  7    PGGLTKV---VHLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---  60

Query  581  SIGAAFSGHFLGQTR--WPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
            ++G AF   ++  T+  W   +  EA     L+  L +  +N  +L PR
Sbjct  61   TMGCAFINLYIMATQHAWGQLTFWEASQLCLLLLCLTLAAINARWLGPR  109



>ref|XP_001490060.1| PREDICTED: transmembrane protein 205 isoform X1 [Equus caballus]
 ref|XP_005611984.1| PREDICTED: transmembrane protein 205 isoform X2 [Equus caballus]
 ref|XP_005611985.1| PREDICTED: transmembrane protein 205 isoform X3 [Equus caballus]
 ref|XP_005611986.1| PREDICTED: transmembrane protein 205 isoform X4 [Equus caballus]
Length=189

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HLL L+ A+GM +WV+F S +VL  ALPR     VQ+KL+P YF     S+  AF    +
Sbjct  15   HLLVLSGAWGMQMWVTFASGFVLFRALPRHTFGLVQSKLFPFYFHI---SMACAFVSFCI  71

Query  548  --GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
               Q  W   +  EA   F  + +L +  +N  +LEPR
Sbjct  72   LAPQRAWAQLTFWEASQLFLTLLSLTLATINARWLEPR  109



>ref|XP_007951790.1| PREDICTED: transmembrane protein 205 [Orycteropus afer afer]
Length=189

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 6/66 (9%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGY  582
            P +LT V    HLL L+ A+GM +WV+F++ ++L   LPR     VQ+KL+P YF     
Sbjct  7    PGSLTKV---VHLLVLSGAWGMQMWVTFVAGFLLFRGLPRHTFGLVQSKLFPFYFHI---  60

Query  581  SIGAAF  564
            S+G AF
Sbjct  61   SMGCAF  66



>dbj|BAA92764.1| unnamed protein product [Mus musculus]
Length=189

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = -1

Query  758  ENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYS  579
            E+  ++    HLL L+ A+GM VWV+FIS ++   +LPR     VQ+K++P+YF     S
Sbjct  5    EDPGSLIKVIHLLVLSGAWGMQVWVTFISGFLFFRSLPRHTFGLVQSKVFPVYFHV---S  61

Query  578  IGAAF  564
            +G AF
Sbjct  62   LGCAF  66



>ref|XP_006184934.1| PREDICTED: transmembrane protein 205 [Camelus ferus]
 ref|XP_010965169.1| PREDICTED: transmembrane protein 205 [Camelus bactrianus]
 ref|XP_010965170.1| PREDICTED: transmembrane protein 205 [Camelus bactrianus]
Length=189

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 6/66 (9%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGY  582
            P +LT V    HLL L+ A+GM VWV+F+S ++L   LPR     VQ+KL+P YF     
Sbjct  7    PGSLTKV---VHLLVLSGAWGMQVWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---  60

Query  581  SIGAAF  564
            S+  AF
Sbjct  61   SMSCAF  66



>ref|XP_002921398.1| PREDICTED: transmembrane protein 205-like isoform 1 [Ailuropoda 
melanoleuca]
 ref|XP_002921399.1| PREDICTED: transmembrane protein 205-like isoform 2 [Ailuropoda 
melanoleuca]
 gb|EFB12965.1| hypothetical protein PANDA_010291 [Ailuropoda melanoleuca]
Length=189

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 59/110 (54%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT +    +LL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF    
Sbjct  6    NPGSLTKM---VYLLVLSGAWGMQMWVTFVSGFLLFRNLPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   Q  W   +  EA     L+   ++  +N  +LEPR
Sbjct  61   -SMGCAFINLCILAPQHAWAQLTFWEASQLCLLLLNFVLSAINARWLEPR  109



>ref|XP_003797991.1| PREDICTED: transmembrane protein 205 [Otolemur garnettii]
Length=189

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAF  564
            HLL L+ A+GM +WV+F+S ++L   LPR     VQ+KL+P YF     S+G AF
Sbjct  15   HLLVLSGAWGMQMWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHT---SMGCAF  66



>ref|XP_006206363.1| PREDICTED: transmembrane protein 205 [Vicugna pacos]
Length=189

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 6/66 (9%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGY  582
            P +LT V    HLL L+ A+GM VWV+F+S ++L   LPR     VQ+KL+P YF     
Sbjct  7    PGSLTKV---VHLLVLSGAWGMQVWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFHI---  60

Query  581  SIGAAF  564
            S+  AF
Sbjct  61   SMSCAF  66



>gb|EQB78321.1| transmembrane protein 205 [Camelus ferus]
Length=211

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 6/66 (9%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGY  582
            P +LT V    HLL L+ A+GM VWV+F+S ++L   LPR     VQ+KL+P YF     
Sbjct  29   PGSLTKV---VHLLVLSGAWGMQVWVTFVSGFLLFRGLPRHTFGLVQSKLFPFYFH---I  82

Query  581  SIGAAF  564
            S+  AF
Sbjct  83   SMSCAF  88



>ref|XP_010931739.1| PREDICTED: transmembrane protein 205-like [Elaeis guineensis]
Length=211

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = -1

Query  731  AHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS-GH  555
            AHLL  AT +G+ +WV+FI   +    LPR Q   +Q+K++P YF  M  S+ AA S   
Sbjct  42   AHLLCFATCWGVSLWVTFIGGIITFKNLPRHQFGNLQSKMFPAYF--MVLSVCAAISVAA  99

Query  554  FLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
            F     W  ++  E Y LGF L++AL   L NL    P
Sbjct  100  FAYLHPWKSAAPLERYQLGF-LLSALGFNLSNLFVFTP  136



>ref|XP_005346982.1| PREDICTED: transmembrane protein 205 [Microtus ochrogaster]
Length=189

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 3/65 (5%)
 Frame = -1

Query  758  ENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYS  579
            E+  ++    HLL L+ A+GM +WV+F S ++L  +LPR     VQ+KL+P+YF     S
Sbjct  5    EDPGSLIKVVHLLVLSGAWGMQMWVTFASGFLLFRSLPRHTFGLVQSKLFPVYFHV---S  61

Query  578  IGAAF  564
            +G AF
Sbjct  62   LGCAF  66



>ref|XP_004084163.1| PREDICTED: transmembrane protein 205-like isoform 1 [Oryzias 
latipes]
 ref|XP_004084164.1| PREDICTED: transmembrane protein 205-like isoform 2 [Oryzias 
latipes]
Length=188

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 3/58 (5%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
            P +L  VF   HLL L+  +GM VWVSFI+ +VL T + R     VQ+KL+P+YF  +
Sbjct  7    PTDLVKVF---HLLVLSFTWGMQVWVSFIAGFVLVTQVTRHTFGLVQSKLFPVYFYCL  61



>ref|XP_004442704.1| PREDICTED: transmembrane protein 205 [Ceratotherium simum simum]
Length=189

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = -1

Query  755  NLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSI  576
            NL ++    HLL L+ A+GM +WV+F S +VL   +PR     VQ+KL+P YF     S+
Sbjct  6    NLGSLTKVVHLLVLSGAWGMQMWVTFASGFVLFRGVPRHTFGLVQSKLFPFYFHI---SM  62

Query  575  GAAFSGHFL--GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
              AF    +   Q  W   +  EA     L+ +L +  +N  +LEPR
Sbjct  63   ACAFVNLCILAPQRAWAQLTFWEASQLCLLLLSLTLATINARWLEPR  109



>ref|XP_002451243.1| hypothetical protein SORBIDRAFT_05g026390 [Sorghum bicolor]
 gb|EES10231.1| hypothetical protein SORBIDRAFT_05g026390 [Sorghum bicolor]
Length=210

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 51/96 (53%), Gaps = 3/96 (3%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            H+L  ATA+G  +WV+FI   V+   LPR Q  ++Q K++P YF  +  S  A     F 
Sbjct  42   HVLAFATAWGAGLWVTFIGGIVMFKYLPRHQFGSLQGKMFPAYFMLIS-SCSAISVAAFA  100

Query  548  GQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
                W  +S  E Y LGF L++AL   L NL+   P
Sbjct  101  YLHPWKTASTIERYQLGF-LISALGCNLSNLLVFTP  135



>ref|XP_005050720.1| PREDICTED: transmembrane protein 205-like [Ficedula albicollis]
Length=178

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFK  594
            HLL L+T++GM VWV+F++ +V+S  LPR    ++Q +L+P YF 
Sbjct  25   HLLFLSTSWGMQVWVTFVAGFVMSRHLPRHTFGSIQRQLFPYYFH  69



>ref|XP_003579299.1| PREDICTED: transmembrane protein 205-like [Brachypodium distachyon]
Length=213

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 52/99 (53%), Gaps = 5/99 (5%)
 Frame = -1

Query  734  TAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS-G  558
             AHLL  AT++G  +W +FI   ++   LPR Q   +Q K++P YF  +  S  AA S  
Sbjct  43   VAHLLCFATSWGAALWATFIGGIIMFKNLPRHQFGNLQGKMFPAYFTLI--SACAAISVA  100

Query  557  HFLGQTRWPYSSATEAY-LGFNLVAALIMVLVNLVYLEP  444
             F     W  +S  E Y LGF L++AL   L NL+   P
Sbjct  101  AFAYLHPWKAASTVERYQLGF-LISALGFDLSNLLVFTP  138



>ref|XP_006765857.1| PREDICTED: transmembrane protein 205 [Myotis davidii]
Length=189

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 57/110 (52%), Gaps = 8/110 (7%)
 Frame = -1

Query  764  SPENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            +P +LT V    HLL L+ A+GM +WV+F+S     +  PR     VQ+KL+P YF    
Sbjct  6    NPASLTKV---VHLLVLSGAWGMQIWVTFVSGRDPRSGRPRHTFGLVQSKLFPFYFHI--  60

Query  584  YSIGAAFSGHFLGQTRWPYSSAT--EAYLGFNLVAALIMVLVNLVYLEPR  441
             S+G AF    +   + P+S  T  E      L  +L +  +N  +LEPR
Sbjct  61   -SMGCAFVNFCILFPQHPWSQLTFWETSQLCLLFLSLTLATINARWLEPR  109



>gb|KFW82049.1| Transmembrane protein 205, partial [Manacus vitellinus]
Length=177

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFK  594
            HLL L+T++GM +WV+F++ +V+S  LPR    ++Q KL+P YF 
Sbjct  5    HLLFLSTSWGMQIWVTFVAGFVMSRHLPRHTFGSIQRKLFPYYFH  49



>ref|XP_008923476.1| PREDICTED: transmembrane protein 205 [Manacus vitellinus]
Length=187

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFK  594
            HLL L+T++GM +WV+F++ +V+S  LPR    ++Q KL+P YF 
Sbjct  15   HLLFLSTSWGMQIWVTFVAGFVMSRHLPRHTFGSIQRKLFPYYFH  59



>ref|XP_008831793.1| PREDICTED: transmembrane protein 205 [Nannospalax galili]
 ref|XP_008831794.1| PREDICTED: transmembrane protein 205 [Nannospalax galili]
 ref|XP_008831795.1| PREDICTED: transmembrane protein 205 [Nannospalax galili]
 ref|XP_008831796.1| PREDICTED: transmembrane protein 205 [Nannospalax galili]
Length=189

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 38/56 (68%), Gaps = 3/56 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFS  561
            HL+ L+ A+GM +WV+F S ++L  +LPR     VQ+KL+P+YF     S+G AF+
Sbjct  15   HLMVLSGAWGMQMWVTFASGFLLFRSLPRHTFGLVQSKLFPVYFHV---SLGCAFT  67



>ref|XP_006898852.1| PREDICTED: transmembrane protein 205 [Elephantulus edwardii]
Length=189

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 56/107 (52%), Gaps = 4/107 (4%)
 Frame = -1

Query  761  PENLTAVFGTAHLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGY  582
            P  LT V    +LL L+ A+GM +W++F+S ++L  ALPR     VQ+KL+P YF     
Sbjct  7    PGGLTKVI---YLLVLSGAWGMQMWITFVSGFLLFPALPRHTFGLVQSKLFPFYFHICMV  63

Query  581  SIGAAFSGHFLGQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
                 F G  + Q  W   +  E      L+  L++ ++N  +LEPR
Sbjct  64   CAFVNF-GILVSQLTWAQLTFWETSQFCLLLLCLLLAVINARWLEPR  109



>ref|XP_004616637.1| PREDICTED: transmembrane protein 205 [Sorex araneus]
Length=189

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 5/100 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HLL L+ A+GM +WV+F S ++L   LPR     VQ+KL+P YF     S+  AF    +
Sbjct  15   HLLVLSGAWGMQMWVTFASGFILFRGLPRHTFGLVQSKLFPFYFHV---SVACAFVNLCV  71

Query  548  --GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPRAA  435
               Q  W   +  E+   F L+ +L++  VN  +LEPR +
Sbjct  72   LASQYSWARITFWESSQVFLLLLSLVLAAVNDRWLEPRTS  111



>ref|XP_004689065.1| PREDICTED: transmembrane protein 205 [Condylura cristata]
Length=189

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 50/98 (51%), Gaps = 5/98 (5%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMGYSIGAAFSGHFL  549
            HLL L+ A+GM +WV+F S ++L   LPR     VQ+KL+P YF     S+  AF    +
Sbjct  15   HLLVLSGAWGMQIWVTFASGFLLFRGLPRHTFGLVQSKLFPFYFHI---SMSCAFVNLCI  71

Query  548  --GQTRWPYSSATEAYLGFNLVAALIMVLVNLVYLEPR  441
               Q  W   +  EA     L   L +  +N  +LEPR
Sbjct  72   LASQHSWAQLTYWEASQLCLLFLNLTLATINARWLEPR  109



>ref|XP_008501066.1| PREDICTED: transmembrane protein 205 [Calypte anna]
Length=187

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAMG  585
            HLL L+T++GM +WV+F++ +V+ T LPR     +Q KL+P YF  + 
Sbjct  15   HLLFLSTSWGMQIWVTFVAGFVMGTHLPRHTFGLIQRKLFPYYFHILS  62



>gb|KFO96458.1| Transmembrane protein 205, partial [Calypte anna]
Length=177

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -1

Query  728  HLLGLATAYGMCVWVSFISSYVLSTALPRQQIATVQTKLYPLYFKAM  588
            HLL L+T++GM +WV+F++ +V+ T LPR     +Q KL+P YF  +
Sbjct  5    HLLFLSTSWGMQIWVTFVAGFVMGTHLPRHTFGLIQRKLFPYYFHIL  51



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3362574547750