BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10234_g1_i1 len=1281 path=[609:0-590 608:591-1280]

Length=1281
                                                                      Score     E

ref|XP_009614824.1|  PREDICTED: probable inactive poly [ADP-ribos...    298   3e-93   
ref|XP_009759861.1|  PREDICTED: probable inactive poly [ADP-ribos...    288   1e-89   
ref|XP_006345059.1|  PREDICTED: probable inactive poly [ADP-ribos...    281   7e-87   
ref|XP_006345058.1|  PREDICTED: probable inactive poly [ADP-ribos...    281   1e-86   
ref|XP_010318907.1|  PREDICTED: probable inactive poly [ADP-ribos...    276   5e-85   
ref|XP_004236104.1|  PREDICTED: probable inactive poly [ADP-ribos...    276   5e-85   
ref|XP_008239766.1|  PREDICTED: probable inactive poly [ADP-ribos...    270   1e-82   
ref|XP_006439822.1|  hypothetical protein CICLE_v10020868mg             266   2e-81   
ref|XP_006439823.1|  hypothetical protein CICLE_v10020868mg             265   8e-81   
gb|KDO69658.1|  hypothetical protein CISIN_1g018800mg                   264   1e-80   
ref|XP_006376856.1|  hypothetical protein POPTR_0012s08250g             264   1e-80   
ref|XP_006476779.1|  PREDICTED: probable inactive poly [ADP-ribos...    264   2e-80   
ref|XP_002318648.2|  hypothetical protein POPTR_0012s08250g             264   3e-80   Populus trichocarpa [western balsam poplar]
gb|KDO69659.1|  hypothetical protein CISIN_1g018800mg                   263   4e-80   
ref|XP_007209290.1|  hypothetical protein PRUPE_ppa007712mg             263   4e-80   
ref|XP_011028562.1|  PREDICTED: probable inactive poly [ADP-ribos...    264   4e-80   
ref|XP_006476778.1|  PREDICTED: probable inactive poly [ADP-ribos...    262   6e-80   
ref|XP_011001533.1|  PREDICTED: probable inactive poly [ADP-ribos...    263   8e-80   
ref|XP_006476777.1|  PREDICTED: probable inactive poly [ADP-ribos...    262   9e-80   
ref|XP_009789645.1|  PREDICTED: probable inactive poly [ADP-ribos...    260   1e-78   
ref|XP_002282800.2|  PREDICTED: probable inactive poly [ADP-ribos...    258   3e-78   Vitis vinifera
emb|CAN67883.1|  hypothetical protein VITISV_022357                     255   2e-77   Vitis vinifera
ref|XP_004152554.1|  PREDICTED: probable inactive poly [ADP-ribos...    257   2e-77   
ref|XP_004172680.1|  PREDICTED: probable inactive poly [ADP-ribos...    256   3e-77   
gb|KDP31098.1|  hypothetical protein JCGZ_11474                         256   3e-77   
ref|XP_008393031.1|  PREDICTED: probable inactive poly [ADP-ribos...    255   4e-77   
ref|XP_008374434.1|  PREDICTED: probable inactive poly [ADP-ribos...    255   7e-77   
ref|XP_009363019.1|  PREDICTED: probable inactive poly [ADP-ribos...    253   3e-76   
ref|XP_011101326.1|  PREDICTED: probable inactive poly [ADP-ribos...    251   3e-75   
ref|XP_008438396.1|  PREDICTED: probable inactive poly [ADP-ribos...    250   7e-75   
emb|CDP12412.1|  unnamed protein product                                247   5e-74   
gb|KHG28315.1|  putative inactive poly [ADP-ribose] polymerase SR...    245   1e-73   
ref|XP_010027645.1|  PREDICTED: probable inactive poly [ADP-ribos...    245   4e-73   
ref|XP_007036227.1|  RCD one 5, putative isoform 1                      245   8e-73   
ref|XP_010027684.1|  PREDICTED: probable inactive poly [ADP-ribos...    243   3e-72   
ref|XP_002511397.1|  conserved hypothetical protein                     243   3e-72   Ricinus communis
ref|XP_010251252.1|  PREDICTED: probable inactive poly [ADP-ribos...    242   5e-72   
ref|XP_007036228.1|  RCD one 5, putative isoform 2                      242   6e-72   
ref|XP_003631261.1|  PREDICTED: probable inactive poly [ADP-ribos...    235   7e-70   
ref|XP_004298944.1|  PREDICTED: probable inactive poly [ADP-ribos...    237   7e-70   
gb|KCW83377.1|  hypothetical protein EUGRSUZ_B00313                     235   2e-69   
ref|XP_008389655.1|  PREDICTED: probable inactive poly [ADP-ribos...    231   4e-68   
ref|XP_009596826.1|  PREDICTED: probable inactive poly [ADP-ribos...    230   3e-67   
ref|XP_008221823.1|  PREDICTED: probable inactive poly [ADP-ribos...    229   3e-67   
ref|XP_006374521.1|  hypothetical protein POPTR_0015s08760g             226   5e-67   
ref|XP_010678769.1|  PREDICTED: probable inactive poly [ADP-ribos...    229   5e-67   
ref|XP_011071853.1|  PREDICTED: probable inactive poly [ADP-ribos...    228   3e-66   
ref|XP_008340039.1|  PREDICTED: probable inactive poly [ADP-ribos...    224   2e-65   
gb|KCW83379.1|  hypothetical protein EUGRSUZ_B00314                     224   2e-65   
ref|XP_010547808.1|  PREDICTED: probable inactive poly [ADP-ribos...    224   2e-65   
ref|XP_010101215.1|  putative inactive poly [ADP-ribose] polymera...    224   1e-64   
ref|XP_008438409.1|  PREDICTED: probable inactive poly [ADP-ribos...    218   4e-63   
emb|CBI28528.3|  unnamed protein product                                215   4e-63   
gb|AAM64396.1|  unknown                                                 216   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002525374.1|  conserved hypothetical protein                     216   2e-62   Ricinus communis
ref|NP_201058.1|  probable inactive poly [ADP-ribose] polymerase ...    214   6e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009768131.1|  PREDICTED: probable inactive poly [ADP-ribos...    214   9e-62   
ref|XP_009768129.1|  PREDICTED: probable inactive poly [ADP-ribos...    214   1e-61   
gb|KDP26589.1|  hypothetical protein JCGZ_17747                         214   2e-61   
ref|XP_003525502.1|  PREDICTED: probable inactive poly [ADP-ribos...    212   7e-61   
ref|XP_010483966.1|  PREDICTED: probable inactive poly [ADP-ribos...    209   1e-59   
ref|XP_010458988.1|  PREDICTED: probable inactive poly [ADP-ribos...    208   1e-59   
ref|XP_010444100.1|  PREDICTED: probable inactive poly [ADP-ribos...    207   3e-59   
gb|KHN18456.1|  Putative inactive poly [ADP-ribose] polymerase SRO5     207   5e-59   
ref|XP_004508868.1|  PREDICTED: probable inactive poly [ADP-ribos...    207   6e-59   
ref|XP_006600645.1|  PREDICTED: probable inactive poly [ADP-ribos...    206   8e-59   
ref|XP_006281617.1|  hypothetical protein CARUB_v10027743mg             206   8e-59   
ref|XP_006600643.1|  PREDICTED: probable inactive poly [ADP-ribos...    206   9e-59   
ref|XP_006600644.1|  PREDICTED: probable inactive poly [ADP-ribos...    206   1e-58   
ref|XP_006600642.1|  PREDICTED: probable inactive poly [ADP-ribos...    206   1e-58   
ref|XP_010320567.1|  PREDICTED: probable inactive poly [ADP-ribos...    206   1e-58   
ref|XP_010045550.1|  PREDICTED: probable inactive poly [ADP-ribos...    205   4e-58   
gb|KEH31843.1|  inactive poly [ADP-ribose] polymerase SRO4              204   4e-58   
gb|KEH31844.1|  inactive poly [ADP-ribose] polymerase SRO4              204   5e-58   
ref|XP_007044660.1|  RCD one 2, putative isoform 2                      204   9e-58   
ref|XP_009590724.1|  PREDICTED: probable inactive poly [ADP-ribos...    204   9e-58   
ref|XP_009115512.1|  PREDICTED: probable inactive poly [ADP-ribos...    202   1e-57   
ref|XP_009130223.1|  PREDICTED: probable inactive poly [ADP-ribos...    202   1e-57   
emb|CDY44157.1|  BnaA09g30950D                                          202   1e-57   
ref|XP_006356437.1|  PREDICTED: probable inactive poly [ADP-ribos...    202   2e-57   
ref|XP_006394384.1|  hypothetical protein EUTSA_v10004619mg             201   6e-57   
ref|XP_007044659.1|  RCD one 2, putative isoform 1                      202   6e-57   
emb|CDY66230.1|  BnaAnng21860D                                          202   9e-57   
emb|CDY30723.1|  BnaA02g33450D                                          202   1e-56   
ref|XP_009590725.1|  PREDICTED: probable inactive poly [ADP-ribos...    200   1e-56   
ref|XP_011071855.1|  PREDICTED: probable inactive poly [ADP-ribos...    201   2e-56   
emb|CDY70596.1|  BnaAnng34290D                                          199   3e-56   
ref|XP_010477650.1|  PREDICTED: probable inactive poly [ADP-ribos...    200   3e-56   
ref|XP_010498866.1|  PREDICTED: probable inactive poly [ADP-ribos...    199   3e-56   
ref|XP_010552642.1|  PREDICTED: probable inactive poly [ADP-ribos...    199   6e-56   
ref|XP_007155430.1|  hypothetical protein PHAVU_003G200500g             199   7e-56   
ref|XP_006356433.1|  PREDICTED: probable inactive poly [ADP-ribos...    198   8e-56   
ref|XP_002890588.1|  predicted protein                                  197   3e-55   
ref|XP_006305404.1|  hypothetical protein CARUB_v10009796mg             197   3e-55   
ref|XP_010045553.1|  PREDICTED: probable inactive poly [ADP-ribos...    197   5e-55   
ref|XP_004501930.1|  PREDICTED: probable inactive poly [ADP-ribos...    194   2e-54   
ref|NP_173769.1|  probable inactive poly [ADP-ribose] polymerase ...    194   5e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004238657.1|  PREDICTED: probable inactive poly [ADP-ribos...    193   6e-54   
gb|KFK27981.1|  hypothetical protein AALP_AA8G456300                    193   6e-54   
ref|XP_007138076.1|  hypothetical protein PHAVU_009G178500g             195   1e-53   
ref|XP_003601269.1|  hypothetical protein MTR_3g077870                  192   2e-53   
ref|XP_010045554.1|  PREDICTED: probable inactive poly [ADP-ribos...    192   2e-53   
gb|EYU31252.1|  hypothetical protein MIMGU_mgv1a025306mg                192   3e-53   
ref|XP_009151374.1|  PREDICTED: probable inactive poly [ADP-ribos...    190   8e-53   
emb|CDY61348.1|  BnaC03g74760D                                          189   1e-52   
ref|XP_009619110.1|  PREDICTED: probable inactive poly [ADP-ribos...    190   1e-52   
gb|AAF79590.1|AC007945_10  F28C11.18                                    190   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006844999.1|  hypothetical protein AMTR_s00058p00198960          190   7e-52   
ref|XP_002308571.1|  hypothetical protein POPTR_0006s24720g             187   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_006416073.1|  hypothetical protein EUTSA_v10008227mg             186   3e-51   
emb|CDY51640.1|  BnaC05g50870D                                          186   3e-51   
gb|KDO82409.1|  hypothetical protein CISIN_1g022829mg                   184   9e-51   
ref|XP_006483865.1|  PREDICTED: probable inactive poly [ADP-ribos...    185   1e-50   
ref|XP_011019501.1|  PREDICTED: probable inactive poly [ADP-ribos...    185   1e-50   
ref|XP_010471034.1|  PREDICTED: probable inactive poly [ADP-ribos...    183   4e-50   
ref|XP_004297628.1|  PREDICTED: probable inactive poly [ADP-ribos...    183   5e-50   
ref|XP_006302598.1|  hypothetical protein CARUB_v10020702mg             182   1e-49   
emb|CDY54287.1|  BnaC07g48280D                                          181   2e-49   
gb|KHN30903.1|  Putative inactive poly [ADP-ribose] polymerase SRO5     181   2e-49   
ref|XP_003523079.1|  PREDICTED: probable inactive poly [ADP-ribos...    181   2e-49   
ref|XP_006578626.1|  PREDICTED: probable inactive poly [ADP-ribos...    181   3e-49   
emb|CDY57852.1|  BnaA07g38830D                                          180   5e-49   
ref|XP_010046157.1|  PREDICTED: probable inactive poly [ADP-ribos...    181   1e-48   
ref|XP_002888780.1|  hypothetical protein ARALYDRAFT_476164             179   1e-48   
ref|XP_009105706.1|  PREDICTED: probable inactive poly [ADP-ribos...    177   4e-48   
ref|XP_003629911.1|  hypothetical protein MTR_8g088250                  177   4e-48   
gb|KCW83380.1|  hypothetical protein EUGRSUZ_B00314                     177   6e-48   
ref|XP_007159536.1|  hypothetical protein PHAVU_002G245700g             176   9e-48   
ref|NP_177201.1|  probable inactive poly [ADP-ribose] polymerase ...    175   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427817.1|  PREDICTED: probable inactive poly [ADP-ribos...    175   6e-47   
ref|XP_011009692.1|  PREDICTED: probable inactive poly [ADP-ribos...    175   8e-47   
ref|XP_008790405.1|  PREDICTED: probable inactive poly [ADP-ribos...    178   8e-47   
ref|XP_011019509.1|  PREDICTED: probable inactive poly [ADP-ribos...    174   1e-46   
gb|KHN34314.1|  Putative inactive poly [ADP-ribose] polymerase SRO5     176   2e-46   
ref|XP_002308573.1|  hypothetical protein POPTR_0006s24750g             173   4e-46   Populus trichocarpa [western balsam poplar]
emb|CDY25790.1|  BnaA07g09920D                                          172   4e-46   
ref|XP_006390889.1|  hypothetical protein EUTSA_v10019788mg             172   4e-46   
ref|XP_009103166.1|  PREDICTED: probable inactive poly [ADP-ribos...    172   4e-46   
ref|XP_009103165.1|  PREDICTED: probable inactive poly [ADP-ribos...    172   6e-46   
ref|XP_004504414.1|  PREDICTED: probable inactive poly [ADP-ribos...    171   6e-46   
ref|XP_010498867.1|  PREDICTED: probable inactive poly [ADP-ribos...    170   2e-45   
emb|CDY11593.1|  BnaC06g31460D                                          171   2e-45   
ref|XP_006585197.1|  PREDICTED: probable inactive poly [ADP-ribos...    169   3e-45   
ref|XP_010551574.1|  PREDICTED: probable inactive poly [ADP-ribos...    170   3e-45   
ref|XP_010936236.1|  PREDICTED: probable inactive poly [ADP-ribos...    173   5e-45   
ref|XP_006404346.1|  hypothetical protein EUTSA_v10011103mg             170   6e-45   
ref|XP_008444977.1|  PREDICTED: probable inactive poly [ADP-ribos...    172   1e-44   
ref|NP_974981.1|  probable inactive poly [ADP-ribose] polymerase ...    166   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002324757.2|  hypothetical protein POPTR_0018s05040g             169   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_009411334.1|  PREDICTED: probable inactive poly [ADP-ribos...    171   3e-44   
gb|AFK40348.1|  unknown                                                 167   6e-44   
ref|XP_010939313.1|  PREDICTED: probable inactive poly [ADP-ribos...    169   2e-43   
ref|NP_190356.2|  probable inactive poly [ADP-ribose] polymerase ...    164   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009775772.1|  PREDICTED: probable inactive poly [ADP-ribos...    169   4e-43   
ref|XP_008785694.1|  PREDICTED: probable inactive poly [ADP-ribos...    168   5e-43   
ref|XP_002875860.1|  hypothetical protein ARALYDRAFT_323380             164   7e-43   
ref|XP_009341582.1|  PREDICTED: probable inactive poly [ADP-ribos...    169   1e-42   
ref|XP_004148400.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    167   1e-42   
ref|XP_003561862.1|  PREDICTED: probable inactive poly [ADP-ribos...    166   1e-42   
ref|XP_010515080.1|  PREDICTED: probable inactive poly [ADP-ribos...    164   1e-42   
ref|XP_003613057.1|  hypothetical protein MTR_5g032190                  167   2e-42   
ref|XP_009618750.1|  PREDICTED: probable inactive poly [ADP-ribos...    167   2e-42   
emb|CAB41855.1|  putative protein                                       162   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503382.1|  PREDICTED: probable inactive poly [ADP-ribos...    162   3e-42   
ref|XP_004489757.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    167   4e-42   
gb|AAC18815.1|  F17O7.2                                                 161   9e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426219.1|  PREDICTED: probable inactive poly [ADP-ribos...    160   2e-41   
gb|EMT23623.1|  hypothetical protein F775_03099                         163   2e-41   
ref|XP_002988021.1|  hypothetical protein SELMODRAFT_447190             166   3e-41   
emb|CBI33838.3|  unnamed protein product                                160   5e-41   
ref|XP_006293007.1|  hypothetical protein CARUB_v10019284mg             158   1e-40   
ref|XP_008375548.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    162   1e-40   
emb|CDP18551.1|  unnamed protein product                                157   1e-40   
ref|XP_008231814.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    162   1e-40   
ref|XP_001777080.1|  predicted protein                                  156   1e-40   
ref|XP_002276953.2|  PREDICTED: inactive poly [ADP-ribose] polyme...    160   5e-40   Vitis vinifera
emb|CAN61759.1|  hypothetical protein VITISV_006105                     160   6e-40   Vitis vinifera
ref|XP_001757896.1|  predicted protein                                  161   7e-40   
ref|XP_008790406.1|  PREDICTED: probable inactive poly [ADP-ribos...    159   8e-40   
ref|XP_009400059.1|  PREDICTED: probable inactive poly [ADP-ribos...    158   1e-39   
ref|XP_006849443.1|  hypothetical protein AMTR_s00024p00059840          160   2e-39   
ref|XP_009388429.1|  PREDICTED: probable inactive poly [ADP-ribos...    155   3e-39   
ref|XP_010518915.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    158   3e-39   
ref|XP_009400060.1|  PREDICTED: probable inactive poly [ADP-ribos...    157   3e-39   
ref|XP_010518916.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    158   5e-39   
gb|KEH44337.1|  inactive poly [ADP-ribose] polymerase RCD1              157   5e-39   
ref|XP_008785695.1|  PREDICTED: probable inactive poly [ADP-ribos...    157   5e-39   
ref|XP_010518913.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    157   6e-39   
ref|XP_009341584.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    156   9e-39   
gb|KDO50333.1|  hypothetical protein CISIN_1g013071mg                   152   1e-38   
gb|KDO50334.1|  hypothetical protein CISIN_1g013071mg                   152   1e-38   
gb|KEH44339.1|  inactive poly [ADP-ribose] polymerase RCD1              156   1e-38   
gb|KHN48060.1|  Putative inactive poly [ADP-ribose] polymerase SRO2     150   2e-38   
ref|XP_010939314.1|  PREDICTED: probable inactive poly [ADP-ribos...    155   2e-38   
ref|XP_006438378.1|  hypothetical protein CICLE_v10032827mg             148   2e-38   
ref|XP_006585196.1|  PREDICTED: probable inactive poly [ADP-ribos...    150   2e-38   
ref|XP_006432737.1|  hypothetical protein CICLE_v10001062mg             154   3e-38   
ref|XP_006432739.1|  hypothetical protein CICLE_v10001062mg             154   4e-38   
gb|KDO50332.1|  hypothetical protein CISIN_1g013071mg                   154   4e-38   
ref|XP_006432738.1|  hypothetical protein CICLE_v10001062mg             153   6e-38   
ref|XP_010266789.1|  PREDICTED: probable inactive poly [ADP-ribos...    154   7e-38   
ref|XP_002309510.2|  hypothetical protein POPTR_0006s24760g             151   7e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006651191.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    152   1e-37   
ref|XP_010055259.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    153   1e-37   
gb|KCW71724.1|  hypothetical protein EUGRSUZ_E00230                     153   1e-37   
ref|XP_006471515.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    154   1e-37   
ref|XP_007158260.1|  hypothetical protein PHAVU_002G137600g             153   1e-37   
ref|XP_006471514.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    154   2e-37   
gb|KCW66709.1|  hypothetical protein EUGRSUZ_F00472                     151   3e-37   
ref|XP_006853728.1|  hypothetical protein AMTR_s00056p00165600          154   3e-37   
ref|XP_008219150.1|  PREDICTED: probable inactive poly [ADP-ribos...    151   3e-37   
ref|XP_009399446.1|  PREDICTED: probable inactive poly [ADP-ribos...    146   4e-37   
ref|XP_010060144.1|  PREDICTED: probable inactive poly [ADP-ribos...    151   4e-37   
ref|XP_009413220.1|  PREDICTED: probable inactive poly [ADP-ribos...    152   5e-37   
ref|XP_009800759.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    152   6e-37   
ref|XP_003534287.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    152   6e-37   
gb|KHN38948.1|  Inactive poly [ADP-ribose] polymerase RCD1              150   2e-36   
ref|XP_002301130.1|  hypothetical protein POPTR_0002s11300g             149   2e-36   Populus trichocarpa [western balsam poplar]
gb|EYU38430.1|  hypothetical protein MIMGU_mgv1a003940mg                150   2e-36   
ref|XP_004512494.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    149   3e-36   
ref|XP_001782814.1|  predicted protein                                  142   4e-36   
emb|CDP00981.1|  unnamed protein product                                147   5e-36   
ref|XP_009625987.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    149   7e-36   
ref|XP_003516978.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    148   8e-36   
ref|XP_009397806.1|  PREDICTED: probable inactive poly [ADP-ribos...    144   8e-36   
ref|XP_011074308.1|  PREDICTED: probable inactive poly [ADP-ribos...    147   8e-36   
gb|EYU36416.1|  hypothetical protein MIMGU_mgv1a005594mg                147   9e-36   
ref|XP_008800068.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    148   1e-35   
ref|XP_007214795.1|  hypothetical protein PRUPE_ppa003072mg             147   2e-35   
ref|XP_009397805.1|  PREDICTED: probable inactive poly [ADP-ribos...    143   2e-35   
gb|KHN04854.1|  Inactive poly [ADP-ribose] polymerase RCD1              148   2e-35   
ref|XP_008347314.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    147   2e-35   
gb|EEE58642.1|  hypothetical protein OsJ_10018                          145   3e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010245245.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    147   3e-35   
emb|CDP18552.1|  unnamed protein product                                145   6e-35   
ref|NP_001049456.1|  Os03g0230300                                       145   6e-35   Oryza sativa Japonica Group [Japonica rice]
gb|KHF97830.1|  Inactive poly [ADP-ribose] polymerase RCD1              145   7e-35   
ref|XP_009107993.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    145   7e-35   
ref|XP_011017031.1|  PREDICTED: probable inactive poly [ADP-ribos...    145   7e-35   
ref|XP_008803591.1|  PREDICTED: probable inactive poly [ADP-ribos...    145   8e-35   
ref|XP_007158258.1|  hypothetical protein PHAVU_002G137500g             145   1e-34   
ref|XP_010276820.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    145   1e-34   
ref|XP_010678766.1|  PREDICTED: probable inactive poly [ADP-ribos...    142   1e-34   
ref|XP_010245242.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    146   1e-34   
ref|XP_009335476.1|  PREDICTED: probable inactive poly [ADP-ribos...    144   1e-34   
gb|KDP41553.1|  hypothetical protein JCGZ_15960                         144   2e-34   
ref|XP_010919988.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    144   2e-34   
ref|XP_009357224.1|  PREDICTED: probable inactive poly [ADP-ribos...    143   2e-34   
gb|KEH27736.1|  inactive poly [ADP-ribose] polymerase RCD1              144   2e-34   
gb|KEH27735.1|  inactive poly [ADP-ribose] polymerase RCD1              143   2e-34   
ref|XP_009388421.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    144   2e-34   
ref|XP_010669586.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    143   4e-34   
ref|XP_010920069.1|  PREDICTED: probable inactive poly [ADP-ribos...    140   4e-34   
gb|KHG18643.1|  Inactive poly [ADP-ribose] polymerase RCD1 -like ...    142   4e-34   
ref|XP_010678767.1|  PREDICTED: probable inactive poly [ADP-ribos...    140   5e-34   
ref|XP_008357587.1|  PREDICTED: probable inactive poly [ADP-ribos...    142   6e-34   
ref|XP_010540748.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    142   7e-34   
ref|XP_004244408.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    142   8e-34   
ref|XP_010540746.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    142   8e-34   
ref|XP_006361265.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    142   9e-34   
ref|XP_010933419.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    142   1e-33   
gb|EYU17668.1|  hypothetical protein MIMGU_mgv1a015403mg                134   1e-33   
ref|XP_007040702.1|  WWE protein-protein interaction domain prote...    141   2e-33   
ref|XP_009114903.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    141   2e-33   
ref|XP_008352749.1|  PREDICTED: probable inactive poly [ADP-ribos...    140   2e-33   
emb|CDY67026.1|  BnaCnng53220D                                          141   2e-33   
ref|XP_008368116.1|  PREDICTED: probable inactive poly [ADP-ribos...    140   3e-33   
ref|XP_002510015.1|  conserved hypothetical protein                     139   3e-33   Ricinus communis
ref|XP_010540749.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    140   3e-33   
ref|XP_010540747.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    140   3e-33   
ref|XP_010540745.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    140   3e-33   
ref|XP_002890975.1|  hypothetical protein ARALYDRAFT_473413             140   3e-33   
ref|NP_001154388.1|  inactive poly [ADP-ribose] polymerase RCD1         140   4e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CCH26549.1|  Radical-induced cell death 1                           140   5e-33   
ref|XP_004300204.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    140   5e-33   
ref|XP_007040697.1|  WWE protein-protein interaction domain prote...    140   6e-33   
ref|NP_849739.1|  inactive poly [ADP-ribose] polymerase RCD1            140   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004299848.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    139   7e-33   
emb|CCH26548.1|  Radical-induced cell death 1                           139   7e-33   
ref|XP_009114902.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    139   8e-33   
ref|XP_009384135.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    139   8e-33   
emb|CCH26566.1|  Radical-induced cell death 1                           139   8e-33   
gb|EYU17669.1|  hypothetical protein MIMGU_mgv1a015403mg                132   8e-33   
emb|CCH26559.1|  Radical-induced cell death 1                           139   8e-33   
emb|CCH26557.1|  Radical-induced cell death 1                           139   9e-33   
emb|CCH26552.1|  Radical-induced cell death 1                           139   9e-33   
ref|NP_564391.1|  inactive poly [ADP-ribose] polymerase RCD1            139   9e-33   
emb|CCH26561.1|  Radical-induced cell death 1                           139   9e-33   
emb|CDY22597.1|  BnaC05g24350D                                          139   1e-32   
gb|AES95791.2|  inactive poly [ADP-ribose] polymerase SRO4              137   1e-32   
emb|CAC14428.1|  ceo protein                                            139   2e-32   
ref|XP_006410709.1|  hypothetical protein EUTSA_v10016444mg             138   2e-32   
ref|XP_011069695.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    137   4e-32   
ref|XP_010667453.1|  PREDICTED: probable inactive poly [ADP-ribos...    137   5e-32   
ref|XP_009597260.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    137   6e-32   
ref|XP_008448639.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    137   6e-32   
ref|XP_010231657.1|  PREDICTED: probable inactive poly [ADP-ribos...    135   6e-32   
gb|AAO00681.1|  Unknown protein                                         136   8e-32   
gb|AAG23444.1|AC084165_10  unknown protein                              137   8e-32   
gb|AAK54509.1|AF317898_1  ATP8                                          136   9e-32   
ref|XP_006854080.1|  hypothetical protein AMTR_s00048p00122750          136   1e-31   
ref|XP_003560570.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   1e-31   
ref|XP_009798332.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   1e-31   
ref|XP_008658753.1|  PREDICTED: probable inactive poly [ADP-ribos...    136   1e-31   
ref|XP_002518985.1|  conserved hypothetical protein                     135   1e-31   
ref|XP_006368356.1|  hypothetical protein POPTR_0001s01980g             136   2e-31   
ref|XP_004150664.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   2e-31   
ref|XP_004165873.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   2e-31   
gb|EMS48695.1|  hypothetical protein TRIUR3_22494                       135   2e-31   
ref|XP_010053639.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   3e-31   
ref|XP_009397114.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   3e-31   
ref|XP_011018490.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   3e-31   
ref|XP_011018493.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   3e-31   
ref|XP_009397115.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   3e-31   
ref|XP_009769815.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   3e-31   
ref|XP_010053636.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   3e-31   
ref|XP_009615777.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   3e-31   
ref|XP_004136202.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    134   4e-31   
gb|EMT17371.1|  hypothetical protein F775_05839                         135   4e-31   
ref|XP_007018381.1|  WWE protein-protein interaction domain famil...    134   4e-31   
ref|XP_010905618.1|  PREDICTED: probable inactive poly [ADP-ribos...    136   4e-31   
ref|XP_009769814.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   4e-31   
ref|XP_010461042.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    134   4e-31   
ref|XP_004300203.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    135   4e-31   
gb|KGN60355.1|  hypothetical protein Csa_3G901000                       135   4e-31   
ref|XP_003612833.1|  hypothetical protein MTR_5g029580                  133   5e-31   
ref|XP_010905614.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    136   5e-31   
ref|XP_010042493.1|  PREDICTED: probable inactive poly [ADP-ribos...    125   6e-31   
ref|XP_006365969.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    134   6e-31   
gb|EMT03093.1|  hypothetical protein F775_26708                         134   7e-31   
ref|XP_010478646.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    134   7e-31   
emb|CDY43007.1|  BnaC05g28860D                                          134   8e-31   
ref|XP_008658755.1|  PREDICTED: probable inactive poly [ADP-ribos...    134   8e-31   
ref|XP_010461041.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    134   8e-31   
ref|XP_010478645.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    133   1e-30   
ref|XP_009384133.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    133   1e-30   
ref|XP_006415236.1|  hypothetical protein EUTSA_v10007192mg             133   1e-30   
gb|ACN27891.1|  unknown                                                 131   1e-30   
ref|XP_006303942.1|  hypothetical protein CARUB_v10008689mg             133   1e-30   
emb|CDY32124.1|  BnaC04g44420D                                          132   2e-30   
ref|XP_008806623.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    134   2e-30   
ref|XP_010104538.1|  putative inactive poly [ADP-ribose] polymera...    132   2e-30   
ref|XP_009141489.1|  PREDICTED: probable inactive poly [ADP-ribos...    132   2e-30   
ref|XP_010499771.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    132   2e-30   
ref|NP_001146014.1|  hypothetical protein                               131   2e-30   
ref|XP_009800757.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    132   2e-30   
ref|XP_003574384.1|  PREDICTED: probable inactive poly [ADP-ribos...    132   2e-30   
ref|XP_002283585.3|  PREDICTED: inactive poly [ADP-ribose] polyme...    131   2e-30   
ref|XP_009798330.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    132   4e-30   
ref|XP_010096927.1|  Inactive poly [ADP-ribose] polymerase RCD1         132   5e-30   
gb|KEH44338.1|  inactive poly [ADP-ribose] polymerase RCD1              130   6e-30   
ref|XP_009400762.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    130   7e-30   
ref|XP_006352905.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    130   8e-30   
ref|XP_008644248.1|  PREDICTED: hypothetical protein isoform X1         130   1e-29   
ref|XP_004985116.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    129   1e-29   
ref|XP_008466012.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    129   3e-29   
gb|AEK94072.1|  SRO1                                                    129   4e-29   
emb|CDY31694.1|  BnaA05g08530D                                          128   5e-29   
ref|NP_001065494.1|  Os10g0577800                                       128   7e-29   
ref|XP_002465607.1|  hypothetical protein SORBIDRAFT_01g042000          127   7e-29   
gb|EAY79639.1|  hypothetical protein OsI_34783                          128   7e-29   
ref|XP_008644251.1|  PREDICTED: hypothetical protein isoform X2         128   7e-29   
ref|XP_008653050.1|  PREDICTED: probable inactive poly [ADP-ribos...    126   8e-29   
ref|XP_004983535.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    127   1e-28   
ref|XP_009143661.1|  PREDICTED: probable inactive poly [ADP-ribos...    126   1e-28   
ref|XP_006356803.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    126   2e-28   
ref|XP_004241757.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    127   2e-28   
ref|XP_010509607.1|  PREDICTED: probable inactive poly [ADP-ribos...    126   2e-28   
ref|XP_002303439.2|  hypothetical protein POPTR_0003s09530g             126   3e-28   
ref|XP_011028113.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    126   3e-28   
ref|XP_011028112.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    126   3e-28   
ref|XP_011028108.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    126   4e-28   
emb|CCA61109.1|  RCD1 protein                                           125   4e-28   
dbj|BAJ95231.1|  predicted protein                                      125   4e-28   
ref|XP_004983536.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    125   5e-28   
ref|XP_010320246.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    124   8e-28   
ref|XP_008372584.1|  PREDICTED: probable inactive poly [ADP-ribos...    117   1e-27   
ref|NP_001051940.1|  Os03g0854800                                       122   1e-27   
emb|CDY60257.1|  BnaCnng35940D                                          120   2e-27   
ref|XP_010505058.1|  PREDICTED: probable inactive poly [ADP-ribos...    123   3e-27   
ref|XP_010325572.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    123   3e-27   
ref|XP_003621296.1|  hypothetical protein MTR_7g011550                  123   3e-27   
emb|CBI33839.3|  unnamed protein product                                122   3e-27   
ref|XP_004245934.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    123   4e-27   
ref|XP_010516725.1|  PREDICTED: probable inactive poly [ADP-ribos...    122   5e-27   
ref|XP_002463489.1|  hypothetical protein SORBIDRAFT_01g000700          122   5e-27   
gb|AGT17108.1|  RCD1 protein                                            122   6e-27   
ref|XP_002277020.2|  PREDICTED: inactive poly [ADP-ribose] polyme...    122   8e-27   
ref|XP_010920071.1|  PREDICTED: probable inactive poly [ADP-ribos...    119   8e-27   
ref|XP_010663151.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    122   8e-27   
ref|XP_010663169.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    122   9e-27   
ref|XP_007040704.1|  WWE protein-protein interaction domain prote...    121   1e-26   
gb|AAO66528.1|  putative CEO protein (alternative splicing products)    122   1e-26   
gb|KDP35446.1|  hypothetical protein JCGZ_10829                         122   1e-26   
gb|EAZ29354.1|  hypothetical protein OsJ_13421                          122   1e-26   
gb|EAY92641.1|  hypothetical protein OsI_14386                          122   1e-26   
ref|XP_011069699.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    120   1e-26   
ref|XP_004951488.1|  PREDICTED: uncharacterized protein LOC101782...    123   1e-26   
ref|XP_004951491.1|  PREDICTED: uncharacterized protein LOC101782...    122   1e-26   
gb|EMS56146.1|  hypothetical protein TRIUR3_28420                       119   2e-26   
ref|XP_006653008.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    122   2e-26   
gb|AEV41085.1|  putative RCD1                                           122   2e-26   
emb|CAN81025.1|  hypothetical protein VITISV_023316                     122   2e-26   
gb|AEV41131.1|  putative RCD1                                           122   3e-26   
ref|XP_006653007.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    122   3e-26   
emb|CAE03607.2|  OSJNBb0004A17.9                                        122   3e-26   
gb|EEE61888.1|  hypothetical protein OsJ_16585                          121   4e-26   
emb|CDX84199.1|  BnaC04g09610D                                          119   4e-26   
ref|XP_007040705.1|  WWE protein-protein interaction domain prote...    119   4e-26   
ref|XP_006650923.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    120   5e-26   
gb|EEC78230.1|  hypothetical protein OsI_17876                          121   5e-26   
emb|CAH67765.1|  H0322F07.2                                             121   6e-26   
ref|NP_001054224.1|  Os04g0672200                                       120   6e-26   
ref|XP_004302015.1|  PREDICTED: probable inactive poly [ADP-ribos...    118   6e-26   
ref|NP_565806.1|  probable inactive poly [ADP-ribose] polymerase ...    119   7e-26   
ref|XP_010228666.1|  PREDICTED: probable inactive poly [ADP-ribos...    120   7e-26   
ref|XP_010228663.1|  PREDICTED: probable inactive poly [ADP-ribos...    120   7e-26   
ref|XP_010933421.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    119   7e-26   
ref|XP_010228665.1|  PREDICTED: probable inactive poly [ADP-ribos...    120   8e-26   
ref|XP_010228664.1|  PREDICTED: probable inactive poly [ADP-ribos...    120   8e-26   
ref|XP_009769817.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    118   1e-25   
gb|KHG04226.1|  Inactive poly [ADP-ribose] polymerase RCD1 -like ...    119   1e-25   
ref|XP_010228662.1|  PREDICTED: probable inactive poly [ADP-ribos...    120   1e-25   
gb|AEV41038.1|  putative RCD1                                           119   2e-25   
ref|XP_002881400.1|  hypothetical protein ARALYDRAFT_482511             118   2e-25   
ref|XP_010664460.1|  PREDICTED: probable inactive poly [ADP-ribos...    117   2e-25   
ref|XP_010664461.1|  PREDICTED: probable inactive poly [ADP-ribos...    116   3e-25   
gb|AAL07215.1|  unknown protein                                         117   3e-25   
ref|XP_008644316.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    117   3e-25   
ref|XP_006293912.1|  hypothetical protein CARUB_v10022903mg             117   4e-25   
ref|XP_010235040.1|  PREDICTED: probable inactive poly [ADP-ribos...    115   5e-25   
dbj|BAO57693.1|  inactive poly [ADP-ribose] polymerase RCD1-like        112   7e-25   
ref|XP_008679319.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    117   1e-24   
ref|XP_004960116.1|  PREDICTED: uncharacterized protein LOC101785...    117   1e-24   
ref|XP_008679320.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    117   1e-24   
ref|XP_009417829.1|  PREDICTED: probable inactive poly [ADP-ribos...    114   1e-24   
ref|XP_011019510.1|  PREDICTED: probable inactive poly [ADP-ribos...    110   1e-24   
ref|XP_008679316.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    116   1e-24   
ref|XP_004980995.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    115   2e-24   
ref|XP_010920070.1|  PREDICTED: probable inactive poly [ADP-ribos...    112   2e-24   
ref|XP_009417828.1|  PREDICTED: inactive poly [ADP-ribose] polyme...    114   2e-24   
dbj|BAK02861.1|  predicted protein                                      115   2e-24   
gb|EMT14133.1|  hypothetical protein F775_21649                         115   3e-24   
emb|CDY41739.1|  BnaA08g06940D                                          114   3e-24   
gb|EMT27790.1|  hypothetical protein F775_04369                         111   5e-24   
gb|ABB48028.2|  Poly polymerase catalytic domain containing prote...    112   8e-24   
ref|XP_008658759.1|  PREDICTED: probable inactive poly [ADP-ribos...    112   9e-24   
ref|XP_002441661.1|  hypothetical protein SORBIDRAFT_08g000400          114   9e-24   
ref|XP_010516726.1|  PREDICTED: probable inactive poly [ADP-ribos...    111   1e-23   
ref|XP_009417830.1|  PREDICTED: probable inactive poly [ADP-ribos...    111   2e-23   
ref|XP_003580799.1|  PREDICTED: uncharacterized protein LOC100842408    113   2e-23   
gb|ABB48030.1|  Poly polymerase catalytic domain containing prote...    111   2e-23   
ref|XP_010516727.1|  PREDICTED: probable inactive poly [ADP-ribos...    110   2e-23   
gb|ABB48029.2|  Poly polymerase catalytic domain containing prote...    111   3e-23   
gb|ABB48027.2|  Poly polymerase catalytic domain containing prote...    111   3e-23   
dbj|BAJ96999.1|  predicted protein                                      109   4e-23   
ref|XP_008644252.1|  PREDICTED: hypothetical protein isoform X3         110   4e-23   
gb|EPS73692.1|  hypothetical protein M569_01065                         108   6e-23   
gb|AFW64535.1|  hypothetical protein ZEAMMB73_633681                    107   1e-22   
gb|AFW69032.1|  hypothetical protein ZEAMMB73_489428                    109   1e-22   
ref|XP_009141490.1|  PREDICTED: probable inactive poly [ADP-ribos...    108   2e-22   
gb|EMS48181.1|  hypothetical protein TRIUR3_19806                       110   2e-22   
gb|AFW89097.1|  hypothetical protein ZEAMMB73_663979                    106   3e-22   
gb|AAO66529.1|  putative CEO protein (alternative splicing products)    107   7e-22   
ref|XP_009381835.1|  PREDICTED: uncharacterized protein LOC103969927    106   1e-21   
ref|XP_010096925.1|  Inactive poly [ADP-ribose] polymerase RCD1         102   1e-20   
ref|XP_004229117.1|  PREDICTED: probable inactive poly [ADP-ribos...  99.8    1e-20   
ref|XP_007222842.1|  hypothetical protein PRUPE_ppa006683mg             100   7e-20   
gb|ACN30742.1|  unknown                                               97.1    6e-19   
gb|KCW62663.1|  hypothetical protein EUGRSUZ_G00207                   94.4    3e-18   
gb|EEE65448.1|  hypothetical protein OsJ_20812                        95.5    1e-17   
ref|XP_010678768.1|  PREDICTED: probable inactive poly [ADP-ribos...  90.1    5e-17   
gb|KHN06465.1|  Putative inactive poly [ADP-ribose] polymerase SRO2   88.2    1e-16   
ref|NP_001057288.1|  Os06g0248400                                     92.4    1e-16   
ref|XP_002865178.1|  predicted protein                                87.4    1e-16   
gb|EPS58940.1|  hypothetical protein M569_15873                       83.2    6e-16   
ref|XP_004238548.1|  PREDICTED: probable inactive poly [ADP-ribos...  85.1    2e-15   
ref|XP_009794457.1|  PREDICTED: probable inactive poly [ADP-ribos...  79.0    6e-14   
ref|XP_004501133.1|  PREDICTED: inactive poly [ADP-ribose] polyme...  82.8    7e-14   
ref|XP_007032308.1|  RCD one 1-like protein                           80.1    8e-14   
ref|XP_007223623.1|  hypothetical protein PRUPE_ppa012602mg           78.6    1e-13   
ref|XP_002886497.1|  predicted protein                                83.2    1e-13   
ref|XP_010045555.1|  PREDICTED: probable inactive poly [ADP-ribos...  79.0    2e-13   
emb|CAN78474.1|  hypothetical protein VITISV_026794                   79.7    1e-12   
gb|EMT24172.1|  Putative pentatricopeptide repeat-containing protein  80.1    1e-12   
ref|XP_002878921.1|  hypothetical protein ARALYDRAFT_344261           78.2    2e-12   
ref|XP_002306514.1|  hypothetical protein POPTR_0005s19360g           74.3    4e-12   
emb|CDY17771.1|  BnaC08g21790D                                        71.2    2e-10   
gb|KEH21634.1|  RCD1-SRO-TAF4 (RST) plant domain protein              61.6    9e-08   
gb|EPS58939.1|  hypothetical protein M569_15872                       58.2    3e-07   
ref|XP_010100456.1|  hypothetical protein L484_027768                 59.7    5e-07   
ref|XP_003795165.1|  PREDICTED: poly [ADP-ribose] polymerase 15       62.4    5e-07   
ref|XP_006743272.1|  PREDICTED: poly [ADP-ribose] polymerase 15       61.2    8e-07   
gb|ETO09059.1|  hypothetical protein RFI_28325                        57.4    2e-06   
ref|XP_004392000.1|  PREDICTED: poly [ADP-ribose] polymerase 15       58.9    4e-06   
ref|XP_003588707.1|  hypothetical protein MTR_1g011730                55.1    6e-06   
gb|KDO81363.1|  hypothetical protein CISIN_1g040573mg                 54.3    8e-06   
ref|XP_007099350.1|  PREDICTED: LOW QUALITY PROTEIN: poly (ADP-ri...  57.4    1e-05   
ref|XP_008980587.1|  PREDICTED: poly [ADP-ribose] polymerase 15       57.4    1e-05   
ref|XP_008706472.1|  PREDICTED: poly [ADP-ribose] polymerase 15       57.4    2e-05   



>ref|XP_009614824.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Nicotiana tomentosiformis]
Length=379

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/281 (49%), Positives = 209/281 (74%), Gaps = 7/281 (2%)
 Frame = -2

Query  956  HEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFS  777
            ++++N+ L+ V+EG++ + I+  K +SGL  +G    I +I K E  SS  K+AKLQSF 
Sbjct  71   YQEKNTDLMRVDEGDKVYGIIREKFMSGLGALGASTQITAIHK-ETCSSFTKQAKLQSFL  129

Query  776  LFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPL  597
            +F+KAVE+K G  N N+++AW GASK E+ +I  HGF PS N +G++ H + L PD++PL
Sbjct  130  IFSKAVEKKCGGNNANVKYAWFGASKDEINNIFSHGFVPSSN-NGAYSHAICLSPDNYPL  188

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
             CL +A+AD+NG+R +L CRVILGK+E+V PG+ QWHP+S EFD GVD+L+ P+KYIVWS
Sbjct  189  DCLQNAVADKNGIRDLLLCRVILGKSEVVHPGTGQWHPSSDEFDTGVDNLLSPRKYIVWS  248

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            T++N+++ P +++SF +++    ++   QRN V S K PNSP I+FP+L+S L+KFLPP 
Sbjct  249  TDMNSYVFPEFMVSFRVTS----HVKESQRNGVPS-KNPNSPWISFPALISALSKFLPPH  303

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
             ++ IT Y  DH+E KMTR ++++++R+LAGD+LL  I+K+
Sbjct  304  TIKLITKYHSDHKERKMTRRDLIQQVRKLAGDDLLTAIIKS  344



>ref|XP_009759861.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Nicotiana sylvestris]
Length=379

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/300 (46%), Positives = 211/300 (70%), Gaps = 11/300 (4%)
 Frame = -2

Query  956  HEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFS  777
            ++++N+ L+ ++EG++ + I+  K +SGL   G    I +I K+   SS  K+AKLQSF 
Sbjct  71   YQEKNTGLMRIDEGDKVYGIIREKFMSGLGAFGASTQITAIHKDT-CSSFTKQAKLQSFL  129

Query  776  LFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPL  597
            +F+KAVE+K G  +  +++AW GASK E+ +I  HGF  S N +G++ H + L PD++PL
Sbjct  130  IFSKAVEKKCGGNDAYVKYAWFGASKDEINNIFSHGFVHSSN-NGAYSHAICLSPDNYPL  188

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
             CL +A+AD+NGVRH+L CRVILG++E+V PG+ QWHP+S EFD GVD+L+ P+KYIVWS
Sbjct  189  DCLQNAVADKNGVRHLLLCRVILGRSEVVHPGTGQWHPSSDEFDTGVDNLLSPRKYIVWS  248

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            T +N+++ P +++SF +++    ++   QRN V + K PNSP I+FP+L+S L+KFLPP 
Sbjct  249  TQMNSYVFPEFMVSFRVTS----HVKESQRNGVPA-KNPNSPWISFPALISALSKFLPPH  303

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNKTGVRRN  57
             ++ IT Y  DH+E KMTR ++++ +R+LAGD+LL  I+K+ +    Y      TG+  N
Sbjct  304  TIKLITKYHSDHKERKMTRRDLIQHVRKLAGDDLLTSIIKSCK----YKHNKGSTGISSN  359



>ref|XP_006345059.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
isoform X2 [Solanum tuberosum]
Length=375

 Score =   281 bits (719),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/290 (48%), Positives = 207/290 (71%), Gaps = 8/290 (3%)
 Frame = -2

Query  968  VTDLHEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKL  789
            V  +HE+R+S L+ ++EG++ + I+  K +SGL   G+   I +I K E  SS +K+AKL
Sbjct  64   VGSVHEERSSGLMRIDEGDKIYGIISNKFLSGLGCFGLSTEITAIHK-ETCSSFIKQAKL  122

Query  788  QSFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPD  609
            QSF +F+KAVE+K G GN N+++AW GAS  E+ +I  HGF  S N +G++   + L PD
Sbjct  123  QSFLIFSKAVEKKCG-GNANVKYAWFGASNDEINNIFSHGFSHSSN-NGAYSQAICLSPD  180

Query  608  HFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKY  429
                 CL +A+ D+NGVRH+L CRVILGKTE+V PGS Q HP+S+E+D GVD+L  P+KY
Sbjct  181  DNSHDCLQAAVPDKNGVRHLLLCRVILGKTEVVHPGSGQCHPSSEEYDTGVDNLSSPRKY  240

Query  428  IVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKF  249
            IVWST++N+++ P +++SF +S+    +    QRN+V  ++ P SP ITFP+L+S L+KF
Sbjct  241  IVWSTHMNSYVFPEFMVSFRVSSHAKES----QRNTV-PVQNPKSPWITFPALISALSKF  295

Query  248  LPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
            LPPQ ++ IT Y  DH+  K+TR ++++++R+LAGDELL  I+K+ ++ Q
Sbjct  296  LPPQTVKLITKYHNDHKGRKITRRDLIQQVRKLAGDELLTAIIKSCKNKQ  345



>ref|XP_006345058.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
isoform X1 [Solanum tuberosum]
Length=376

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/290 (48%), Positives = 207/290 (71%), Gaps = 8/290 (3%)
 Frame = -2

Query  968  VTDLHEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKL  789
            V  +HE+R+S L+ ++EG++ + I+  K +SGL   G+   I +I K E  SS +K+AKL
Sbjct  64   VGSVHEERSSGLMRIDEGDKIYGIISNKFLSGLGCFGLSTEITAIHK-ETCSSFIKQAKL  122

Query  788  QSFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPD  609
            QSF +F+KAVE+K G GN N+++AW GAS  E+ +I  HGF  S N +G++   + L PD
Sbjct  123  QSFLIFSKAVEKKCG-GNANVKYAWFGASNDEINNIFSHGFSHSSN-NGAYSQAICLSPD  180

Query  608  HFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKY  429
                 CL +A+ D+NGVRH+L CRVILGKTE+V PGS Q HP+S+E+D GVD+L  P+KY
Sbjct  181  DNSHDCLQAAVPDKNGVRHLLLCRVILGKTEVVHPGSGQCHPSSEEYDTGVDNLSSPRKY  240

Query  428  IVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKF  249
            IVWST++N+++ P +++SF +S+    +    QRN+V  ++ P SP ITFP+L+S L+KF
Sbjct  241  IVWSTHMNSYVFPEFMVSFRVSSHAKES----QRNTV-PVQNPKSPWITFPALISALSKF  295

Query  248  LPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
            LPPQ ++ IT Y  DH+  K+TR ++++++R+LAGDELL  I+K+ ++ Q
Sbjct  296  LPPQTVKLITKYHNDHKGRKITRRDLIQQVRKLAGDELLTAIIKSCKNKQ  345



>ref|XP_010318907.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
isoform X1 [Solanum lycopersicum]
Length=376

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/290 (47%), Positives = 207/290 (71%), Gaps = 8/290 (3%)
 Frame = -2

Query  968  VTDLHEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKL  789
            V  +HE+R+S L+ ++EG++ + I+  K +SGL   G+   I +I+K E  SS +K+AKL
Sbjct  64   VGSVHEERSSGLMRIDEGDKIYGIISNKFLSGLGCFGLSTEITAIQK-ETCSSFVKQAKL  122

Query  788  QSFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPD  609
            QSF +F+KAVE+K   GN N+++AW G SK E+++I  HGF    N +G++   + L PD
Sbjct  123  QSFLIFSKAVEKKCS-GNANVKYAWFGGSKDEISNIFSHGFSCRSN-NGAYSQAICLSPD  180

Query  608  HFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKY  429
                 CL +A+ D+NGVRH+L CRVILGKTE+V PGS Q HP+S+E+D GVD+L  P+K+
Sbjct  181  DNSHDCLQAAVPDKNGVRHLLLCRVILGKTEVVHPGSGQCHPSSEEYDTGVDNLSSPRKF  240

Query  428  IVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKF  249
            IVWST++N+++ P +++SF +S+    +    QRN+V  ++ P SP ITFP+L+S L+KF
Sbjct  241  IVWSTHMNSYVFPEFMVSFRVSSHAKES----QRNAV-PIQNPKSPWITFPALISALSKF  295

Query  248  LPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
            LPPQ ++ IT Y  DH+  K+TR ++++++R+LAGDELL  I+K+ ++ Q
Sbjct  296  LPPQTVKLITKYHNDHKGRKITRRDLIQQVRKLAGDELLTAIIKSCKNKQ  345



>ref|XP_004236104.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
isoform X2 [Solanum lycopersicum]
Length=375

 Score =   276 bits (706),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/290 (47%), Positives = 207/290 (71%), Gaps = 8/290 (3%)
 Frame = -2

Query  968  VTDLHEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKL  789
            V  +HE+R+S L+ ++EG++ + I+  K +SGL   G+   I +I+K E  SS +K+AKL
Sbjct  64   VGSVHEERSSGLMRIDEGDKIYGIISNKFLSGLGCFGLSTEITAIQK-ETCSSFVKQAKL  122

Query  788  QSFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPD  609
            QSF +F+KAVE+K   GN N+++AW G SK E+++I  HGF    N +G++   + L PD
Sbjct  123  QSFLIFSKAVEKKCS-GNANVKYAWFGGSKDEISNIFSHGFSCRSN-NGAYSQAICLSPD  180

Query  608  HFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKY  429
                 CL +A+ D+NGVRH+L CRVILGKTE+V PGS Q HP+S+E+D GVD+L  P+K+
Sbjct  181  DNSHDCLQAAVPDKNGVRHLLLCRVILGKTEVVHPGSGQCHPSSEEYDTGVDNLSSPRKF  240

Query  428  IVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKF  249
            IVWST++N+++ P +++SF +S+    +    QRN+V  ++ P SP ITFP+L+S L+KF
Sbjct  241  IVWSTHMNSYVFPEFMVSFRVSSHAKES----QRNAV-PIQNPKSPWITFPALISALSKF  295

Query  248  LPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
            LPPQ ++ IT Y  DH+  K+TR ++++++R+LAGDELL  I+K+ ++ Q
Sbjct  296  LPPQTVKLITKYHNDHKGRKITRRDLIQQVRKLAGDELLTAIIKSCKNKQ  345



>ref|XP_008239766.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Prunus mume]
Length=387

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 137/286 (48%), Positives = 198/286 (69%), Gaps = 10/286 (3%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N RL+ + +GNR H +++++ VS L  +G  A + +I +N +SS ++ +A+L+SF ++ K
Sbjct  76   NDRLVALFDGNRVHDLIKQRFVSSLGLLGPHANVVAIHRNSYSS-LVGQARLRSFQIYLK  134

Query  764  AVEEKSGFGNGNMQFAWLG-ASKKELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLG  594
            AVEEK G GN N+++AW   +SK E++ I+ HGF       KDG +G GVYL PD  PL 
Sbjct  135  AVEEKCG-GNPNVKYAWYAPSSKDEISKIICHGFGHHEKPQKDGLYGSGVYLAPDDSPLT  193

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
            C+  +  DE+G+RH+L CRVILG+ E+V PGS Q+HPTS+EFD GVD+ + PKKYIVWST
Sbjct  194  CVEGSNVDEDGLRHLLLCRVILGRPEVVHPGSEQYHPTSEEFDSGVDNPIAPKKYIVWST  253

Query  413  NINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQI  234
             +NTHILP Y+ISF   T     L G  +    S+KKP SP +  P+L+  L+KFLPP  
Sbjct  254  YMNTHILPEYVISFRAPTC----LKGFLKTQ-ESIKKPTSPWMPLPALIGVLSKFLPPPT  308

Query  233  MQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            +  I+ + KDHRE K++R E+++R+R++AGD+LL  I+K+ R  QI
Sbjct  309  IALISKHYKDHREDKISRHELIQRVRQIAGDKLLASIIKSFRAKQI  354



>ref|XP_006439822.1| hypothetical protein CICLE_v10020868mg [Citrus clementina]
 gb|ESR53062.1| hypothetical protein CICLE_v10020868mg [Citrus clementina]
Length=348

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/284 (47%), Positives = 199/284 (70%), Gaps = 13/284 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI ++EG++ + ++  +L+SGL  +G QA I SI +N FS  VM +AK+QSF +FAKAV 
Sbjct  74   LISLQEGDKVYDLISGRLISGLGVLGAQAKIVSIHRNSFSG-VMGRAKIQSFQIFAKAVA  132

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFD----PSMNKDGSFGHGVYLCPDHFPLGCL  588
            +K G G+ N+++AW   SK E++ I++HGF     PS N  G +G GVYL PD  PL C+
Sbjct  133  QKCG-GDANVKYAWYAGSKDEISKIIEHGFGYCGKPSNN--GMYGCGVYLSPDDSPLECV  189

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
             ++  D  G+R++L CRVILGK E+V PGS Q+HP++ EF+ GVD+L  PKKYI+WSTN+
Sbjct  190  KNSAIDREGMRYLLLCRVILGKQEVVHPGSDQYHPSTGEFESGVDNLQVPKKYILWSTNM  249

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            NTHILP YIIS  +   ++   FG  ++   SL+ P SP + FP L+S L+KFLPP  + 
Sbjct  250  NTHILPEYIIS--LKAPSSMKGFGRVQD---SLRVPTSPWMPFPILISALSKFLPPPTVA  304

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
             ++ Y +DH+  K++R E+++R+R++AGD+LLI ++K+ R  Q+
Sbjct  305  LMSKYYRDHKGKKVSRHELIQRVRQIAGDQLLIAVIKSYRAKQL  348



>ref|XP_006439823.1| hypothetical protein CICLE_v10020868mg [Citrus clementina]
 gb|ESR53063.1| hypothetical protein CICLE_v10020868mg [Citrus clementina]
Length=352

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/280 (48%), Positives = 197/280 (70%), Gaps = 13/280 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI ++EG++ + ++  +L+SGL  +G QA I SI +N FS  VM +AK+QSF +FAKAV 
Sbjct  74   LISLQEGDKVYDLISGRLISGLGVLGAQAKIVSIHRNSFSG-VMGRAKIQSFQIFAKAVA  132

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFD----PSMNKDGSFGHGVYLCPDHFPLGCL  588
            +K G G+ N+++AW   SK E++ I++HGF     PS N  G +G GVYL PD  PL C+
Sbjct  133  QKCG-GDANVKYAWYAGSKDEISKIIEHGFGYCGKPSNN--GMYGCGVYLSPDDSPLECV  189

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
             ++  D  G+R++L CRVILGK E+V PGS Q+HP++ EF+ GVD+L  PKKYI+WSTN+
Sbjct  190  KNSAIDREGMRYLLLCRVILGKQEVVHPGSDQYHPSTGEFESGVDNLQVPKKYILWSTNM  249

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            NTHILP YIIS  +   ++   FG  ++   SL+ P SP + FP L+S L+KFLPP  + 
Sbjct  250  NTHILPEYIIS--LKAPSSMKGFGRVQD---SLRVPTSPWMPFPILISALSKFLPPPTVA  304

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
             ++ Y +DH+  K++R E+++R+R++AGD+LLI ++K+ R
Sbjct  305  LMSKYYRDHKGKKVSRHELIQRVRQIAGDQLLIAVIKSYR  344



>gb|KDO69658.1| hypothetical protein CISIN_1g018800mg [Citrus sinensis]
Length=348

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/284 (47%), Positives = 198/284 (70%), Gaps = 13/284 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI ++EG++ + ++  +L+SGL  +G QA I SI +N FS  VM +AK+QSF +FAKAV 
Sbjct  74   LISLQEGDKVYDLISGRLISGLGVLGAQAKIVSIHRNSFSG-VMGQAKIQSFQIFAKAVA  132

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFD----PSMNKDGSFGHGVYLCPDHFPLGCL  588
            +K G G+ N+++AW   +K E+  I++HGF     PS N  G +G GVYL PD  PL C+
Sbjct  133  QKCG-GDANVKYAWYAGTKDEICKIIEHGFGYCGKPSNN--GMYGCGVYLSPDDSPLECV  189

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
             ++  D  G+R++L CRVILGK E+V PGS Q+HP++ EF+ GVD+L  PKKYI+WSTN+
Sbjct  190  KNSAIDREGMRYLLLCRVILGKQEVVHPGSDQYHPSTGEFESGVDNLQVPKKYILWSTNM  249

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            NTHILP YIIS  +   ++   FG  ++   SL+ P SP + FP L+S L+KFLPP  + 
Sbjct  250  NTHILPEYIIS--LKAPSSMKGFGRVQD---SLRVPTSPWMPFPILISALSKFLPPPTVA  304

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
             ++ Y +DH+  K++R E+++R+R++AGD+LLI ++K+ R  Q+
Sbjct  305  LMSKYYRDHKGKKVSRHELIQRVRQIAGDQLLIAVIKSYRAKQL  348



>ref|XP_006376856.1| hypothetical protein POPTR_0012s08250g [Populus trichocarpa]
 gb|ERP54653.1| hypothetical protein POPTR_0012s08250g [Populus trichocarpa]
Length=347

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 198/281 (70%), Gaps = 9/281 (3%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N  L+ + EG+R H +++R+ VSGL  +G QA + +I +N +S  V+++A++QSF +FAK
Sbjct  67   NDGLVRLFEGDRVHDLIKRRFVSGLGLLGKQATVVAIHRNSYSG-VLEQARMQSFQIFAK  125

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSM--NKDGSFGHGVYLCPDHFPLGC  591
            A+E+K G G+ N++F W G ++ E+  I++HGF   M  N +G +G G+YL PD  P+ C
Sbjct  126  AMEKKCG-GDANVKFGWYGGTRDEICEIVKHGFSARMIDNSNGLYGCGIYLSPDDSPVEC  184

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
            +     D++G+RH+L CR+ILGK+E+V PGS Q  P+S+EFD G+D+L  PKKYI+WST+
Sbjct  185  VKKLSVDKDGLRHLLLCRLILGKSEVVHPGSDQCRPSSEEFDSGMDNLTSPKKYILWSTH  244

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +NTHILP ++ISF   +     L G  R    SL++PNSP + FP+L+S L+KFLPP   
Sbjct  245  MNTHILPEFVISFRAPS----RLKGYFRIP-ESLRRPNSPWMPFPALISALSKFLPPTTT  299

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            + I  Y +DHRE K++R ++++++R+  GD+LLI ++K+ R
Sbjct  300  KLIIKYHRDHREKKISRQQLIQQVRKTVGDKLLISVIKSFR  340



>ref|XP_006476779.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
isoform X3 [Citrus sinensis]
Length=348

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 195/282 (69%), Gaps = 9/282 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI ++EG++ + ++  +L+SGL  +G QA I SI +N FS  VM +AK+QSF +F KAV 
Sbjct  74   LISLQEGDKVYDLISGRLISGLGVLGAQAKIVSIHRNSFSG-VMGQAKIQSFQIFVKAVA  132

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNS  582
            +K G G+ N+++AW   +K E+  I++HGF      N DG +G GVYL PD  PL C+ +
Sbjct  133  QKCG-GDANVKYAWYAGTKDEICKIIEHGFGYCGKPNNDGMYGCGVYLSPDDSPLECVKN  191

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            +  D  G+R++L CRVILGK E+V PG+ Q+HP++ EF+ GVD+L  PKKYI+WSTN+NT
Sbjct  192  SAIDREGMRYLLLCRVILGKQEVVHPGTDQYHPSTGEFESGVDNLQVPKKYILWSTNMNT  251

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HILP YIIS    +  +   FG  ++   SL+ P SP + FP L+S L+KFLPP  +  +
Sbjct  252  HILPEYIISLKAPS--SMKGFGRVQD---SLRVPTSPWMPFPILISALSKFLPPPTIALM  306

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            + Y +DH+  K++R E+++R+R++AGD+LLI ++K+ R  Q+
Sbjct  307  SKYYRDHKGKKVSRHELIQRVRQIAGDQLLIAVIKSYRAKQL  348



>ref|XP_002318648.2| hypothetical protein POPTR_0012s08250g [Populus trichocarpa]
 gb|EEE96868.2| hypothetical protein POPTR_0012s08250g [Populus trichocarpa]
Length=379

 Score =   264 bits (674),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 198/281 (70%), Gaps = 9/281 (3%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N  L+ + EG+R H +++R+ VSGL  +G QA + +I +N +S  V+++A++QSF +FAK
Sbjct  67   NDGLVRLFEGDRVHDLIKRRFVSGLGLLGKQATVVAIHRNSYSG-VLEQARMQSFQIFAK  125

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSM--NKDGSFGHGVYLCPDHFPLGC  591
            A+E+K G G+ N++F W G ++ E+  I++HGF   M  N +G +G G+YL PD  P+ C
Sbjct  126  AMEKKCG-GDANVKFGWYGGTRDEICEIVKHGFSARMIDNSNGLYGCGIYLSPDDSPVEC  184

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
            +     D++G+RH+L CR+ILGK+E+V PGS Q  P+S+EFD G+D+L  PKKYI+WST+
Sbjct  185  VKKLSVDKDGLRHLLLCRLILGKSEVVHPGSDQCRPSSEEFDSGMDNLTSPKKYILWSTH  244

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +NTHILP ++ISF   +     L G  R    SL++PNSP + FP+L+S L+KFLPP   
Sbjct  245  MNTHILPEFVISFRAPS----RLKGYFRIP-ESLRRPNSPWMPFPALISALSKFLPPTTT  299

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            + I  Y +DHRE K++R ++++++R+  GD+LLI ++K+ R
Sbjct  300  KLIIKYHRDHREKKISRQQLIQQVRKTVGDKLLISVIKSFR  340



>gb|KDO69659.1| hypothetical protein CISIN_1g018800mg [Citrus sinensis]
Length=350

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/280 (47%), Positives = 196/280 (70%), Gaps = 13/280 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI ++EG++ + ++  +L+SGL  +G QA I SI +N FS  VM +AK+QSF +FAKAV 
Sbjct  74   LISLQEGDKVYDLISGRLISGLGVLGAQAKIVSIHRNSFSG-VMGQAKIQSFQIFAKAVA  132

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFD----PSMNKDGSFGHGVYLCPDHFPLGCL  588
            +K G G+ N+++AW   +K E+  I++HGF     PS N  G +G GVYL PD  PL C+
Sbjct  133  QKCG-GDANVKYAWYAGTKDEICKIIEHGFGYCGKPSNN--GMYGCGVYLSPDDSPLECV  189

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
             ++  D  G+R++L CRVILGK E+V PGS Q+HP++ EF+ GVD+L  PKKYI+WSTN+
Sbjct  190  KNSAIDREGMRYLLLCRVILGKQEVVHPGSDQYHPSTGEFESGVDNLQVPKKYILWSTNM  249

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            NTHILP YIIS  +   ++   FG  ++   SL+ P SP + FP L+S L+KFLPP  + 
Sbjct  250  NTHILPEYIIS--LKAPSSMKGFGRVQD---SLRVPTSPWMPFPILISALSKFLPPPTVA  304

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
             ++ Y +DH+  K++R E+++R+R++AGD+LLI ++K+ R
Sbjct  305  LMSKYYRDHKGKKVSRHELIQRVRQIAGDQLLIAVIKSYR  344



>ref|XP_007209290.1| hypothetical protein PRUPE_ppa007712mg [Prunus persica]
 gb|EMJ10489.1| hypothetical protein PRUPE_ppa007712mg [Prunus persica]
Length=358

 Score =   263 bits (672),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 132/282 (47%), Positives = 195/282 (69%), Gaps = 10/282 (4%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N  L+ + +G+R H +++++ VS L  +G  A + +I +N +SS ++ +A+L+SF ++ K
Sbjct  81   NDGLVALFDGDRVHDLIKQRFVSSLGLLGPHANVVAIHRNSYSS-LVGQARLRSFQIYLK  139

Query  764  AVEEKSGFGNGNMQFAWLG-ASKKELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLG  594
            AVEEK G GN N+++AW   +SK E++ I+ HGF       KDG +G GVYL PD  P+ 
Sbjct  140  AVEEKCG-GNPNVKYAWYAPSSKDEISKIICHGFGHHEKPQKDGLYGSGVYLAPDDSPMT  198

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
            C+  +  DE+G+RH+L CRVILG+ E+V PGS Q+HP+S+EFD GVD+ + PKKYIVWST
Sbjct  199  CVEGSNVDEDGLRHLLLCRVILGRPEVVHPGSEQYHPSSEEFDSGVDNPIAPKKYIVWST  258

Query  413  NINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQI  234
             +NTHILP Y+ISF   T     L G  +    S+KKP SP + FP+L+  L+KFLPP  
Sbjct  259  YMNTHILPEYVISFRAPTC----LKGFLKTQ-ESIKKPTSPWMPFPALIGVLSKFLPPPT  313

Query  233  MQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
               I+ + KDHRE K++R E+++R+R++AGD+LL  I+K+ R
Sbjct  314  FALISKHYKDHRENKISRHELIQRVRQIAGDKLLASIIKSFR  355



>ref|XP_011028562.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Populus euphratica]
 ref|XP_011016113.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Populus euphratica]
Length=383

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/288 (45%), Positives = 197/288 (68%), Gaps = 9/288 (3%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N  LI + EG+R H +++++ VSGL  +G +A + +I +N +S  V+++A++QSF L AK
Sbjct  71   NDGLIRLFEGDRVHDLIKQRFVSGLGLLGKKATVVAIHRNTYSG-VLEQARMQSFQLIAK  129

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSM--NKDGSFGHGVYLCPDHFPLGC  591
            A+E+K G G+ N++F W G ++ E+  I++HGF   M  N +G +G G+YL PD  P+ C
Sbjct  130  AMEKKCG-GDANVKFGWYGGTRDEICEIMKHGFSARMIDNSNGLYGSGIYLSPDDSPVEC  188

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
            +      ++G+RH+L CRVILGK E+V PGS Q+HP+S EFD G+D L  PKKYIVWS +
Sbjct  189  VKKLNVGKDGLRHMLLCRVILGKAEVVHPGSDQYHPSSDEFDSGMDSLSSPKKYIVWSAH  248

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +NTHILP Y+ISF+  +    +L G  R    SL+KP SP + FPSL+S L+KFLPP   
Sbjct  249  MNTHILPEYVISFSAPS----SLKGYFRIP-ESLRKPTSPWMPFPSLISALSKFLPPTAT  303

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTS  87
            + I  Y + HR  K++R E+++++R++ GD+LLI ++K+ R   + TS
Sbjct  304  KLIIKYYRAHRAKKISRQELIQQVRKIVGDKLLISVIKSFRTKMLVTS  351



>ref|XP_006476778.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
isoform X2 [Citrus sinensis]
Length=352

 Score =   262 bits (670),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 194/278 (70%), Gaps = 9/278 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI ++EG++ + ++  +L+SGL  +G QA I SI +N FS  VM +AK+QSF +F KAV 
Sbjct  74   LISLQEGDKVYDLISGRLISGLGVLGAQAKIVSIHRNSFSG-VMGQAKIQSFQIFVKAVA  132

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNS  582
            +K G G+ N+++AW   +K E+  I++HGF      N DG +G GVYL PD  PL C+ +
Sbjct  133  QKCG-GDANVKYAWYAGTKDEICKIIEHGFGYCGKPNNDGMYGCGVYLSPDDSPLECVKN  191

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            +  D  G+R++L CRVILGK E+V PG+ Q+HP++ EF+ GVD+L  PKKYI+WSTN+NT
Sbjct  192  SAIDREGMRYLLLCRVILGKQEVVHPGTDQYHPSTGEFESGVDNLQVPKKYILWSTNMNT  251

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HILP YIIS  +   ++   FG  ++   SL+ P SP + FP L+S L+KFLPP  +  +
Sbjct  252  HILPEYIIS--LKAPSSMKGFGRVQD---SLRVPTSPWMPFPILISALSKFLPPPTIALM  306

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            + Y +DH+  K++R E+++R+R++AGD+LLI ++K+ R
Sbjct  307  SKYYRDHKGKKVSRHELIQRVRQIAGDQLLIAVIKSYR  344



>ref|XP_011001533.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Populus euphratica]
Length=379

 Score =   263 bits (672),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 128/288 (44%), Positives = 200/288 (69%), Gaps = 9/288 (3%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N  L+ + EG+R H +++R+ VSGL  +G QA + +I +N +S  V+++A++QSF +F K
Sbjct  67   NDGLVRLFEGDRVHDLIKRRFVSGLGLLGKQATVVAIHRNSYSG-VLEQARMQSFQIFVK  125

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSM--NKDGSFGHGVYLCPDHFPLGC  591
            A+E K G G+ N++F W G ++ E+  I++HGF   M  N +G +G G+YL PD  P+ C
Sbjct  126  AMENKCG-GDANVKFGWYGGTRDEICEIVKHGFSARMIDNSNGLYGCGIYLSPDDSPVEC  184

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
            +     +++G+RH+L CR+ILGK+E+V PGS Q HP+S+EFD G+D+L  PKKYI+WST+
Sbjct  185  VKKLSVEKDGLRHLLLCRLILGKSEVVHPGSDQCHPSSEEFDSGMDNLSSPKKYILWSTH  244

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +NTHILP ++ISF   +     L G  R    SL++PNSP + FP+L+S L+KFLPP   
Sbjct  245  MNTHILPEFVISFRAPS----RLKGYFRIP-ESLRRPNSPWMPFPALISTLSKFLPPTTT  299

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTS  87
            + I  Y +DHRE K++R ++++++R+  GD+LLI ++K+ R   + TS
Sbjct  300  KLIIKYHRDHREKKISRQQLIQQVRKTVGDKLLISVIKSFRTEILGTS  347



>ref|XP_006476777.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
isoform X1 [Citrus sinensis]
Length=367

 Score =   262 bits (670),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 193/278 (69%), Gaps = 9/278 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI ++EG++ + ++  +L+SGL  +G QA I SI +N FS  VM +AK+QSF +F KAV 
Sbjct  74   LISLQEGDKVYDLISGRLISGLGVLGAQAKIVSIHRNSFSG-VMGQAKIQSFQIFVKAVA  132

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNS  582
            +K G G+ N+++AW   +K E+  I++HGF      N DG +G GVYL PD  PL C+ +
Sbjct  133  QKCG-GDANVKYAWYAGTKDEICKIIEHGFGYCGKPNNDGMYGCGVYLSPDDSPLECVKN  191

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            +  D  G+R++L CRVILGK E+V PG+ Q+HP++ EF+ GVD+L  PKKYI+WSTN+NT
Sbjct  192  SAIDREGMRYLLLCRVILGKQEVVHPGTDQYHPSTGEFESGVDNLQVPKKYILWSTNMNT  251

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HILP YIIS    +  +   FG  ++   SL+ P SP + FP L+S L+KFLPP  +  +
Sbjct  252  HILPEYIISLKAPS--SMKGFGRVQD---SLRVPTSPWMPFPILISALSKFLPPPTIALM  306

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            + Y +DH+  K++R E+++R+R++AGD+LLI ++K+ R
Sbjct  307  SKYYRDHKGKKVSRHELIQRVRQIAGDQLLIAVIKSYR  344



>ref|XP_009789645.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Nicotiana sylvestris]
Length=391

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/280 (47%), Positives = 194/280 (69%), Gaps = 10/280 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI ++EG++ HQI+ +K +SGL  +G+   IE+I+KN +SS  M+ A+LQSF  F+KA+E
Sbjct  89   LIRIDEGDKMHQIINKKFISGLGILGLSTQIEAIDKNAYSSFTMQ-ARLQSFLRFSKAME  147

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
            +K G GN N ++AW GASK ++ SI  HGF   MN +G++GH + L P  +PL CL +A+
Sbjct  148  KKCG-GNANEKYAWFGASKDDIDSIFSHGFGNPMN-NGAYGHCICLSPYDYPLDCLQTAI  205

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
             D++G+RH+L  RVILG+ E+V PG  Q HPTS++FD GVD+L  P+KYIVWS+N+N +I
Sbjct  206  PDKDGLRHLLLSRVILGRLEVVHPGLGQSHPTSEQFDTGVDNLHSPRKYIVWSSNMNAYI  265

Query  395  LPLYIISF-TISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
             P ++ISF  IS +    +F V       LK P+S  I+FP+L+S L+K LPP  ++ I 
Sbjct  266  FPDFVISFRIISKVKESRIFSV------PLKSPSSAWISFPALISALSKILPPNTVKLIK  319

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
             Y  D++E K+TR  ++++  +LAGDELL  I+K+ +  Q
Sbjct  320  KYHSDYKERKITRRGLIQQATKLAGDELLALIIKSCKTKQ  359



>ref|XP_002282800.2| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Vitis vinifera]
 ref|XP_010663176.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Vitis vinifera]
 emb|CBI15032.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/293 (45%), Positives = 198/293 (68%), Gaps = 10/293 (3%)
 Frame = -2

Query  956  HEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFS  777
            H +    L+ ++E  + H+I+E+ LVSGL  +    ++  I +N ++S V+ +A+LQSF 
Sbjct  33   HNEHIHGLVRLDEDEKLHRIIEKALVSGLGPLRQHTSVVDIHRNGYAS-VISQARLQSFR  91

Query  776  LFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPL  597
            +F +AVE+K   GN N++F W  ASK E+  I+ HGF  S   +G +G GVYL P H  +
Sbjct  92   IFGRAVEKKCE-GNANVKFGWYSASKDEIGRIISHGFSHS---NGLYGCGVYLYPHHSSI  147

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
              + S + DE+G+RH+L CRVILGK E+V PGS+Q+HP+S++FD GVD+L  PKKYIVWS
Sbjct  148  ESMKSCVVDEDGLRHLLLCRVILGKMEVVHPGSQQYHPSSEDFDSGVDNLPAPKKYIVWS  207

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            T++NTHILP Y+++F         L G   N+  SLKKP SP + F +L+S L+KFLPPQ
Sbjct  208  THMNTHILPEYVVTFRAPPC----LKGF-LNTQGSLKKPTSPWMPFTTLISVLSKFLPPQ  262

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGN  78
             +  I  + +DHRE K+ R E+++ +R++AGD+LL  ++K+ R  Q+ ++ G+
Sbjct  263  SVNLIAKHHRDHRENKIPRHELIRLVRQIAGDKLLTVVIKSHRAKQLNSTNGS  315



>emb|CAN67883.1| hypothetical protein VITISV_022357 [Vitis vinifera]
Length=341

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/293 (44%), Positives = 197/293 (67%), Gaps = 10/293 (3%)
 Frame = -2

Query  956  HEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFS  777
            H +    L+ ++E  + H+I+E+  VSGL  +    ++  I +N ++S V+ +A+LQSF 
Sbjct  30   HNEHIHGLVRLDEDEKLHRIIEKAXVSGLGPLRQHTSVVDIHRNGYAS-VISQARLQSFR  88

Query  776  LFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPL  597
            +F +AVE+K   GN N++F W  ASK E+  I+ HGF  S   +G +G GVYL P H  +
Sbjct  89   IFGRAVEKKCE-GNANVKFGWYSASKDEIGRIISHGFSHS---NGLYGCGVYLYPHHSSI  144

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
              + S + DE+G+RH+L CRVILGK E+V PGS+Q+HP+S++FD GVD+L  PKKYIVWS
Sbjct  145  ESMKSCVVDEDGLRHLLLCRVILGKMEVVHPGSQQYHPSSEDFDSGVDNLPAPKKYIVWS  204

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            T++NTHILP Y+++F         L G   N+  SLKKP SP + F +L+S L+KFLPPQ
Sbjct  205  THMNTHILPEYVVTFRAPPC----LKGF-LNTQGSLKKPTSPWMPFTTLISVLSKFLPPQ  259

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGN  78
             +  I  + +DHRE K+ R E+++ +R++AGD+LL  ++K+ R  Q+ ++ G+
Sbjct  260  SVNLIAKHHRDHRENKIPRHELIRLVRQIAGDKLLTVVIKSHRAKQLNSTNGS  312



>ref|XP_004152554.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
[Cucumis sativus]
 gb|KGN64308.1| hypothetical protein Csa_1G046060 [Cucumis sativus]
Length=388

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 201/309 (65%), Gaps = 24/309 (8%)
 Frame = -2

Query  953  EQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSL  774
            E RN  L+ + E ++ + +++R+ VSGL  +G Q  + ++ KN  S+ +  +A+L +F +
Sbjct  76   EWRNEGLVKLVEEDKIYDLIKRRFVSGLGLLGPQTTVSAVYKNSHSTHI-GQARLHTFQI  134

Query  773  FAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS--FGHGVYLCPDHFP  600
            ++KAVE+K+G GN N+++AWLGASK ++ SIL +GF      + S   G G+YL PD+ P
Sbjct  135  YSKAVEKKNG-GNANVKYAWLGASKDQINSILGYGFSHCNKPESSQCLGSGIYLSPDNHP  193

Query  599  LGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVW  420
            L  L  A+ D +G+RH+L CRV+LGK+EL+ PGSRQ HP+ + FD G D+L  PKKYIVW
Sbjct  194  LESLEDAVVDADGLRHLLLCRVVLGKSELIHPGSRQNHPSCEAFDSGADNLFAPKKYIVW  253

Query  419  STNINTHILPLYIISFTI-----STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELA  255
            ST++NTHILP Y+ISF        TL A   F          + P SP + FPSL+S L+
Sbjct  254  STHMNTHILPEYLISFRTPPRLKGTLKARQPF----------RMPTSPWMPFPSLISVLS  303

Query  254  KFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI-----YT  90
            K+LP   +  IT Y KDHR+ K++R E++KR+R +AGD+LLI ++K+ R  +      + 
Sbjct  304  KYLPAPEIAMITKYHKDHRDHKISRHELIKRVRLIAGDKLLIHVIKSFRTQESNVDVGFE  363

Query  89   SMGNKTGVR  63
              G+++G R
Sbjct  364  GKGSRSGAR  372



>ref|XP_004172680.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
[Cucumis sativus]
Length=388

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 201/309 (65%), Gaps = 24/309 (8%)
 Frame = -2

Query  953  EQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSL  774
            E RN  L+ + E ++ + +++R+ VSGL  +G Q  + ++ KN  S+ +  +A+L +F +
Sbjct  76   EWRNEGLVKLVEEDKIYDLIKRRFVSGLGLLGPQTTVSAVYKNSHSTHI-GQARLHTFQI  134

Query  773  FAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS--FGHGVYLCPDHFP  600
            ++KAVE+K+G GN N+++AWLGASK ++ SIL +GF      + S   G G+YL PD+ P
Sbjct  135  YSKAVEKKNG-GNANVKYAWLGASKDQINSILGYGFSHCNKPESSQCLGSGIYLSPDNHP  193

Query  599  LGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVW  420
            L  L  A+ D +G+RH+L CRV+LGK+EL+ PGSRQ HP+ + FD G D+L  PKKYIVW
Sbjct  194  LESLEDAVVDADGLRHLLLCRVVLGKSELIHPGSRQNHPSCEAFDSGADNLFAPKKYIVW  253

Query  419  STNINTHILPLYIISFTI-----STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELA  255
            ST++NTHILP Y+ISF        TL A   F          + P SP + FPSL+S L+
Sbjct  254  STHMNTHILPEYLISFRTPPRLKGTLKARQPF----------RMPTSPWMPFPSLISVLS  303

Query  254  KFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI-----YT  90
            K+LP   +  IT Y KDHR+ K++R E++KR+R +AGD+LLI ++K+ R  +      + 
Sbjct  304  KYLPAPEIAMITKYHKDHRDHKISRHELIKRVRLIAGDKLLIHVIKSFRTQESNGDVGFE  363

Query  89   SMGNKTGVR  63
              G+++G R
Sbjct  364  GKGSRSGAR  372



>gb|KDP31098.1| hypothetical protein JCGZ_11474 [Jatropha curcas]
Length=378

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 190/274 (69%), Gaps = 8/274 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG+R H +++R+ +SGL  +G QA + +I +N +S  ++ +A+++SF +  KA+E
Sbjct  66   LVRIFEGDRVHDLIKRRFLSGLGSLGKQATVTAIYRNTYSG-IIDQARMKSFQILTKAME  124

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKD-GSFGHGVYLCPDHFPLGCLNSA  579
            +K   GN N++FAW G S  E+  I++HGF   +N + G +G G+YL PD  PL  + + 
Sbjct  125  DKCN-GNANVKFAWFGDSTDEICKIMKHGFGSQINNNNGLYGCGIYLSPDDSPLESVKNL  183

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
              D+NG+RH+L CRVILGK E+V PGS Q HP+S+EFD G+D+L+ PKKYIVWST++NT 
Sbjct  184  KVDKNGLRHLLLCRVILGKPEIVHPGSDQGHPSSEEFDSGIDNLLSPKKYIVWSTHMNTR  243

Query  398  ILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
            ILP Y+ISF  S      L G +R    +   P SP + FP++++ L+KFLPP  +  I 
Sbjct  244  ILPEYVISFKASPC----LKGFRRIREPA-GIPTSPWMPFPAVITALSKFLPPTTVGLIA  298

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
             Y +DHRE K++R E+++R+R+LAGD+LLI ++K
Sbjct  299  KYHRDHREKKISRQELIQRVRQLAGDKLLIAVIK  332



>ref|XP_008393031.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Malus domestica]
Length=365

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/283 (44%), Positives = 193/283 (68%), Gaps = 10/283 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ +  G+R H +++++ VS L  +G Q ++ ++ +N +SS V  +A+L+SF ++ KAVE
Sbjct  66   LVPLFNGDRVHDLIKQRFVSSLGLLGTQVSVVAVHRNSYSSPV-GQARLRSFQIYLKAVE  124

Query  755  EKSGFGNGNMQFAWLGA-SKKELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLN  585
            EK G GN N+++AW    SK E++ I+ HGF       ++G +G+GVYL PDH P+ C+ 
Sbjct  125  EKCG-GNPNVKYAWYAPYSKDEISKIICHGFGNFEQQQRNGVYGNGVYLAPDHSPMQCVE  183

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
                DE+G+RH+L CRVILG+ E+V PGS+Q HP+S++FD G+D++  PKKY VWST++N
Sbjct  184  GLNVDEDGLRHLLLCRVILGRPEVVCPGSKQHHPSSEQFDSGIDNIFAPKKYJVWSTHMN  243

Query  404  THILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQS  225
            THILP Y+ISF   +    +   +Q      +KKP SP + FP L+  L+KFLPP  +  
Sbjct  244  THILPEYVISFRAPSC-LKDFLKIQE----PIKKPTSPWMPFPVLIGVLSKFLPPPTIAL  298

Query  224  ITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            I+ Y K+HR   +TR ++++++R++AGDELL+ I+K+ R  QI
Sbjct  299  ISKYYKEHRANVITRQQLIQKVRQIAGDELLVSIIKSFRAKQI  341



>ref|XP_008374434.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Malus domestica]
Length=363

 Score =   255 bits (651),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 198/287 (69%), Gaps = 14/287 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + +G+R H +++++ +S L  +G QA++ ++ +N +SS ++ +A+L+SF ++ KAVE
Sbjct  69   LVPLFDGDRVHDLIKQRFLSSLGLLGAQASVVAVHRNSYSS-LVGQARLRSFQIYLKAVE  127

Query  755  EKSGFGNGNMQFAWLG-ASKKELTSILQHGF----DPSMNKDGSFGHGVYLCPDHFPLGC  591
            EK G GN N+++AW   +SK E++ I+ HGF     P  N  G+FG+GVYL PD  PL  
Sbjct  128  EKCG-GNPNVKYAWFAPSSKDEISKIICHGFGNFEQPQTN--GAFGNGVYLAPDDSPLQL  184

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
            + S   DE+G+RH+L CRVILG+ E+V PGS+Q HP+S++FD G+D +  PKKYIVWST+
Sbjct  185  VESLNVDEDGLRHLLLCRVILGRPEVVCPGSKQHHPSSEQFDSGIDSIFAPKKYIVWSTH  244

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +NTHILP Y+ISF         L  VQ      +KKP SP + FP+L+  L+KFLPP  +
Sbjct  245  MNTHILPEYVISFRAPNC-LKELLKVQE----PVKKPTSPWMPFPALIGVLSKFLPPPSI  299

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYT  90
              I+ + KDHRE  +TR ++++++R++AGD+LL  I+K+ R  QI T
Sbjct  300  ALISKHYKDHRENVITRQQLIQKVRQIAGDKLLASIIKSFRAKQIKT  346



>ref|XP_009363019.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Pyrus x bretschneideri]
Length=365

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/283 (44%), Positives = 194/283 (69%), Gaps = 10/283 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + +G+R H +++++ VS L  +G Q ++ ++ +N +SS ++ +A+L+SF ++ KAVE
Sbjct  66   LVPLFDGDRVHDLIKQRFVSSLGLLGTQVSVVAVHRNSYSS-LVGQARLRSFQIYLKAVE  124

Query  755  EKSGFGNGNMQFAWLGA-SKKELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLN  585
            EK G GN NM++AW    SK E++ I+ HGF       ++G +G+GVYL PD  P+ C+ 
Sbjct  125  EKCG-GNPNMKYAWYAPYSKDEISKIICHGFGNFEQQQRNGVYGNGVYLAPDDSPMQCME  183

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            S   DE+G+RH+L CRVILG+ E+V PGS+Q HP+S++FD G+D +  PKKYIVWST++N
Sbjct  184  SLNVDEDGLRHLLLCRVILGRPEVVCPGSKQLHPSSEQFDSGIDSIFAPKKYIVWSTHMN  243

Query  404  THILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQS  225
            THILP Y+ISF        +   +Q      +KKP SP + F +L+  L+KFLPP  +  
Sbjct  244  THILPEYVISFRAPNC-LKDFLKIQE----PIKKPTSPWMPFQALIGVLSKFLPPPTIAL  298

Query  224  ITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            I+ Y K+HR   +TR ++++++R++AGDELL+ I+K+ R  QI
Sbjct  299  ISKYYKEHRANVITRQQLIQKVRQIAGDELLVSIIKSFRAKQI  341



>ref|XP_011101326.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Sesamum indicum]
Length=372

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/276 (45%), Positives = 195/276 (71%), Gaps = 8/276 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI V++G   ++I+++KLVS L   G  A +E+I++N+FS  +  +AKLQSF ++++A+E
Sbjct  90   LIRVDDGEVVYEIIKKKLVSSLSCYGFDAQVEAIQRNDFSG-ITCRAKLQSFCIYSRAME  148

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
             K G GN N+++AW GASK E++ IL HGF   MN   + GHGV+L P   P+  +  A 
Sbjct  149  IKCG-GNANVKYAWFGASKDEISKILDHGFGLPMNAR-THGHGVHLSPVDHPVESMELAS  206

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
             DE+G+RH+L CRVILGKTE+V PGS Q+HP+ +EFD G+D+L  P+KYIVWS+++NTHI
Sbjct  207  PDEDGLRHMLLCRVILGKTEVVCPGSEQYHPSCEEFDSGIDNLASPQKYIVWSSSMNTHI  266

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LP +++SF  S+    +  G Q+    + ++ NS  + F SL++ L+KFLPP  ++ I+ 
Sbjct  267  LPEFVVSFRASS----SCRGSQKGRQPT-RQANSDWMPFSSLITTLSKFLPPDAIELISK  321

Query  215  YVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
               D+++ KM+R EM++ +R++AGD+LL+ I+K+ R
Sbjct  322  NYGDYKKQKMSRHEMIQLVRQVAGDKLLMTIIKSYR  357



>ref|XP_008438396.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
isoform X1 [Cucumis melo]
Length=388

 Score =   250 bits (639),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 197/306 (64%), Gaps = 19/306 (6%)
 Frame = -2

Query  953  EQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSL  774
            E RN  L+ + E ++ + +++R+ ++GL  +G Q  + ++ KN  S+ +  +A+L +F +
Sbjct  76   EWRNEGLVKLVEEDKIYDLIKRRFLTGLGLLGPQTTVSAVYKNSHSTHI-GQARLHTFQI  134

Query  773  FAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS--FGHGVYLCPDHFP  600
            +++AVE+K+  GN N+++AWLGASK ++ SIL +GF      + S   G G+YL PD+ P
Sbjct  135  YSQAVEKKNS-GNANVKYAWLGASKDQINSILDYGFSHCNKPESSQFLGSGIYLSPDNHP  193

Query  599  LGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVW  420
            L  L   + D +G+RH+L CRV+LGK+EL+ PGSRQ HP+ + FD G DDL  PKKYIVW
Sbjct  194  LESLEDTVVDGDGLRHLLLCRVVLGKSELIHPGSRQNHPSCEAFDSGADDLFAPKKYIVW  253

Query  419  STNINTHILPLYIISFTI-----STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELA  255
            ST++NTHILP Y+ISF        TL A   F          + P SP + FPSL+S L+
Sbjct  254  STHMNTHILPEYLISFRTPPRLKGTLKARQPF----------RMPTSPWMPFPSLISVLS  303

Query  254  KFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNK  75
            K+LP   +  IT Y KDHR+ K++R E++KR+R +AGD+LLI ++K+ R  +    +G +
Sbjct  304  KYLPAPEIAMITKYHKDHRDHKISRHELIKRVRLIAGDKLLIHVIKSFRTQESNGDVGFE  363

Query  74   TGVRRN  57
                RN
Sbjct  364  GKGSRN  369



>emb|CDP12412.1| unnamed protein product [Coffea canephora]
Length=347

 Score =   247 bits (630),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/277 (45%), Positives = 194/277 (70%), Gaps = 11/277 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGM-QAAIESIEKNEFSSSVMKKAKLQSFSLFAKAV  759
             I V+E +++H+ ++++ VS L   G+    IE+I KN   SS   +A+  SFS+F++A+
Sbjct  78   FIKVDEDDKQHEFIKQRFVSSLTERGLTHPQIEAIHKNA-CSSWTARARFMSFSIFSRAL  136

Query  758  EEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSA  579
            ++K+  G+ N+++AW GASK E+ +I  HGF  ++N DG +G G+YL P    L  + S+
Sbjct  137  QKKTE-GHPNVKYAWYGASKDEIRNIFLHGFGNTLN-DGIYGRGIYLYPSDSLLESIQSS  194

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
            + DE+G+RH++ CRV+LG+ E+V P   Q HP+S+EFD GVD+L+ P+KYIVWST++N  
Sbjct  195  VVDEDGLRHLVLCRVVLGRMEIVHPN--QSHPSSEEFDSGVDNLLSPRKYIVWSTHMNNQ  252

Query  398  ILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
            I P Y++SF +    A NL G QR S   LK P+SP + FP+L++ LAKFLPP  +++I 
Sbjct  253  IFPEYVVSFRL----ASNLKGCQRIS-PPLKMPSSPWMPFPTLITALAKFLPPNSIKAIQ  307

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
             +  DHRE K+TR E+++R+RR+AGD+LL+ ++K+ R
Sbjct  308  KHHSDHREKKITRQELIQRVRRIAGDDLLVAVIKSFR  344



>gb|KHG28315.1| putative inactive poly [ADP-ribose] polymerase SRO5 -like protein 
[Gossypium arboreum]
Length=339

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/285 (45%), Positives = 196/285 (69%), Gaps = 9/285 (3%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N+ LI +  G++ H ++ R+ +S L  + +     +I+KN F+  V  +A+LQSF +F K
Sbjct  57   NNGLIQLGSGDKAHDLITRRFLSNLGSMAVHIKDLTIQKNCFAG-VTWQARLQSFQIFIK  115

Query  764  AVEEK-SGFGNGNMQFAWLGASKKELTSILQHGFDPSM--NKDGSFGHGVYLCPDHFPLG  594
            A+E+K  G G+ N+++AW  A++ E+  I++HGF         G +GHG+YL PD  P+ 
Sbjct  116  AMEKKCGGGGDANVKYAWCAATRDEICKIVKHGFGHCGLPKNSGLYGHGIYLSPDDSPME  175

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
             + +A+AD+NGVR+++ CRVILGK ELV+PGS+Q HP+S EFD GVDDL  PKKY+VWST
Sbjct  176  SVKNAVADKNGVRYLMLCRVILGKAELVQPGSKQCHPSSDEFDSGVDDLSSPKKYVVWST  235

Query  413  NINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQI  234
            ++NTHILP +I+SF  +T +     G+Q      LK P SP I+FP+L+S L+K+LPP  
Sbjct  236  HLNTHILPEFIVSFR-ATSSLKGFLGMQDR----LKMPTSPWISFPALISALSKYLPPTA  290

Query  233  MQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
            +  I+ Y KDH++ K++R E+++ +R+ AGD+LLI ++K+ R  Q
Sbjct  291  INLISKYYKDHKDKKISRHELIQFVRQFAGDKLLIAVIKSSRTKQ  335



>ref|XP_010027645.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Eucalyptus grandis]
 ref|XP_010027653.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Eucalyptus grandis]
 gb|KCW83373.1| hypothetical protein EUGRSUZ_B00305 [Eucalyptus grandis]
Length=354

 Score =   245 bits (625),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/283 (43%), Positives = 188/283 (66%), Gaps = 9/283 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L  + EG+R H +++ + VS L  +  Q A+  I +N ++S V  KA+ Q+F ++++AV+
Sbjct  76   LTELGEGDRVHGLIKERFVSRLGALAAQVAVVGIHQNRYAS-VAAKARAQAFQVYSEAVQ  134

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPS---MNKDGSFGHGVYLCPDHFPLGCLN  585
            +K G    N+++AW   SK+E++ IL +GF  S    + +G +G G+Y  PD  PL  + 
Sbjct  135  KKGGGDTANVRYAWYATSKEEVSKILSYGFGYSGKPESNNGLYGCGIYFSPDSHPLESVK  194

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            SA  DE+G+RH+L CRVILGK ELV PGS Q HP+S+++D GVDDL  P++YIVWST++N
Sbjct  195  SAPRDEDGLRHLLLCRVILGKPELVSPGSEQSHPSSEQYDSGVDDLSSPRRYIVWSTHMN  254

Query  404  THILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQS  225
            TH+LP Y++SF         L G+ R    S +KP SP + FP+L+SEL+K L P  +  
Sbjct  255  THVLPEYVVSFRAPCC----LRGLLRTPEKS-RKPTSPWMPFPTLISELSKILRPSDVSL  309

Query  224  ITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            I+ Y KDH+ GK++R  +++++R++AGD LL +I+K+ R  Q 
Sbjct  310  ISKYYKDHKGGKISRHVLIQKVRQIAGDGLLTRIIKSFRIKQF  352



>ref|XP_007036227.1| RCD one 5, putative isoform 1 [Theobroma cacao]
 gb|EOY20728.1| RCD one 5, putative isoform 1 [Theobroma cacao]
Length=384

 Score =   245 bits (625),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/293 (42%), Positives = 194/293 (66%), Gaps = 13/293 (4%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N+ L+ +  G++ H ++ ++ +S L  +       +I KN F   V  +A+LQSF +F K
Sbjct  65   NNGLVRLFPGDKAHDVIMKRFLSNLGALAAHTKDLTIHKNSFLG-VTWQARLQSFQIFIK  123

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFD----PSMNKDGSFGHGVYLCPDHFPL  597
            A+E+K G G+ N+++AW  AS+ E+  I++HGF     P     G +G G+YL PD  P+
Sbjct  124  AMEKKCG-GDANIKYAWCSASRDEICKIVEHGFGHFGLPE--NSGLYGCGLYLSPDDSPM  180

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
              + +AM D+NG+RH++ CRVILGK E V+PGS+Q HP+S EFD GVD+L  PKKYI+WS
Sbjct  181  ESVKNAMVDKNGMRHLMLCRVILGKAEAVQPGSKQCHPSSDEFDSGVDNLSSPKKYILWS  240

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            T++NTHILP +I+SF   + +     G+Q      LK P SP I+FP+L+S L++FLPP 
Sbjct  241  THMNTHILPEFILSFRAPS-SLKGFLGMQ----DRLKIPTSPWISFPALISALSEFLPPP  295

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGN  78
             +  I+ Y KD R+ K++R E+++ +R++AGD+LL+ ++K+ R  ++ +  GN
Sbjct  296  SINLISKYHKDLRDKKISRHELIQFVRQIAGDKLLVAVIKSSRTKKVISLQGN  348



>ref|XP_010027684.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Eucalyptus grandis]
 gb|KCW83378.1| hypothetical protein EUGRSUZ_B00314 [Eucalyptus grandis]
Length=353

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/282 (43%), Positives = 187/282 (66%), Gaps = 8/282 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ +EEG++ H+ ++ + VS L  +  Q  + +I ++  SSSV   ++ Q+F +++ AV+
Sbjct  76   LMELEEGDKAHRFIKERFVSRLGALRAQVTVAAIHRS-CSSSVAVTSRAQAFQVYSAAVQ  134

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS--FGHGVYLCPDHFPLGCLNS  582
            +K G    N+++AW  ASK+E+  I  +GF  S   + S  +G GVY  PD+ PL  + S
Sbjct  135  KKGGGDTANVRYAWYPASKEEVAKIFSYGFGYSGKPENSGLYGRGVYFAPDNHPLQSVES  194

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A  DE+G+RH+L C+VILGK+EL+  GS Q HP S+++D GVDDL  PK+YI+W+T+INT
Sbjct  195  APVDEDGLRHLLLCQVILGKSELIGFGSEQSHPNSEQYDSGVDDLSSPKRYIIWNTHINT  254

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            H+LP Y++SF     +     G+ R    S +KP SP + F  L+SEL+K LPP  + S+
Sbjct  255  HVLPEYVVSFRAPCCSR----GLLRTPGKS-RKPTSPWMPFRVLISELSKILPPSDINSM  309

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            + Y KDH+EGK+ R E+V+++R++AGD LL +I+K+ R  Q 
Sbjct  310  SKYYKDHKEGKIPRHELVRKVRQIAGDGLLTRIIKSSRTKQF  351



>ref|XP_002511397.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51999.1| conserved hypothetical protein [Ricinus communis]
Length=374

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/278 (42%), Positives = 188/278 (68%), Gaps = 15/278 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG+R + +++R+ +SGL  +G QA + +I +N++S  ++ +A++QSF +F KA+E
Sbjct  71   LVRLSEGDRVNDLIKRRFISGLGLLGKQATVVAIHRNKYSG-IVGQARMQSFQIFTKAME  129

Query  755  EKSGFGNGNMQFAWLGAS-KKELTSILQHGFDPSMN-KDGSFGHGVYLCPDHFPLGCLNS  582
            +K G GN N+++AW GAS + ++ +I+ HGF   +N  +G +G G+YL PD  PL  + +
Sbjct  130  DKCG-GNANVKYAWFGASSRDDICNIMTHGFGRQINDNNGLYGCGIYLSPDDSPLESVKN  188

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
               D++G+RH+L CRVILG++E V PGS Q HP+S++FD G+D  + PKKYIVWST +NT
Sbjct  189  LRVDKDGLRHLLLCRVILGRSEEVHPGSEQCHPSSEKFDSGIDTFLSPKKYIVWSTYMNT  248

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HI P ++ISF                   S   P SP + FP+L+S L++FLPP  +  +
Sbjct  249  HIFPEFVISFKAPCCLKE-----------SPGVPTSPWMPFPALISALSEFLPPATIGLL  297

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
              + KDHRE K++R E+++R+R++AGD LLI ++K+ R
Sbjct  298  DKHHKDHREKKISRQELIQRVRQIAGDRLLIAVIKSFR  335



>ref|XP_010251252.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Nelumbo nucifera]
Length=367

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 127/285 (45%), Positives = 189/285 (66%), Gaps = 9/285 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI +EEG++EH +++++ + G+  V     I SI KN +SS     A+LQSF +F++A+ 
Sbjct  83   LIRLEEGDKEHSVIKQRFLMGMGSVRSLTTITSIHKNIYSS-FQGLARLQSFRIFSQAMS  141

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSM--NKDGSFGHGVYLCPDHFPLGCLNS  582
            +K   GN N++FAW G S+  +  I+ HGF  S     +G +G G+YL P++F L    S
Sbjct  142  QKC-HGNPNIKFAWYGTSRDGVDRIISHGFGQSGRPENNGLYGSGLYLSPENFSLDSALS  200

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            +  ++NG+RHVL CRVILG  E VR GS Q+HP+S+EFD GVD+L+ P+KYI+WST++NT
Sbjct  201  STLNKNGLRHVLLCRVILGNMEEVRSGSEQFHPSSEEFDSGVDNLLAPRKYIIWSTHMNT  260

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HILP Y+ISF+        L G  R     + KP S  + FP+L+S LA+FLPP  ++ I
Sbjct  261  HILPEYVISFSAPPC----LEGFHRVQ-QPVVKPTSAWMPFPTLISVLARFLPPTTIRVI  315

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTS  87
              Y   +RE K+TR ++V+++R++ GDELL+KI+K+ R  Q+  S
Sbjct  316  QKYHYSYREKKITREQLVQKVRQIVGDELLVKIIKSCRGKQLKAS  360



>ref|XP_007036228.1| RCD one 5, putative isoform 2 [Theobroma cacao]
 gb|EOY20729.1| RCD one 5, putative isoform 2 [Theobroma cacao]
Length=362

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 125/295 (42%), Positives = 193/295 (65%), Gaps = 13/295 (4%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N+ L+ +  G++ H ++ ++ +S L  +       +I KN F   V  +A+LQSF +F K
Sbjct  65   NNGLVRLFPGDKAHDVIMKRFLSNLGALAAHTKDLTIHKNSFLG-VTWQARLQSFQIFIK  123

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFD----PSMNKDGSFGHGVYLCPDHFPL  597
            A+E+K G G+ N+++AW  AS+ E+  I++HGF     P     G +G G+YL PD  P+
Sbjct  124  AMEKKCG-GDANIKYAWCSASRDEICKIVEHGFGHFGLP--ENSGLYGCGLYLSPDDSPM  180

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
              + +AM D+NG+RH++ CRVILGK E V+PGS+Q HP+S EFD GVD+L  PKKYI+WS
Sbjct  181  ESVKNAMVDKNGMRHLMLCRVILGKAEAVQPGSKQCHPSSDEFDSGVDNLSSPKKYILWS  240

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            T++NTHILP +I+SF   + +     G+Q      LK P SP I+FP+L+S L++FLPP 
Sbjct  241  THMNTHILPEFILSFRAPS-SLKGFLGMQ----DRLKIPTSPWISFPALISALSEFLPPP  295

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNKT  72
             +  I+ Y KD R+ K++R E+++ +R++AGD+LL+ ++K+ R   I  S   +T
Sbjct  296  SINLISKYHKDLRDKKISRHELIQFVRQIAGDKLLVAVIKSSRTKPIAFSSIQRT  350



>ref|XP_003631261.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Vitis vinifera]
Length=325

 Score =   235 bits (600),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/281 (43%), Positives = 177/281 (63%), Gaps = 10/281 (4%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N+ +I V+EGN EH  +++   SG+  +G    + SI KN   S++  +A+ +SF +F++
Sbjct  42   NNGMIRVDEGNTEHDAIKKMFFSGMGPIGKGTDVVSIHKNS-HSTLTGQARFESFRIFSQ  100

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS--FGHGVYLCPDHFPLGC  591
            AV +K G G+ N+ +AW GAS+ E+  I+ HGF           +G GVYL    F + C
Sbjct  101  AVGKKCG-GDANINYAWYGASRGEIYDIISHGFSRLQRPKAGELYGFGVYLSSAKFSIDC  159

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
              S+  DENG+RHV+ CRVILG  E V  GS+Q+HP S+E+D GVDD+  P++YI+WS  
Sbjct  160  ALSSAEDENGLRHVMLCRVILGNMETVCAGSQQFHPCSREYDSGVDDVSAPRRYIIWSAY  219

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +N+HILP YIISF         L GV R   ++L KP SP + F +L+S L+K LPP  M
Sbjct  220  MNSHILPSYIISFRAP------LKGVPRRIQANLVKPTSPWMKFHTLLSVLSKVLPPHKM  273

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
              I+ Y  D    K+TR ++VKRLR++AGDE+L +++K  R
Sbjct  274  TQISKYHCDFHRKKITRQQLVKRLRQIAGDEMLTRVIKLYR  314



>ref|XP_004298944.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
[Fragaria vesca subsp. vesca]
Length=389

 Score =   237 bits (605),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 124/292 (42%), Positives = 188/292 (64%), Gaps = 10/292 (3%)
 Frame = -2

Query  962  DLHEQRNSRLIGVEEGNREHQIMERKLVSGLMGV-GMQAAIESIEKNEFSSSVMKKAKLQ  786
            D+     + L+ + EG+R + +++++ ++ L G+ G Q  + +I +N  S     +A+L 
Sbjct  68   DVSPALEAGLVKLGEGDRFYDLIKKRFLASLGGLLGPQVTVSAINRNSHSG-FTGQARLN  126

Query  785  SFSLFAKAVEEKSGFGNGNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGHGVYLCPD  609
            +F ++ KAVE+K G G+ N+++ W  +S K+E++ I+ HGF      +G +G GVYL PD
Sbjct  127  AFRVYLKAVEDKCG-GDANVKYGWYASSSKEEISKIVSHGFGQCEKINGVYGRGVYLAPD  185

Query  608  HFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPG-SRQWHPTSQEFDCGVDDLVFPKK  432
              PL CL S  ADE+G+RH+L CRVILGK E+V PG + Q+HP+S EFD GVD L  PKK
Sbjct  186  DSPLECLESLSADEDGMRHLLLCRVILGKPEVVLPGNAEQYHPSSSEFDSGVDRLSAPKK  245

Query  431  YIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAK  252
            YIVWST++NTHILP Y+ISF   T     L      +   ++KP SP +  P+L+  L+K
Sbjct  246  YIVWSTHMNTHILPEYVISFRAPTCLKEFL-----KTQEPIRKPTSPWMPIPTLIGVLSK  300

Query  251  FLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
             LP   +  I  Y K HRE K++R E+++R+R++AGD+LL  I+K+ R  Q+
Sbjct  301  VLPQPSIALIIKYHKAHRENKISRSELIQRIRQIAGDKLLATIIKSFRTKQL  352



>gb|KCW83377.1| hypothetical protein EUGRSUZ_B00313 [Eucalyptus grandis]
Length=351

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 188/282 (67%), Gaps = 10/282 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ +EEG++ H+ ++ + VS L  +  Q  + +I ++  SSS   +++ Q+F ++++AV+
Sbjct  76   LMELEEGDKAHRFIKERFVSRLGALREQVTVAAIHRS-CSSSFAARSRAQAFQVYSEAVQ  134

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS--FGHGVYLCPDHFPLGCLNS  582
            +K G    N+++AW  ASK+E+  I  +GF  S   + S  +G GVY  PD+ PL   + 
Sbjct  135  KKGGGDTANVRYAWYPASKEEVAKIFSYGFGYSGKPENSGLYGRGVYFAPDNHPL--ESP  192

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A  DE+G+RH+L C+VILGK+EL+  GS Q HP+S+++D GVDDL  PK+YIVW+T+INT
Sbjct  193  APVDEDGLRHLLLCQVILGKSELIGFGSEQSHPSSEQYDSGVDDLSSPKRYIVWNTHINT  252

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            H+LP Y++SF     +     G+ R S  S +KP SP + F  L+SEL+K LPP  + S+
Sbjct  253  HVLPEYVVSFRAPYCSR----GMLRTSGKS-RKPTSPWMPFRVLISELSKILPPSDINSM  307

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            + Y KDH+EGK+ R  +V+++R++AGD LL +I+K+ R  Q 
Sbjct  308  SKYYKDHKEGKIPRHVLVRKVRQIAGDGLLTRIIKSSRTKQF  349



>ref|XP_008389655.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Malus domestica]
Length=334

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/282 (43%), Positives = 189/282 (67%), Gaps = 10/282 (4%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKA  762
            S +I V++ + EH+I+++  VSG+   G    I ++ KN  SS   +KA+ +SF +F++A
Sbjct  46   SGMIRVDDESLEHEIIKKSFVSGMGLAGRDTNIVAVHKN-LSSDPTRKARFESFKIFSQA  104

Query  761  VEEKSGFGNGNMQFAWLGASKKELTSILQHGF----DPSMNKDGSFGHGVYLCPDHFPL-  597
            V  K G GN N+++AW G SK+EL  +L HGF    +P  N + S+G GV++ P  F   
Sbjct  105  VASKCG-GNANVKYAWYGGSKQELCDVLVHGFNRCREPVPN-EVSYGVGVHMIPAKFTCD  162

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
            G L+SA+ DE+G++H+L CRVILGK E+V PGS+Q  P+ +E D GVD+LV P++Y+VWS
Sbjct  163  GALSSAV-DESGLKHILLCRVILGKAEMVAPGSKQSQPSCKEVDTGVDNLVNPRRYVVWS  221

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKK-PNSPRITFPSLVSELAKFLPP  240
              +N+HI P Y++SF       + + GV     S+L++ P SP ++FP+L+S L+KFLPP
Sbjct  222  AIMNSHIYPCYVVSFKAPNTLPNVVSGVPTAQQSALRQPPTSPWMSFPALMSILSKFLPP  281

Query  239  QIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
            Q MQ +     + R  K+TR ++++R+R++AGD LLI ++K+
Sbjct  282  QKMQLLVACHNEFRANKVTRPQLIQRVRQIAGDRLLIGVIKS  323



>ref|XP_009596826.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Nicotiana tomentosiformis]
Length=375

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/261 (45%), Positives = 175/261 (67%), Gaps = 14/261 (5%)
 Frame = -2

Query  947  RNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFA  768
            ++  LI + EG++ H+I+ RK +SGL  +G+   IE+I KN  SS  M+ A LQ F  F+
Sbjct  85   KSDDLIRINEGDKMHKIISRKFISGLGVLGLSTQIEAIHKNICSSFTMQ-ANLQPFFTFS  143

Query  767  KAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL  588
            K++E+K G GN N+++AW GASK E+ SI  HGF+  ++ DG++GH + L PD +PL CL
Sbjct  144  KSMEKKCG-GNANVKYAWFGASKDEIDSIFSHGFEHPIH-DGAYGHCICLSPDDYPLDCL  201

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
             + + D++G+RH+L CRVILG+T    PG  Q HPTS++F  GVD+L  P+KYIVW +N+
Sbjct  202  QTTIPDKDGLRHLLLCRVILGRT----PGLGQSHPTSEQFVTGVDNLHSPRKYIVWKSNM  257

Query  407  NTHILPLYIISFTI-STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            N ++ P ++ISF + S +    +F V       LK PNS  I+FP+L+S L+K LPP  +
Sbjct  258  NAYVFPDFMISFRVTSDVKESRIFSV------PLKSPNSAWISFPALISALSKILPPNTV  311

Query  230  QSITTYVKDHREGKMTRLEMV  168
            + I  Y  D++E K+TR E++
Sbjct  312  KLIKKYHSDYKERKITRRELL  332



>ref|XP_008221823.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Prunus mume]
Length=337

 Score =   229 bits (583),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/295 (42%), Positives = 191/295 (65%), Gaps = 12/295 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I +EE N  H I++   +SG+   G    + +I KN  SS + ++A+ +SF +F++AV 
Sbjct  47   MIRLEEENSAHDIIKTCFLSGMGFAGGDTNLVAIHKN-VSSDLTRQARFESFKIFSQAVA  105

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGF----DPSMNKDGSFGHGVYLCPDHFPL-GC  591
            +K G G+ N+++AW G SK EL  IL HGF    +P+ N+  S+G GV+L    F   G 
Sbjct  106  QKCG-GDANVKYAWYGGSKDELCEILVHGFSRCREPAPNER-SYGVGVHLISPVFAYDGA  163

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
            L+SA+ DE G+RH+L CRVILGK E V PGS+Q HP+S+E D GVD+L FP++Y+VWS  
Sbjct  164  LSSAV-DERGLRHMLLCRVILGKMETVAPGSKQSHPSSKEMDTGVDNLQFPRRYVVWSAF  222

Query  410  INTHILPLYIISFTISTLNAHNLF--GVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            +N+HI P+Y++SF   + N  +    G+Q    ++  KP SP +TFP+L+S LAKFLPP 
Sbjct  223  MNSHIFPVYVVSFKAPSPNVVSGIQPGIQPRQANT-SKPTSPWVTFPALMSTLAKFLPPP  281

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNKT  72
             M  I     + R  ++TR ++++++R++ GD LLI+++KA R   ++ +   +T
Sbjct  282  KMLLIVKSHNEFRAKRITRPQLIRKVRQIVGDNLLIQVIKAFRSKSLHPASAKRT  336



>ref|XP_006374521.1| hypothetical protein POPTR_0015s08760g [Populus trichocarpa]
 gb|ERP52318.1| hypothetical protein POPTR_0015s08760g [Populus trichocarpa]
Length=259

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 109/238 (46%), Positives = 158/238 (66%), Gaps = 14/238 (6%)
 Frame = -2

Query  791  LQSFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSM--NKDGSFGHGVYL  618
            +QSF + AKA+E+K G G+ N++F W G ++ E+  I++HGF   M  N +G +G G+YL
Sbjct  1    MQSFQIIAKAMEKKCG-GDANVKFGWYGGTRDEICEIMKHGFSARMIDNSNGLYGSGIYL  59

Query  617  CPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFP  438
             PD  P+ C+      ++G+RH+L CRVILGK E+V PGS Q+HP+S EFD G+D+L  P
Sbjct  60   SPDDSPVECVKKLSVGKDGLRHMLLCRVILGKAEVVHPGSDQYHPSSDEFDSGMDNLSSP  119

Query  437  KKYIVWSTNINTHILPLYIISFTI-STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSE  261
            KKYIVWS  +NTHILP Y+ISF+  S+L             SS   P SP + FPSL+S 
Sbjct  120  KKYIVWSARMNTHILPEYVISFSAPSSLKGG----------SSTILPTSPWMPFPSLISA  169

Query  260  LAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTS  87
            L+KFLPP   + I  Y + HR  K++R E+++++R++ GD+LLI ++K+ R   + TS
Sbjct  170  LSKFLPPTTTKLIIKYYRAHRAKKISRQELIQQVRKIVGDKLLISVIKSFRTKMLVTS  227



>ref|XP_010678769.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Beta vulgaris subsp. vulgaris]
Length=348

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/277 (41%), Positives = 179/277 (65%), Gaps = 14/277 (5%)
 Frame = -2

Query  932  IGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEE  753
            + + E  R H+++ R+ +S +        + SI K  +SS    +A++QSF + +KA+  
Sbjct  76   VELSEQERTHEVIRRRFLSAMRD---DTKVVSIHKRIWSSDFSAQARVQSFQVHSKALAS  132

Query  752  KSGFGNG----NMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLN  585
             +  G G    +M+FAW G SK+ +  IL  GF  +  +D +    +YL PDH P+  L 
Sbjct  133  NNNGGAGASPNSMKFAWFGGSKERIHHILSRGFSFNDIRD-NINAAIYLSPDHSPVNSLE  191

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
             A+ DE+GVRH+L CRV+LG++ELV+P S Q  P+S EFD GVDD   PKKYI+WS+N+N
Sbjct  192  KAIPDEDGVRHLLLCRVVLGRSELVQPNSAQTEPSSNEFDSGVDDFENPKKYIIWSSNMN  251

Query  404  THILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQS  225
            +HILP Y++SFT S+   ++        V+ +K P+SP I+FPSL+S L KFLPP  +  
Sbjct  252  SHILPEYVVSFTDSSTTGNSKI------VNGMKMPSSPWISFPSLISVLGKFLPPDAISL  305

Query  224  ITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
            I+ Y  +++E +++R E++K +R++AGD+LL+ ++K+
Sbjct  306  ISKYHVEYKEKRISRPELIKIVRQIAGDKLLVAVIKS  342



>ref|XP_011071853.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
isoform X1 [Sesamum indicum]
 ref|XP_011071854.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
isoform X1 [Sesamum indicum]
Length=377

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 191/291 (66%), Gaps = 9/291 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
             + + + + +++ +++KLVS L   G  A +E+I +N +SS +  +A+L SFS+++KA++
Sbjct  90   FVRIPDDDTKYENIKKKLVSRLSSCGFSAQVETIHRNGYSS-MTSRARLHSFSIYSKAIQ  148

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
             KS  GN N+++AW G SK+E++ IL +GF   +N +G +G+GVYL     PL    S+ 
Sbjct  149  MKS-HGNANLKYAWYGGSKQEISEILSYGFGLPLN-NGVYGYGVYLSTVDHPLESFQSST  206

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
            ADE+G+RH+L CRV+LG  E++ PGS Q+HP+S+EFD GVDDL  PKKYIVW+T +NTHI
Sbjct  207  ADEDGLRHMLLCRVLLGNMEVICPGSGQYHPSSEEFDSGVDDLTSPKKYIVWTTKMNTHI  266

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LP ++I + IS+       G Q+  +   K P S  I   +L++ L KFLP   ++ ++ 
Sbjct  267  LPEFVIGYRISSC----CNGYQK-ILEPPKHPTSDWIHLDTLINALPKFLPADAIKLLSE  321

Query  215  YVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNKTGVR  63
            +   +++ K+TR  M++R+R + GD+LL+ ++K+  + +I  S G+    R
Sbjct  322  HNSQYKKQKITRHAMIQRVRHIVGDDLLLLMIKSHGE-KIKASYGSDKDDR  371



>ref|XP_008340039.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Malus domestica]
Length=334

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/281 (41%), Positives = 182/281 (65%), Gaps = 8/281 (3%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKA  762
            S ++ V++ + EH+I+ +  V G+   G    I ++ KN  SS   ++A+ +SF +F +A
Sbjct  46   SGMVRVDDESFEHEIIRKSFVLGMDLAGRDTNIVAVHKN-LSSDPTRRARFESFKIFTQA  104

Query  761  VEEKSGFGNGNMQFAWLGASKKELTSILQHGF----DPSMNKDGSFGHGVYLCPDHFPLG  594
            V  K G GN N+++ W G SK+EL  +L HGF    +P+ N + S+G GV++ P  F   
Sbjct  105  VARKCG-GNANVKYGWYGGSKEELCDVLVHGFSRCREPAPN-EVSYGVGVHMIPAKFTCD  162

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
               S++ DE+G++H+L CRVILGK E+V PGS+Q  P+SQE D GVD+LV P++Y+VWS 
Sbjct  163  GALSSVVDESGLKHILLCRVILGKAEMVAPGSKQSQPSSQEVDTGVDNLVNPRRYVVWSA  222

Query  413  NINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLK-KPNSPRITFPSLVSELAKFLPPQ  237
             +N+H+ P Y+ISF   +   + + GV     S+L+  P SP ++FP+L+S L+KFLPP 
Sbjct  223  IMNSHVYPCYLISFKAPSTLPNVVSGVPTMQRSALRPPPTSPWMSFPALLSILSKFLPPT  282

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
             MQ +       R  K+TR ++++R+R++AGD LLI ++K+
Sbjct  283  KMQLLVVCHNKFRANKITRPQLIQRVRQIAGDRLLIGVIKS  323



>gb|KCW83379.1| hypothetical protein EUGRSUZ_B00314 [Eucalyptus grandis]
Length=329

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 173/282 (61%), Gaps = 32/282 (11%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ +EEG++ H+ ++ + VS L  +  Q  + +I ++  SSSV   ++ Q+F +++ AV+
Sbjct  76   LMELEEGDKAHRFIKERFVSRLGALRAQVTVAAIHRS-CSSSVAVTSRAQAFQVYSAAVQ  134

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS--FGHGVYLCPDHFPLGCLNS  582
            +K G    N+++AW  ASK+E+  I  +GF  S   + S  +G GVY  PD+ PL  + S
Sbjct  135  KKGGGDTANVRYAWYPASKEEVAKIFSYGFGYSGKPENSGLYGRGVYFAPDNHPLQSVES  194

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A  DE+G+RH+L C+VILGK+EL+  GS Q HP S+++D GVDDL  PK+YI+W+T+INT
Sbjct  195  APVDEDGLRHLLLCQVILGKSELIGFGSEQSHPNSEQYDSGVDDLSSPKRYIIWNTHINT  254

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            H+LP Y++SF                               P    EL+K LPP  + S+
Sbjct  255  HVLPEYVVSFRA-----------------------------PCCSRELSKILPPSDINSM  285

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            + Y KDH+EGK+ R E+V+++R++AGD LL +I+K+ R  Q 
Sbjct  286  SKYYKDHKEGKIPRHELVRKVRQIAGDGLLTRIIKSSRTKQF  327



>ref|XP_010547808.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Tarenaya hassleriana]
Length=338

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/280 (43%), Positives = 184/280 (66%), Gaps = 9/280 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI + EG++ H +++R+LVS L  +G    + S+ +N F S+  ++AKL +F ++AKAVE
Sbjct  56   LIELPEGDKIHDLVKRRLVSCLGSIG---EVVSVLRNGFRSA-NRRAKLHAFHVYAKAVE  111

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
            +K G G GN+++ W    + E+  IL+HGF+ + +  G FG G+YL PD+ P   L  + 
Sbjct  112  QKHG-GVGNVKYGWCAVKRDEVGEILEHGFN-APSDGGFFGRGLYLSPDNAPQESLRCSA  169

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
            AD +G+R +L  RVILGK+E+VRP S +  P+S EFD GVD+L  P+KY+VWST++NTH+
Sbjct  170  ADGDGMRFLLLSRVILGKSEVVRPYSGRSCPSSPEFDSGVDNLQSPRKYVVWSTHMNTHV  229

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LP  ++    +  N  +L     +     K+PNSP I FP+L+S+++KFL P  M+ +  
Sbjct  230  LPEILVCVK-APANLGSLLSASES--DGPKRPNSPFIPFPALLSQVSKFLSPYEMRLVMK  286

Query  215  YVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            +  D R GK++R E+V+R+RRL GDELL +I+   RD  +
Sbjct  287  HYSDQRGGKISRFELVQRIRRLTGDELLKEIISTFRDKAV  326



>ref|XP_010101215.1| putative inactive poly [ADP-ribose] polymerase SRO5 [Morus notabilis]
 gb|EXB87889.1| putative inactive poly [ADP-ribose] polymerase SRO5 [Morus notabilis]
Length=393

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/315 (38%), Positives = 189/315 (60%), Gaps = 33/315 (10%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGL-MGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAV  759
            L+ + EG+R H +++ + V  L   +G +  +  I +N   SS++ +A+   F +FAKA+
Sbjct  57   LVRLFEGDRVHDLIKERFVLSLGSAIGPKTTVVGIHRNP-HSSIVGQARFHCFQIFAKAI  115

Query  758  EEKSGFGNGNMQFAWLG-ASKKELTSILQHGFDPSMNKDGS--------FGHGVYLCPDH  606
            E K G GN N+++AW   +S  E++ I+ HGF     K  +        +GHG+YL PD 
Sbjct  116  ERKRG-GNANVRYAWYAPSSADEVSRIVSHGFADQFGKYRNNNNNNNELYGHGIYLAPDD  174

Query  605  FPLGCL-NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKY  429
              + CL + +  +E+G+RH++ CRVI+GK E+VR GS Q+HP+S EFD GVD+L  P+KY
Sbjct  175  SAIDCLGDGSFIEEDGIRHLVLCRVIMGKAEIVRSGSEQYHPSSDEFDSGVDNLTKPRKY  234

Query  428  IVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKF  249
            IVWST++NT ILP Y++SF      A             +++P SP + FP+L+S L+KF
Sbjct  235  IVWSTHMNTCILPEYVVSF-----RAPTFLKASARIEEPIRRPTSPWMPFPALISALSKF  289

Query  248  LPPQIMQSITTYVKDHR-------EGKMTRLEMVKRLRRLAGDELLIKIVKAQR------  108
            LPP  +  I+ Y KDH+       E K+ R E+++R+R++AGD++LI ++K  R      
Sbjct  290  LPPPTVALISKYHKDHKAIVFAMMEKKVARQELIQRVRQIAGDDILISVIKDFRAKVKFV  349

Query  107  --DMQIYTSMGNKTG  69
              D+ +Y    ++ G
Sbjct  350  GDDLTLYVLFLHRKG  364



>ref|XP_008438409.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
isoform X2 [Cucumis melo]
Length=335

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/259 (44%), Positives = 166/259 (64%), Gaps = 19/259 (7%)
 Frame = -2

Query  953  EQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSL  774
            E RN  L+ + E ++ + +++R+ ++GL  +G Q  + ++ KN  S+ +  +A+L +F +
Sbjct  76   EWRNEGLVKLVEEDKIYDLIKRRFLTGLGLLGPQTTVSAVYKNSHSTHI-GQARLHTFQI  134

Query  773  FAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS--FGHGVYLCPDHFP  600
            +++AVE+K+  GN N+++AWLGASK ++ SIL +GF      + S   G G+YL PD+ P
Sbjct  135  YSQAVEKKNS-GNANVKYAWLGASKDQINSILDYGFSHCNKPESSQFLGSGIYLSPDNHP  193

Query  599  LGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVW  420
            L  L   + D +G+RH+L CRV+LGK+EL+ PGSRQ HP+ + FD G DDL  PKKYIVW
Sbjct  194  LESLEDTVVDGDGLRHLLLCRVVLGKSELIHPGSRQNHPSCEAFDSGADDLFAPKKYIVW  253

Query  419  STNINTHILPLYIISFTI-----STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELA  255
            ST++NTHILP Y+ISF        TL A   F          + P SP + FPSL+S L+
Sbjct  254  STHMNTHILPEYLISFRTPPRLKGTLKARQPF----------RMPTSPWMPFPSLISVLS  303

Query  254  KFLPPQIMQSITTYVKDHR  198
            K+LP   +  IT Y KDHR
Sbjct  304  KYLPAPEIAMITKYHKDHR  322



>emb|CBI28528.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   215 bits (548),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/254 (44%), Positives = 160/254 (63%), Gaps = 10/254 (4%)
 Frame = -2

Query  863  VGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTS  684
            +G    + SI KN   S++  +A+ +SF +F++AV +K G G+ N+ +AW GAS+ E+  
Sbjct  4    IGKGTDVVSIHKNS-HSTLTGQARFESFRIFSQAVGKKCG-GDANINYAWYGASRGEIYD  61

Query  683  ILQHGFDPSMNKDGS--FGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELV  510
            I+ HGF           +G GVYL    F + C  S+  DENG+RHV+ CRVILG  E V
Sbjct  62   IISHGFSRLQRPKAGELYGFGVYLSSAKFSIDCALSSAEDENGLRHVMLCRVILGNMETV  121

Query  509  RPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQ  330
              GS+Q+HP S+E+D GVDD+  P++YI+WS  +N+HILP YIISF         L GV 
Sbjct  122  CAGSQQFHPCSREYDSGVDDVSAPRRYIIWSAYMNSHILPSYIISFRAP------LKGVP  175

Query  329  RNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRL  150
            R   ++L KP SP + F +L+S L+K LPP  M  I+ Y  D    K+TR ++VKRLR++
Sbjct  176  RRIQANLVKPTSPWMKFHTLLSVLSKVLPPHKMTQISKYHCDFHRKKITRQQLVKRLRQI  235

Query  149  AGDELLIKIVKAQR  108
            AGDE+L +++K  R
Sbjct  236  AGDEMLTRVIKLYR  249



>gb|AAM64396.1| unknown [Arabidopsis thaliana]
Length=309

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/276 (43%), Positives = 175/276 (63%), Gaps = 17/276 (6%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG++ H ++ R   SGL   G Q  I S+ +N F + V  +AKL++F +F +AV+
Sbjct  42   LMELLEGDKAHDLIFRNCKSGL---GDQCQILSVLRNGFRN-VGSRAKLKTFQVFQEAVQ  97

Query  755  EK-SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL-NS  582
             K  G G   +++ W   SK EL +I ++GF   +  DGSFG G+YL PD+ PL CL +S
Sbjct  98   MKHGGHGGAKVKYGWCSVSKHELKTIFEYGFSEPLRNDGSFGRGLYLSPDNSPLDCLKDS  157

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A   E+G+R +L CRV+LGK+E+V  GS +  P+S EFD GVDDLV  KKYIVWST++NT
Sbjct  158  ASESEDGMRFLLLCRVLLGKSEIVPQGSTRSCPSSPEFDSGVDDLVSTKKYIVWSTHMNT  217

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            H+LP +++           LF + R    S K+  SP + FP L+  L+KFLPP  +  I
Sbjct  218  HVLPEFLVCIKA-------LFNLTR----SPKRLRSPWMAFPVLIKTLSKFLPPSQILVI  266

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
              + KD +  ++TR E+++R+R + GD+LL+ I+KA
Sbjct  267  QKHYKDQQNRRITRSELIQRVRSITGDKLLVHIIKA  302



>ref|XP_002525374.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37012.1| conserved hypothetical protein [Ricinus communis]
Length=327

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 177/282 (63%), Gaps = 10/282 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            ++ V+EG+ +++ ++   V G+        I +I KN  S    +KA+  SF +F +AV 
Sbjct  53   MVKVQEGSHDYKTIKEVFVGGMGTHANHTNIVAIHKNVVSDPA-RKARWLSFQIFTRAVG  111

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNS  582
            EKSG  NGN+QFAW G+S++EL  I+  GF+     + D   G G++L P  FP+ C+ S
Sbjct  112  EKSG-NNGNVQFAWYGSSREELCQIISRGFNRCNEASTDQLHGIGIHLSPAGFPIDCIGS  170

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            ++ D NG+ H+L CRVILGK E +   S+Q+ P S EFD GVD+L  P++YI+W+  +N+
Sbjct  171  SVVDANGLGHMLLCRVILGKMEEIPADSKQFQPNSTEFDSGVDNLHKPRRYIIWNAFMNS  230

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HI P YIISF   + N     G++RN +  L +P SP ++FP L+  L+K L P  M  I
Sbjct  231  HIFPTYIISFKAPSFN-----GIKRNQLRKL-RPTSPWLSFPVLLHLLSKCLEPSKMALI  284

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            + +  D ++ K++RL +++R+R+++GD LL++I+   R+  I
Sbjct  285  SKHYDDFKKNKISRLLLIQRVRQISGDRLLVQIIGRHRNRAI  326



>ref|NP_201058.1| probable inactive poly [ADP-ribose] polymerase SRO5 [Arabidopsis 
thaliana]
 sp|Q9FJJ3.1|SRO5_ARATH RecName: Full=Probable inactive poly [ADP-ribose] polymerase 
SRO5; AltName: Full=Protein SIMILAR TO RCD ONE 5 [Arabidopsis 
thaliana]
 gb|AAL38626.1|AF446893_1 AT5g62520/K19B1_13 [Arabidopsis thaliana]
 dbj|BAB11502.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK96591.1| AT5g62520/K19B1_13 [Arabidopsis thaliana]
 gb|AED97618.1| probable inactive poly [ADP-ribose] polymerase SRO5 [Arabidopsis 
thaliana]
Length=309

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 117/276 (42%), Positives = 174/276 (63%), Gaps = 17/276 (6%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG++ H ++ R   SGL   G Q  I S+ +N F + V  +AKL++F +F +AV+
Sbjct  42   LMELLEGDKAHDLIYRNCKSGL---GDQCQILSVLRNGFRN-VGSRAKLKTFQVFQEAVQ  97

Query  755  EK-SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL-NS  582
             K  G G   +++ W   SK EL +I ++GF   +  DGSFG G+YL PD+ PL CL +S
Sbjct  98   MKHGGDGGAKVKYGWCSVSKHELKTIFEYGFSEPLRNDGSFGRGLYLSPDNSPLDCLKDS  157

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A   E+G+R +L CRV+LGK+E+V  GS +  P+S EFD GVDDLV  KKYIVWST++NT
Sbjct  158  ASESEDGMRFLLLCRVLLGKSEIVPQGSTRSCPSSPEFDSGVDDLVSTKKYIVWSTHMNT  217

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            H+LP +++            F + R    S K+  SP + FP L+  L+KFLPP  +  I
Sbjct  218  HVLPEFLVCIKAP-------FNLTR----SPKRLRSPWMAFPVLIKALSKFLPPSQILVI  266

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
              + KD +  ++TR E+++R+R + GD+LL+ I+KA
Sbjct  267  QKHYKDQQNRRITRSELIQRVRSITGDKLLVHIIKA  302



>ref|XP_009768131.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
isoform X2 [Nicotiana sylvestris]
Length=316

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/275 (42%), Positives = 178/275 (65%), Gaps = 12/275 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I +EE N+EH +++   ++ +  +  Q  + +I KN   S+++ KA+L++F +F++AV 
Sbjct  47   MIKLEENNKEHGLIKSGFITCMGPLAKQVEVVAIHKNS-CSTLLGKARLEAFRIFSEAVR  105

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMN-KDGS-FGHGVYLCPDHFPLGCLNS  582
            EK   GN N+++AW G+SK+E+ +I+ HGF  +   K G  FG GVYL P +F  G L S
Sbjct  106  EKCN-GNANIKYAWFGSSKEEIGNIISHGFSTTTEPKSGECFGIGVYLYPANFD-GVL-S  162

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A+ DENG+RH+L CRVILG TE +  GS Q  PTS+EFD GVD++V P  Y +W++++N+
Sbjct  163  AVEDENGLRHMLLCRVILGNTEEIAAGSTQSQPTSEEFDSGVDNIVAPTTYTIWASHMNS  222

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HI P +++SF         L G  +     LK   +PRI FP L+  L+KFL P  M SI
Sbjct  223  HIFPNFLVSFRCPNY----LLGSSKIRKVPLKP--TPRIKFPDLLRALSKFLHPSRMASI  276

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            + Y +D +  K+T+L +V++LR++AGD  L  ++K
Sbjct  277  SKYYEDFQRSKITKLVLVRKLRQIAGDTSLRAVMK  311



>ref|XP_009768129.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
isoform X1 [Nicotiana sylvestris]
Length=320

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/275 (42%), Positives = 178/275 (65%), Gaps = 12/275 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I +EE N+EH +++   ++ +  +  Q  + +I KN   S+++ KA+L++F +F++AV 
Sbjct  47   MIKLEENNKEHGLIKSGFITCMGPLAKQVEVVAIHKNS-CSTLLGKARLEAFRIFSEAVR  105

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMN-KDGS-FGHGVYLCPDHFPLGCLNS  582
            EK   GN N+++AW G+SK+E+ +I+ HGF  +   K G  FG GVYL P +F  G L S
Sbjct  106  EKCN-GNANIKYAWFGSSKEEIGNIISHGFSTTTEPKSGECFGIGVYLYPANFD-GVL-S  162

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A+ DENG+RH+L CRVILG TE +  GS Q  PTS+EFD GVD++V P  Y +W++++N+
Sbjct  163  AVEDENGLRHMLLCRVILGNTEEIAAGSTQSQPTSEEFDSGVDNIVAPTTYTIWASHMNS  222

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HI P +++SF         L G  +     LK   +PRI FP L+  L+KFL P  M SI
Sbjct  223  HIFPNFLVSFRCPNY----LLGSSKIRKVPLKP--TPRIKFPDLLRALSKFLHPSRMASI  276

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            + Y +D +  K+T+L +V++LR++AGD  L  ++K
Sbjct  277  SKYYEDFQRSKITKLVLVRKLRQIAGDTSLRAVMK  311



>gb|KDP26589.1| hypothetical protein JCGZ_17747 [Jatropha curcas]
Length=351

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 177/289 (61%), Gaps = 10/289 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            ++ V EG+ EH  + R  + G+   G    I +I KN  S S   +A+  +F +F +AV 
Sbjct  67   MLKVGEGSLEHNTITRSFLEGMRNRGKDTKIVAIHKNSASGSA-GRARWLTFRIFTEAVS  125

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFD-PSMNKDG-SFGHGVYLCPDHFPLGCLNS  582
            +KSG G+ N++F W G S++++  ++ HGF   S   +G S G G+ L P  F +    S
Sbjct  126  QKSG-GDANLRFGWFGGSREKICQVISHGFSLCSETANGESHGFGISLSPPKFCIDSAAS  184

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A  DENG+RH+L CRV++GK E++  GS+Q+ P+S EFD GVD+L  P+K+IVWS  +N+
Sbjct  185  ATVDENGLRHMLLCRVVMGKMEVIPAGSKQFQPSSTEFDSGVDNLEEPRKFIVWSAFMNS  244

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HI P YIISF     N     G+  N   S+ +P+SP ++FP+L+S L++FL P  M  I
Sbjct  245  HIFPAYIISFQAPCFN-----GLNTNLGRSV-RPSSPWMSFPALLSILSRFLEPSKMALI  298

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNK  75
              +  D R+ K++RL +++++R+++GD LL  I++   + Q+     N+
Sbjct  299  FKFYDDFRKNKISRLTLIRKVRQISGDRLLAAIIRNCTNKQLVIGRSNR  347



>ref|XP_003525502.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
[Glycine max]
Length=327

 Score =   212 bits (539),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 112/270 (41%), Positives = 175/270 (65%), Gaps = 15/270 (6%)
 Frame = -2

Query  902  QIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFGNGNMQ  723
             ++  + V GL+    +  + ++ +N   SSVM  A+  SF +FA+AV E  G GN N++
Sbjct  37   DLVRTRFVRGLVAHCFKPEVLAVRRN-VCSSVMALARQHSFHVFARAVAELRG-GNANVK  94

Query  722  FAWLGAS-KKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVL  546
            FAW GAS K+E+  I+QHGF        +  +G+ L P   PL  + S++ DE+G+RH+L
Sbjct  95   FAWYGASSKEEINDIIQHGFG------HAHSNGLRLSPQDSPLESVKSSVVDEDGLRHLL  148

Query  545  YCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTI  366
             CRVILGKTE+V  GS Q   +SQEFD GVDDL  PK+Y++W   INTH+LP Y++SF +
Sbjct  149  LCRVILGKTEVVPRGSYQCRSSSQEFDSGVDDLSNPKEYVIWCNQINTHVLPEYVLSFRL  208

Query  365  STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKM  186
             +     L G+ +  +    +P+SP + FP+L+S L+K LPP  + SI  + KD+RE ++
Sbjct  209  PS----PLKGIVK--IGEPLRPSSPWMAFPALISMLSKILPPSEVASIAKFHKDYREKRI  262

Query  185  TRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            +R E+++++R +AGD+LL+ ++K+ R  +I
Sbjct  263  SRHELIQKVRVIAGDKLLLSVIKSFRAKKI  292



>ref|XP_010483966.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Camelina sativa]
Length=364

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/279 (41%), Positives = 173/279 (62%), Gaps = 20/279 (7%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG++ H ++ R   SGL   G Q  I S+ +N F + V  +AK ++F +F +AV 
Sbjct  94   LMELLEGDKAHDLIFRNCKSGL---GDQCQILSVLRNGFRT-VGSRAKFKTFQIFQEAVH  149

Query  755  EK----SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL  588
             K     G G   +++ W   +K+EL +IL++GF    + DGS+G G+YL PD+ PL CL
Sbjct  150  TKHAGEDGGGGAKVKYGWCAVAKQELKTILEYGFSQPPSNDGSYGRGLYLSPDNSPLDCL  209

Query  587  -NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
              SA   E+G+R +L CRV+LGK+E+V  GS Q  P+S EFD G+DDL  PKKYIVWST+
Sbjct  210  KESAAESEDGMRFLLLCRVLLGKSEIVTQGSIQSCPSSPEFDSGIDDLASPKKYIVWSTH  269

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +NTH+LP +++            F + R+S    K+  SP + FP L+  L+KFL P  +
Sbjct  270  MNTHVLPEFLVCIKAP-------FNLTRSS----KRLRSPWMAFPVLIKALSKFLSPSQI  318

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
              I  + KD +  +++R E+++R+R + GD+LL+ I+KA
Sbjct  319  LVIQKHYKDQQNRRISRSELIQRVRSITGDKLLVHIIKA  357



>ref|XP_010458988.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Camelina sativa]
Length=319

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 171/278 (62%), Gaps = 19/278 (7%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG++ H ++ R   SGL   G Q  I S+ +N F + V  +AK ++F +F +AV 
Sbjct  50   LMELLEGDKAHDLIFRNCKSGL---GDQCQILSVLRNGFRT-VGSRAKFKTFQIFQEAVH  105

Query  755  EK---SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL-  588
             K    G G   +++ W   +K EL +IL++GF    + DGS+G G+YL PD+ PL CL 
Sbjct  106  AKHAAGGDGGAKVKYGWCSVAKHELKTILEYGFSQPPSNDGSYGRGLYLSPDNSPLDCLK  165

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
             SA   E+G+R +L CRV+LGK+E+V  GS Q  P+S EFD GVDDL  PKKYIVWST++
Sbjct  166  ESAAESEDGMRFLLLCRVLLGKSEIVPQGSIQSCPSSPEFDSGVDDLASPKKYIVWSTHM  225

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            NTH+LP +++            F + R    S K+  SP + FP L+  L+KFL P  + 
Sbjct  226  NTHVLPEFLVCIKAP-------FNLTR----SAKRLRSPWMAFPVLIKALSKFLSPSQIL  274

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
             I  + KD +  +++R E+++R+R + GD+LL+ I+KA
Sbjct  275  VIQKHYKDQQNRRISRSELIQRVRSITGDKLLVHIIKA  312



>ref|XP_010444100.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Camelina sativa]
Length=326

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/279 (41%), Positives = 172/279 (62%), Gaps = 20/279 (7%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG++ H ++ R   SGL   G Q  I S+ +N F + V  +AK ++F +F +AV 
Sbjct  56   LMELLEGDKAHDLIFRNCKSGL---GDQCQILSVLRNGFRT-VGSRAKFKTFQIFQEAVH  111

Query  755  EK----SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL  588
             K     G G   +++ W   +K+EL +IL++GF    + DGS+G G+YL PD+ PL CL
Sbjct  112  TKHAGEDGGGGAKVKYGWCAVAKQELKTILEYGFSQPPSNDGSYGRGLYLSPDNSPLDCL  171

Query  587  -NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
              +A   E+G+R +L CRV+LGK+E+V  GS Q  P+S EFD GVDDL  PKKYIVWST+
Sbjct  172  KETASETEDGMRFLLLCRVLLGKSEIVPQGSIQSCPSSPEFDSGVDDLASPKKYIVWSTH  231

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +NTH+LP +++            F + R    S K+  SP + FP L+  L+KFL P  +
Sbjct  232  MNTHVLPEFLVCIKAP-------FNLTR----SAKRLRSPWMAFPVLIKALSKFLSPSQI  280

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
              I  + KD +  +++R E+++R+R + GD+LL+ I+KA
Sbjct  281  LVIQKHYKDQQNRRISRSELIQRVRSITGDKLLVHIIKA  319



>gb|KHN18456.1| Putative inactive poly [ADP-ribose] polymerase SRO5 [Glycine 
soja]
Length=336

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/293 (40%), Positives = 176/293 (60%), Gaps = 24/293 (8%)
 Frame = -2

Query  929  GVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEK  750
            G    +    ++  + V GL   G++  + ++ +N   SSVM +A+  SF +FA+AV  K
Sbjct  36   GFVPADENADLVRTRFVRGLAAHGLKPEVLAVGRNA-CSSVMAQARQHSFHVFARAVA-K  93

Query  749  SGFGNGNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGH----GVYLCPDHFPLGCLN  585
               GN N++FAW GAS K+E++ I+Q+GF         FGH    G+ L P   PL  + 
Sbjct  94   LRDGNANVKFAWYGASSKEEISDIVQNGF---------FGHAHGNGLRLFPQDSPLESVK  144

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            S++ D++G+RH+L CRVILGKTELV   S Q   +S+EFD GVDDL  PK+Y++W   IN
Sbjct  145  SSVVDKDGLRHLLLCRVILGKTELVPRDSNQCRSSSEEFDSGVDDLSNPKEYVIWCNQIN  204

Query  404  THILPLYIISFTI-STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            TH+LP Y++SF   S L  H   G          +P+SP + FP+L+S L+K LPP  + 
Sbjct  205  THVLPEYVLSFRFPSPLKGHVKIG-------EPLRPSSPWMAFPALISVLSKILPPPDIA  257

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNKTG  69
             I  + KD+RE +++R E+++++R +AGD+LL  ++K+ R  +I  S     G
Sbjct  258  YIAKFHKDYREKRISRYELIQKVRVIAGDKLLFSVIKSFRAKKIPASFKANKG  310



>ref|XP_004508868.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
[Cicer arietinum]
Length=324

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/278 (40%), Positives = 176/278 (63%), Gaps = 14/278 (5%)
 Frame = -2

Query  899  IMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFGNGNMQF  720
            ++  + V  L   G++A   SI +    S+VM +A++QSF +FA+AV +  G GN N++ 
Sbjct  53   LIRSRFVCSLSTQGLKAEAVSIRRYA-CSTVMAQARVQSFQIFARAVAKLRG-GNPNVKH  110

Query  719  AWLGAS-KKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLY  543
            AW GAS K+E+  I+QHGF  + +      HG+ L P   PL  + S+   ++G+RH+L 
Sbjct  111  AWYGASSKEEIVDIIQHGFGHAHS------HGLRLSPSDSPLQSVKSSAVGKDGLRHLLL  164

Query  542  CRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIS  363
            CRVILGK E+V  GS Q  P+S+E+D G+D    PK+Y++WS  INTH+LP Y++SF ++
Sbjct  165  CRVILGKMEVVPEGSDQCRPSSEEYDSGIDSFSSPKEYMIWSNRINTHVLPEYVLSFKLA  224

Query  362  TLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMT  183
            +   H   GV+   V    +P+SP + FP+L S L+K LPP  +  I  + K++RE K+ 
Sbjct  225  SSKGHVKVGVEGQPV----RPSSPWMPFPALFSVLSKILPPSDIGFIAKFHKEYREKKIL  280

Query  182  RLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNKTG  69
            R E+++++R +AGD+LL+ ++K+ R  ++  S   +TG
Sbjct  281  RHELIQKVRLIAGDKLLVSVIKSFRAKKLPASF-KQTG  317



>ref|XP_006600645.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
isoform X4 [Glycine max]
Length=322

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 116/293 (40%), Positives = 176/293 (60%), Gaps = 24/293 (8%)
 Frame = -2

Query  929  GVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEK  750
            G    +    ++  + V GL   G++  + ++ +N   SSVM +A+  SF +FA+AV  K
Sbjct  36   GFVPADENADLVRTRFVRGLAAHGLKPEVLAVGRNA-CSSVMAQARQHSFHVFARAVA-K  93

Query  749  SGFGNGNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGH----GVYLCPDHFPLGCLN  585
               GN N++FAW GAS K+E++ I+Q+GF         FGH    G+ L P   PL  + 
Sbjct  94   LRDGNANVKFAWYGASSKEEISDIVQNGF---------FGHAHGNGLRLFPQDSPLESVK  144

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            S++ D++G+RH+L CRVILGKTELV   S Q   +S+EFD GVDDL  PK+Y++W   IN
Sbjct  145  SSVVDKDGLRHLLLCRVILGKTELVPRDSNQCRSSSEEFDSGVDDLSNPKEYVIWCNQIN  204

Query  404  THILPLYIISFTI-STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            TH+LP Y++SF   S L  H   G          +P+SP + FP+L+S L+K LPP  + 
Sbjct  205  THVLPEYVLSFRFPSPLKGHVKIG-------EPLRPSSPWMAFPALISVLSKILPPPDIA  257

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNKTG  69
             I  + KD+RE +++R E+++++R +AGD+LL  ++K+ R  +I  S     G
Sbjct  258  YIAKFHKDYREKRISRHELIQKVRVIAGDKLLFSVIKSFRAKKIPASFKANKG  310



>ref|XP_006281617.1| hypothetical protein CARUB_v10027743mg [Capsella rubella]
 gb|EOA14515.1| hypothetical protein CARUB_v10027743mg [Capsella rubella]
Length=316

 Score =   206 bits (524),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 113/275 (41%), Positives = 171/275 (62%), Gaps = 17/275 (6%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG++ H ++ R   SGL   G Q  I S+ +N F + V  +AK ++F +F +AV+
Sbjct  51   LMELLEGDKAHDLIFRNCKSGL---GDQCQILSVLRNGFRT-VGSRAKFKTFQIFQEAVQ  106

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL-NSA  579
             K    +  +++ W    K+EL +IL++GF      DGS+G G+YL PD+ PL CL  SA
Sbjct  107  LKHA-EDAKVKYGWCTVGKQELKTILEYGFSQPPRNDGSYGRGLYLSPDNSPLDCLKESA  165

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
               E+G+R +L CRV+LGK+E+V  GS Q  P+S EFD GVDDL  PKKYIVWST++NTH
Sbjct  166  SESEDGMRFLLLCRVLLGKSEIVSQGSIQSCPSSPEFDSGVDDLASPKKYIVWSTHMNTH  225

Query  398  ILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
            +LP +++            F + R    S K+  SP + FP L+  L+KFLPP  +  I 
Sbjct  226  VLPEFLVCVKAP-------FNLTR----SPKRLRSPWMAFPVLIKALSKFLPPSQILVIH  274

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
             + KD +  +++R E+++R+R + GD+LL+ I+KA
Sbjct  275  KHYKDQQNRRISRSELIQRVRSITGDKLLVHIIKA  309



>ref|XP_006600643.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
isoform X2 [Glycine max]
Length=328

 Score =   206 bits (525),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 116/293 (40%), Positives = 176/293 (60%), Gaps = 24/293 (8%)
 Frame = -2

Query  929  GVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEK  750
            G    +    ++  + V GL   G++  + ++ +N   SSVM +A+  SF +FA+AV  K
Sbjct  36   GFVPADENADLVRTRFVRGLAAHGLKPEVLAVGRNA-CSSVMAQARQHSFHVFARAVA-K  93

Query  749  SGFGNGNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGH----GVYLCPDHFPLGCLN  585
               GN N++FAW GAS K+E++ I+Q+GF         FGH    G+ L P   PL  + 
Sbjct  94   LRDGNANVKFAWYGASSKEEISDIVQNGF---------FGHAHGNGLRLFPQDSPLESVK  144

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            S++ D++G+RH+L CRVILGKTELV   S Q   +S+EFD GVDDL  PK+Y++W   IN
Sbjct  145  SSVVDKDGLRHLLLCRVILGKTELVPRDSNQCRSSSEEFDSGVDDLSNPKEYVIWCNQIN  204

Query  404  THILPLYIISFTI-STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            TH+LP Y++SF   S L  H   G          +P+SP + FP+L+S L+K LPP  + 
Sbjct  205  THVLPEYVLSFRFPSPLKGHVKIG-------EPLRPSSPWMAFPALISVLSKILPPPDIA  257

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNKTG  69
             I  + KD+RE +++R E+++++R +AGD+LL  ++K+ R  +I  S     G
Sbjct  258  YIAKFHKDYREKRISRHELIQKVRVIAGDKLLFSVIKSFRAKKIPASFKANKG  310



>ref|XP_006600644.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
isoform X3 [Glycine max]
Length=326

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/293 (40%), Positives = 176/293 (60%), Gaps = 24/293 (8%)
 Frame = -2

Query  929  GVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEK  750
            G    +    ++  + V GL   G++  + ++ +N   SSVM +A+  SF +FA+AV  K
Sbjct  36   GFVPADENADLVRTRFVRGLAAHGLKPEVLAVGRNA-CSSVMAQARQHSFHVFARAVA-K  93

Query  749  SGFGNGNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGH----GVYLCPDHFPLGCLN  585
               GN N++FAW GAS K+E++ I+Q+GF         FGH    G+ L P   PL  + 
Sbjct  94   LRDGNANVKFAWYGASSKEEISDIVQNGF---------FGHAHGNGLRLFPQDSPLESVK  144

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            S++ D++G+RH+L CRVILGKTELV   S Q   +S+EFD GVDDL  PK+Y++W   IN
Sbjct  145  SSVVDKDGLRHLLLCRVILGKTELVPRDSNQCRSSSEEFDSGVDDLSNPKEYVIWCNQIN  204

Query  404  THILPLYIISFTI-STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            TH+LP Y++SF   S L  H   G          +P+SP + FP+L+S L+K LPP  + 
Sbjct  205  THVLPEYVLSFRFPSPLKGHVKIG-------EPLRPSSPWMAFPALISVLSKILPPPDIA  257

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNKTG  69
             I  + KD+RE +++R E+++++R +AGD+LL  ++K+ R  +I  S     G
Sbjct  258  YIAKFHKDYREKRISRHELIQKVRVIAGDKLLFSVIKSFRAKKIPASFKANKG  310



>ref|XP_006600642.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
isoform X1 [Glycine max]
Length=336

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 116/293 (40%), Positives = 176/293 (60%), Gaps = 24/293 (8%)
 Frame = -2

Query  929  GVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEK  750
            G    +    ++  + V GL   G++  + ++ +N   SSVM +A+  SF +FA+AV  K
Sbjct  36   GFVPADENADLVRTRFVRGLAAHGLKPEVLAVGRNA-CSSVMAQARQHSFHVFARAVA-K  93

Query  749  SGFGNGNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGH----GVYLCPDHFPLGCLN  585
               GN N++FAW GAS K+E++ I+Q+GF         FGH    G+ L P   PL  + 
Sbjct  94   LRDGNANVKFAWYGASSKEEISDIVQNGF---------FGHAHGNGLRLFPQDSPLESVK  144

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            S++ D++G+RH+L CRVILGKTELV   S Q   +S+EFD GVDDL  PK+Y++W   IN
Sbjct  145  SSVVDKDGLRHLLLCRVILGKTELVPRDSNQCRSSSEEFDSGVDDLSNPKEYVIWCNQIN  204

Query  404  THILPLYIISFTI-STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            TH+LP Y++SF   S L  H   G          +P+SP + FP+L+S L+K LPP  + 
Sbjct  205  THVLPEYVLSFRFPSPLKGHVKIG-------EPLRPSSPWMAFPALISVLSKILPPPDIA  257

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNKTG  69
             I  + KD+RE +++R E+++++R +AGD+LL  ++K+ R  +I  S     G
Sbjct  258  YIAKFHKDYREKRISRHELIQKVRVIAGDKLLFSVIKSFRAKKIPASFKANKG  310



>ref|XP_010320567.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Solanum lycopersicum]
Length=320

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/275 (40%), Positives = 179/275 (65%), Gaps = 10/275 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I +EE N+EH +++   +SG+  +G +  + +I KN   S+++ +A+L+SF ++++A+ 
Sbjct  47   MIELEERNKEHDLIKAGFLSGMGQLGKEVEVVAIHKNS-CSTILGQARLESFRIYSEAMR  105

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDP-SMNKDGS-FGHGVYLCPDHFPLGCLNS  582
            +K G GN N+++AW G+SK E+ +I+ HGF   +  K G  FG GV+L P +   G L S
Sbjct  106  KKCG-GNANIKYAWFGSSKDEICNIISHGFSTITEPKSGECFGMGVHLYPANIH-GVL-S  162

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A+ DENG+RH+L CRVILG TE++   S+Q+ PT Q+FD GVD+ + PK YI+W + +N+
Sbjct  163  ALEDENGLRHMLLCRVILGNTEIIEASSKQFQPTCQDFDSGVDNYLAPKTYIIWPSYMNS  222

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HILP +++SF+ +      L G          K NS RI F  L+  L+K+L P  M  I
Sbjct  223  HILPNFLVSFSCT---PSYLLGASSKIKKVSPKSNS-RIKFHDLLRVLSKYLHPSRMVLI  278

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            + Y +D ++ K+T+L +V++LRR+AGD  L  ++K
Sbjct  279  SKYYEDFQKNKITKLVLVRKLRRIAGDTSLRAVMK  313



>ref|XP_010045550.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Eucalyptus grandis]
Length=351

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/282 (38%), Positives = 174/282 (62%), Gaps = 13/282 (5%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKA  762
            S+L+ + EG+  ++ +++  VS L  +G Q  + +I +N++SSS   KA+  +F L+++A
Sbjct  73   SKLMELSEGDTVYRFIKQTFVSKLGDLGAQVTVVAIHQNDYSSS-SAKARAVAFQLYSEA  131

Query  761  VEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPS--MNKDGSFGHGVYLCPDHFPLGCL  588
            V++K G    N+ +AW   SK+E+  I   GF+ S     +G FG GVY  P + PL  +
Sbjct  132  VQKKGGSNTANVSYAWYATSKEEVPKIFSCGFNFSEKHENNGFFGCGVYFAPLNHPLESI  191

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
             +A  D +G+RH+L CRVILGK+ELV  GS Q  P+S+++D G+DDL  P++YI+WST++
Sbjct  192  VTAPVDNDGLRHMLLCRVILGKSELVSHGSEQSLPSSEQYDSGIDDLSSPRRYIIWSTHM  251

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKK--PNSPRITFPSLVSELAKFLPPQI  234
            NTH+LP  ++SF     +        R S+ + KK  PNSP I F   + E +K  PP  
Sbjct  252  NTHVLPEIVVSFRAPCFS--------RGSLRTPKKWNPNSPYIPFRFFMKEFSKTFPPSD  303

Query  233  MQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            +  ++ Y K ++E +M++  +V+ +R++ GD  LI I+ + R
Sbjct  304  IDLVSKYYKAYKERRMSKQLLVRIVRKITGDRWLIGIINSFR  345



>gb|KEH31843.1| inactive poly [ADP-ribose] polymerase SRO4 [Medicago truncatula]
Length=310

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/273 (39%), Positives = 171/273 (63%), Gaps = 13/273 (5%)
 Frame = -2

Query  899  IMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFGNGNMQF  720
            ++  + V GL   G++    +I +N    +VM +A++QSF +FA+AV +  G GN N++ 
Sbjct  49   LIRSRFVCGLSAQGLKPYGVAIFRNP-CKTVMAQARIQSFEIFARAVAKMRG-GNANVKH  106

Query  719  AWLGAS-KKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLY  543
             W GAS ++E+  I+QHGF    +      +G+ L P+  PL  +   + D+ G RH+L 
Sbjct  107  VWYGASSREEIVDIIQHGFGYVHS------NGLRLSPNDTPLESVKRTVVDKQGFRHLLL  160

Query  542  CRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIS  363
            CRVI+GK E V  GS Q  P+S+EFD GVD    PK++IVWS  INTH+LP Y++SF ++
Sbjct  161  CRVIMGKLEAVPAGSDQRRPSSEEFDSGVDSFSSPKEFIVWSNKINTHVLPEYVLSFKLA  220

Query  362  TLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMT  183
            +   H   GV    +    +P+SP + FP+L+S L+K LPP  + SI  + K++R+ K++
Sbjct  221  SDKGHEKVGVGGQHM----RPSSPFMQFPTLISALSKILPPSDIVSIAKFHKEYRDKKIS  276

Query  182  RLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSM  84
            R EM++++R++AGD+LL  ++K+ R   +  S+
Sbjct  277  RHEMIQKVRKVAGDKLLFSVIKSFRAKVLLISL  309



>gb|KEH31844.1| inactive poly [ADP-ribose] polymerase SRO4 [Medicago truncatula]
Length=325

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/271 (39%), Positives = 171/271 (63%), Gaps = 13/271 (5%)
 Frame = -2

Query  899  IMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFGNGNMQF  720
            ++  + V GL   G++    +I +N    +VM +A++QSF +FA+AV +  G GN N++ 
Sbjct  49   LIRSRFVCGLSAQGLKPYGVAIFRNP-CKTVMAQARIQSFEIFARAVAKMRG-GNANVKH  106

Query  719  AWLGAS-KKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLY  543
             W GAS ++E+  I+QHGF    +      +G+ L P+  PL  +   + D+ G RH+L 
Sbjct  107  VWYGASSREEIVDIIQHGFGYVHS------NGLRLSPNDTPLESVKRTVVDKQGFRHLLL  160

Query  542  CRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIS  363
            CRVI+GK E V  GS Q  P+S+EFD GVD    PK++IVWS  INTH+LP Y++SF ++
Sbjct  161  CRVIMGKLEAVPAGSDQRRPSSEEFDSGVDSFSSPKEFIVWSNKINTHVLPEYVLSFKLA  220

Query  362  TLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMT  183
            +   H   GV    +    +P+SP + FP+L+S L+K LPP  + SI  + K++R+ K++
Sbjct  221  SDKGHEKVGVGGQHM----RPSSPFMQFPTLISALSKILPPSDIVSIAKFHKEYRDKKIS  276

Query  182  RLEMVKRLRRLAGDELLIKIVKAQRDMQIYT  90
            R EM++++R++AGD+LL  ++K+ R  +++ 
Sbjct  277  RHEMIQKVRKVAGDKLLFSVIKSFRAKKMHA  307



>ref|XP_007044660.1| RCD one 2, putative isoform 2 [Theobroma cacao]
 gb|EOY00492.1| RCD one 2, putative isoform 2 [Theobroma cacao]
Length=337

 Score =   204 bits (519),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/275 (41%), Positives = 167/275 (61%), Gaps = 11/275 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMG---VGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            L  ++E + EH I++    + +     +  +  I +I KN  SS   ++A+  SF +FAK
Sbjct  44   LTKLQEPSLEHTIIKASFFTSIRDQSELAKKINIVAIHKNSHSSR-SREARADSFQVFAK  102

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLN  585
            AV +K G GN N+++ W GAS+ E+  I+ HGF    NK     + + L P  F    + 
Sbjct  103  AVADKCG-GNANLKYGWYGASRNEICEIVMHGF-SWCNKAAGNRYSISLSPAKFAFDSVL  160

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            S+ ADENG+RHVL CRVILGK E++   S Q+HPTS EFD GVDDL  P+KYIVWS  +N
Sbjct  161  SSEADENGLRHVLLCRVILGKQEVLTANSNQFHPTSPEFDSGVDDLSAPRKYIVWSVYMN  220

Query  404  THILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQS  225
            THILP Y+IS     + A  L G +    +++ KP+S  ++FP+L+S L++FL P  + S
Sbjct  221  THILPSYVIS-----IKAPYLIGSKGLLEANIIKPDSKWVSFPTLISMLSRFLEPSQIAS  275

Query  224  ITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIV  120
            +     D +E K+TR +++ R++ +AG + L  IV
Sbjct  276  LNKNYSDFQERKITRKQLIDRMKEIAGHQALAAIV  310



>ref|XP_009590724.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
isoform X1 [Nicotiana tomentosiformis]
Length=329

 Score =   204 bits (518),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 111/296 (38%), Positives = 186/296 (63%), Gaps = 20/296 (7%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I +EE ++EH +++   ++ +  +  +  + +I KN   S+++ KA+L++F +F++AV 
Sbjct  46   MIKLEENDKEHGLIKSGFITCMGPLAKEVEVVAIHKNS-CSTILGKARLEAFRIFSEAVR  104

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMN-KDGS-FGHGVYLCPDHFPLGCLNS  582
            EK   GN N+++AW G+SK+E+  I+ HGF  +   K G  FG GVYL P +   G L S
Sbjct  105  EKCN-GNANIKYAWFGSSKEEICKIISHGFSRTTEAKSGECFGIGVYLYPANID-GVL-S  161

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTS--QEFDCGVDDLVFPKKYIVWSTNI  408
             + DENG+RH+L CRVILG TE++  GS Q  PTS  ++FD GVD++V P +Y +W +++
Sbjct  162  TVEDENGLRHMLLCRVILGNTEVIPAGSTQSQPTSDSEDFDSGVDNIVAPTRYTIWGSHM  221

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            N+HI P +++SF+    N+        + ++ +    +PRI FP L+  L++FL P  M 
Sbjct  222  NSHIFPNFLLSFSFRLGNS--------SKINKVPLKGTPRIKFPDLLRALSQFLHPSRMA  273

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNKTGVRR  60
             I+ Y +D +  K+T+L +V++LR++AGD  L  I+K    +  Y  +GNK+ + R
Sbjct  274  LISKYYEDFQRNKITKLVLVRKLRQIAGDTSLRAIMK----LYPYKDIGNKSLLLR  325



>ref|XP_009115512.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Brassica rapa]
Length=308

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/273 (39%), Positives = 163/273 (60%), Gaps = 12/273 (4%)
 Frame = -2

Query  920  EGNREHQIMERKLVSGL-MGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSG  744
            +GN+EH +++   +SGL     +   +ES+ K   +  V  +A+  +F +F +A+  K+G
Sbjct  45   QGNQEHDVIKACFLSGLGAAFAVDTTVESVRKTS-TEGVAARARYVAFRIFTEAMARKNG  103

Query  743  FGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAMADEN  564
             G+ N+++ W   S++E+  I+ +GF      DGS G GV+L P    L     A  D  
Sbjct  104  -GDPNVKYGWFAGSREEIDRIVSYGFSSREIDDGSHGIGVHLVPSKCSLFAAVGAEPDGE  162

Query  563  GVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLY  384
            GVRH+L CRV+LG+ E +  GS Q HP+S EFDC VDDL  P+KYIVWS+N+N++ILP Y
Sbjct  163  GVRHLLLCRVLLGRPEQIDAGSTQSHPSSGEFDCAVDDLQEPRKYIVWSSNMNSYILPSY  222

Query  383  IISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKD  204
            I+SF    L      G           P+SP ++F ++VS L+KFL    M  I     D
Sbjct  223  IVSFKSPRLRVIGRGG---------PPPSSPWVSFTAVVSVLSKFLDASRMSLIKKTFDD  273

Query  203  HREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
             R+GK+ R ++V+++R++AGD+LL +I+K  +D
Sbjct  274  FRKGKIPRDQLVRKMRQVAGDDLLAQIIKNHKD  306



>ref|XP_009130223.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Brassica rapa]
Length=303

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 114/279 (41%), Positives = 171/279 (61%), Gaps = 21/279 (8%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG+R + ++ R   S L   G Q  + SI +N F++ V  +AKL++F +F +AVE
Sbjct  34   LMELLEGDRAYDLIYRNCKSAL---GDQCELLSILRNGFAA-VGSRAKLKAFQVFQEAVE  89

Query  755  EK----SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL  588
             K     G G   +++ W    K EL S+L++GF    N DG +G G+YL PD+  L CL
Sbjct  90   MKHAGEEGGGKARVKYGWCAVKKTELKSVLEYGFSQPRN-DGCYGRGLYLSPDNALLECL  148

Query  587  -NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
             +SA   E+G+R +L CRVILGK+E+V  GS Q  P+S EF+ GVDDL  P KYIVWST+
Sbjct  149  KDSAAESEDGMRFLLLCRVILGKSEVVPRGSTQSCPSSPEFESGVDDLASPSKYIVWSTH  208

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +NTH+LP +++            F   R    S+K+  SP + FP L+  L+KFLPP  +
Sbjct  209  MNTHVLPEFLVCIKAP-------FNFNR----SVKRLRSPWMAFPVLIKALSKFLPPTQI  257

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
              I  + KD +  +++R E+++R+R + GD+LL+ I+KA
Sbjct  258  LIIQKHYKDQQSRRISRSELIQRVRHITGDKLLVHIIKA  296



>emb|CDY44157.1| BnaA09g30950D [Brassica napus]
Length=308

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/273 (39%), Positives = 163/273 (60%), Gaps = 12/273 (4%)
 Frame = -2

Query  920  EGNREHQIMERKLVSGL-MGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSG  744
            +GN+EH +++   +SGL     +   +ES+ K   +  V  +A+  +F +F +A+  K+G
Sbjct  45   QGNQEHDVIKACFLSGLGAAFAVDTTVESVRKTS-TEEVAARARYVAFRIFTEAMARKNG  103

Query  743  FGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAMADEN  564
             G+ N+++ W   S++E+  I+ +GF      DGS G GV+L P    L     A  D  
Sbjct  104  -GDPNVKYGWFAGSREEIERIVSYGFSSREIDDGSHGIGVHLVPSKCSLFAAVGAEPDGE  162

Query  563  GVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLY  384
            GVRH+L CRV+LG+ E +  GS Q HP+S EFDC VDDL  P+KYIVWS+N+N++ILP Y
Sbjct  163  GVRHLLLCRVLLGRPEQIDAGSTQSHPSSGEFDCAVDDLQEPRKYIVWSSNMNSYILPSY  222

Query  383  IISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKD  204
            I+SF    L      G           P+SP ++F ++VS L+KFL    M  I     D
Sbjct  223  IVSFKSPRLRVIGRGG---------PPPSSPWVSFTAVVSVLSKFLDASRMSLIKKTFDD  273

Query  203  HREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
             R+GK+ R ++V+++R++AGD+LL +I+K  +D
Sbjct  274  FRKGKIPRDQLVRKMRQVAGDDLLAQIIKNHKD  306



>ref|XP_006356437.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2-like 
[Solanum tuberosum]
Length=319

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/275 (40%), Positives = 179/275 (65%), Gaps = 11/275 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I +EE N+EH +++   +SG+  +G +  I +I KN   S+++ +A+L+SF ++++A+ 
Sbjct  47   MIELEERNKEHDLIKAGFLSGMGHLGKEVEIVAIHKNS-CSTILGQARLESFRIYSEAMR  105

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDP-SMNKDGS-FGHGVYLCPDHFPLGCLNS  582
            +K G GN N+++AW G+SK E+ +I+ HGF   +  K G  FG GV+L P +   G L S
Sbjct  106  KKCG-GNANIKYAWFGSSKDEICNIISHGFSTITEPKSGECFGIGVHLYPANIH-GVL-S  162

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A+ DE+G+RH+L CRVILG TE++   S+Q+ PT Q+FD GVD+ + PK YI+W +N+N+
Sbjct  163  AVEDEDGLRHMLLCRVILGNTEVIEASSKQFQPTCQDFDSGVDNYLAPKTYIIWPSNMNS  222

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HILP +++S+   +     L G          K NS RI F  L+  L+K+L P  M  I
Sbjct  223  HILPNFVVSYRCPSC----LLGASSKIKKVSPKSNS-RIKFHDLLRVLSKYLHPSRMVLI  277

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            + Y +D ++ K+T+L ++++LR++AGD  L  ++K
Sbjct  278  SKYYEDFQKNKITKLVLIRKLRQIAGDTSLRAVMK  312



>ref|XP_006394384.1| hypothetical protein EUTSA_v10004619mg [Eutrema salsugineum]
 gb|ESQ31670.1| hypothetical protein EUTSA_v10004619mg [Eutrema salsugineum]
Length=317

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 118/283 (42%), Positives = 171/283 (60%), Gaps = 25/283 (9%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG++ H ++ R   S L   G Q  I S+ +N F + V  +AKL++F +F +AVE
Sbjct  44   LMELLEGDKAHDMIYRNCKSAL---GDQCQILSVLRNGFRN-VGSRAKLRTFQIFQEAVE  99

Query  755  EK--------SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFP  600
             K         G     +++ W   +KKEL SIL++GF    N DGS+G G+YL PD+  
Sbjct  100  MKHVGDDDGGGGSSRAKVKYGWCAVAKKELKSILEYGFSEPRN-DGSYGRGLYLSPDNAL  158

Query  599  LGCL-NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIV  423
            L CL +SA   E+G+R +L  RVILGK+E+V  GS Q  PT QEFD GVDDL  P KYIV
Sbjct  159  LECLKDSAPESEDGMRFLLLSRVILGKSEIVPRGSTQSCPTCQEFDSGVDDLASPTKYIV  218

Query  422  WSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLP  243
            WST++NTH+LP +++   +        F   R    S K+  SP + FP L+  L+KFLP
Sbjct  219  WSTHMNTHVLPEFLVCIKVP-------FNFNR----SPKRLRSPWLAFPVLIKALSKFLP  267

Query  242  PQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
            P  +  I  + KD +  +M+R E+++R+R + GD+LL+ I+KA
Sbjct  268  PSQILIIQKHYKDQQNRRMSRSELIQRVRGITGDKLLVHIIKA  310



>ref|XP_007044659.1| RCD one 2, putative isoform 1 [Theobroma cacao]
 gb|EOY00491.1| RCD one 2, putative isoform 1 [Theobroma cacao]
Length=338

 Score =   202 bits (513),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 111/275 (40%), Positives = 166/275 (60%), Gaps = 10/275 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMG---VGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            L  ++E + EH I++    + +     +  +  I +I KN  SS   ++A+  SF +FAK
Sbjct  44   LTKLQEPSLEHTIIKASFFTSIRDQSELAKKINIVAIHKNSHSSR-SREARADSFQVFAK  102

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLN  585
            AV +K G GN N+++ W GAS+ E+  I+ HGF    NK     + + L P  F    + 
Sbjct  103  AVADKCG-GNANLKYGWYGASRNEICEIVMHGF-SWCNKAAGNRYSISLSPAKFAFDSVL  160

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            S+ ADENG+RHVL CRVILGK E++   S Q+HPTS EFD GVDDL  P+KYIVWS  +N
Sbjct  161  SSEADENGLRHVLLCRVILGKQEVLTANSNQFHPTSPEFDSGVDDLSAPRKYIVWSVYMN  220

Query  404  THILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQS  225
            THILP Y+IS     L    + G +    +++ KP+S  ++FP+L+S L++FL P  + S
Sbjct  221  THILPSYVISIKAPYL----IEGSKGLLEANIIKPDSKWVSFPTLISMLSRFLEPSQIAS  276

Query  224  ITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIV  120
            +     D +E K+TR +++ R++ +AG + L  IV
Sbjct  277  LNKNYSDFQERKITRKQLIDRMKEIAGHQALAAIV  311



>emb|CDY66230.1| BnaAnng21860D [Brassica napus]
Length=356

 Score =   202 bits (513),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 170/278 (61%), Gaps = 20/278 (7%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG+R + ++ R   S L   G Q  + SI +N F++ V  +AKL++F +F +AVE
Sbjct  88   LMELLEGDRAYDLIYRNCKSAL---GDQCDLLSILRNGFAT-VGSRAKLKAFQVFQEAVE  143

Query  755  EK---SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL-  588
             K    G G   +++ W    K EL S+L++GF    N DG +G G+YL PD+  L CL 
Sbjct  144  MKHVGEGGGKARVKYGWCAVKKTELKSVLEYGFSQPRN-DGCYGRGLYLSPDNALLECLK  202

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
            +SA   E+G+R +L  RVILGK+E+V  GS Q  P+S EFD GVDDL  P KYIVWST++
Sbjct  203  DSAAESEDGMRFLLLSRVILGKSEIVPLGSTQSCPSSPEFDSGVDDLASPSKYIVWSTHM  262

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            NTH+LP +++            F + R    S K+  SP + FP L+  L+KFLPP  + 
Sbjct  263  NTHVLPEFLVCIKAP-------FNINR----SAKRLRSPWMAFPVLIKALSKFLPPSQIL  311

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
             I  + KD +  +++R E+++R+R + GD+LL+ I+KA
Sbjct  312  IIQKHYKDQQNRRISRSELIQRVRHITGDKLLVHIIKA  349



>emb|CDY30723.1| BnaA02g33450D [Brassica napus]
Length=356

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/278 (41%), Positives = 170/278 (61%), Gaps = 20/278 (7%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG+R + ++ R   S L   G Q  + SI +N F++ V  +AKL++F +F +AVE
Sbjct  88   LMELLEGDRAYDLIYRNCKSAL---GDQCDLLSILRNGFAT-VGSRAKLKAFQVFQEAVE  143

Query  755  EK---SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL-  588
             K    G G   +++ W    K EL S+L++GF    N DG +G G+YL PD+  L CL 
Sbjct  144  MKHVGEGGGKARVKYGWCAVKKTELKSVLEYGFSQPRN-DGCYGRGLYLSPDNALLECLK  202

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
            +SA   E+G+R +L  RVILGK+E+V  GS Q  P+S EFD GVDDL  P KYIVWST++
Sbjct  203  DSAAESEDGMRFLLLSRVILGKSEIVPLGSTQSCPSSPEFDSGVDDLASPSKYIVWSTHM  262

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            NTH+LP +++            F + R    S K+  SP + FP L+  L+KFLPP  + 
Sbjct  263  NTHVLPEFLVCIKAP-------FNINR----SAKRLRSPWMAFPVLIKALSKFLPPSQIL  311

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
             I  + KD +  +++R E+++R+R + GD+LL+ I+KA
Sbjct  312  IIQKHYKDQQNRRISRSELIQRVRHITGDKLLVHIIKA  349



>ref|XP_009590725.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
isoform X2 [Nicotiana tomentosiformis]
Length=315

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 177/277 (64%), Gaps = 16/277 (6%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I +EE ++EH +++   ++ +  +  +  + +I KN   S+++ KA+L++F +F++AV 
Sbjct  46   MIKLEENDKEHGLIKSGFITCMGPLAKEVEVVAIHKNS-CSTILGKARLEAFRIFSEAVR  104

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMN-KDGS-FGHGVYLCPDHFPLGCLNS  582
            EK   GN N+++AW G+SK+E+  I+ HGF  +   K G  FG GVYL P +   G L S
Sbjct  105  EKCN-GNANIKYAWFGSSKEEICKIISHGFSRTTEAKSGECFGIGVYLYPANID-GVL-S  161

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTS--QEFDCGVDDLVFPKKYIVWSTNI  408
             + DENG+RH+L CRVILG TE++  GS Q  PTS  ++FD GVD++V P +Y +W +++
Sbjct  162  TVEDENGLRHMLLCRVILGNTEVIPAGSTQSQPTSDSEDFDSGVDNIVAPTRYTIWGSHM  221

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            N+HI P +++SF+    N+        + ++ +    +PRI FP L+  L++FL P  M 
Sbjct  222  NSHIFPNFLLSFSFRLGNS--------SKINKVPLKGTPRIKFPDLLRALSQFLHPSRMA  273

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
             I+ Y +D +  K+T+L +V++LR++AGD  L  I+K
Sbjct  274  LISKYYEDFQRNKITKLVLVRKLRQIAGDTSLRAIMK  310



>ref|XP_011071855.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
isoform X2 [Sesamum indicum]
Length=345

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 162/246 (66%), Gaps = 8/246 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
             + + + + +++ +++KLVS L   G  A +E+I +N +SS +  +A+L SFS+++KA++
Sbjct  90   FVRIPDDDTKYENIKKKLVSRLSSCGFSAQVETIHRNGYSS-MTSRARLHSFSIYSKAIQ  148

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
             KS  GN N+++AW G SK+E++ IL +GF   +N +G +G+GVYL     PL    S+ 
Sbjct  149  MKS-HGNANLKYAWYGGSKQEISEILSYGFGLPLN-NGVYGYGVYLSTVDHPLESFQSST  206

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
            ADE+G+RH+L CRV+LG  E++ PGS Q+HP+S+EFD GVDDL  PKKYIVW+T +NTHI
Sbjct  207  ADEDGLRHMLLCRVLLGNMEVICPGSGQYHPSSEEFDSGVDDLTSPKKYIVWTTKMNTHI  266

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LP ++I + IS+       G Q+  +   K P S  I   +L++ L KFLP   ++ ++ 
Sbjct  267  LPEFVIGYRISSC----CNGYQK-ILEPPKHPTSDWIHLDTLINALPKFLPADAIKLLSE  321

Query  215  YVKDHR  198
            +   ++
Sbjct  322  HNSQYK  327



>emb|CDY70596.1| BnaAnng34290D [Brassica napus]
Length=303

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/279 (41%), Positives = 169/279 (61%), Gaps = 21/279 (8%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG+R + ++ R   S L   G Q  + SI +N F + V  +AKL++F +F +AVE
Sbjct  34   LMELLEGDRAYDLIYRNCKSAL---GDQCELLSILRNGFGN-VGSRAKLKAFQVFQEAVE  89

Query  755  EK----SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL  588
             K     G G   +++ W    K EL S+L++GF    N DG +G G+YL PD+  L CL
Sbjct  90   MKHAGEEGGGKARVKYGWCAVKKTELKSVLEYGFSQPRN-DGCYGRGLYLSPDNALLECL  148

Query  587  -NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
             +SA   E+G+R +L  RVILGK+E+V  GS Q  P+S EFD GVDDL  P KYIVWST+
Sbjct  149  KDSAAESEDGMRFLLLSRVILGKSEVVPRGSTQSCPSSPEFDSGVDDLASPSKYIVWSTH  208

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +NTH+LP +++            F   R    S+K+  SP + FP L+  L+KFLPP  +
Sbjct  209  MNTHVLPEFLVCIKAP-------FNFNR----SVKRLRSPWMAFPVLIKALSKFLPPTQI  257

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
              I  + KD +  +++R E+++R+R + GD+LL+ I+KA
Sbjct  258  LIIQKHYKDQQSRRISRSELIQRVRHITGDKLLVHIIKA  296



>ref|XP_010477650.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Camelina sativa]
Length=329

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/281 (40%), Positives = 166/281 (59%), Gaps = 20/281 (7%)
 Frame = -2

Query  923  EEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSG  744
            +EGN EH +++  L+SG+  V     I +I KN  S  +  +AK  SF +F +AV  K  
Sbjct  55   DEGNAEHDVIKACLLSGMGFVSSDTTIVTIRKNT-SDGITNRAKFVSFRIFTEAVARKRV  113

Query  743  FGNGNMQFAWLGASKKELTSILQHGFDPSMNKD-GSF-------GHGVYLCPDHFPLGCL  588
             G+ N+++ W   SK+E+ SI+ +GF    N+D G F       G G++L P    L   
Sbjct  114  GGDANVKYGWYAGSKEEIESIVSYGFS---NQDVGKFEGDPCSHGVGIHLVPSKCSLLAA  170

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
            ++   DE G+RH+L CR+ILGK EL   GS+Q +P+S EFD GVDDL  P+ Y++WS N+
Sbjct  171  SATEPDEEGLRHLLLCRLILGKPELTTSGSKQSYPSSPEFDSGVDDLRNPRNYVIWSCNM  230

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            N+HILP YI+SF    L       V R   ++  +P+SP ++F SL+S L+K +    M 
Sbjct  231  NSHILPSYIVSFRSPRLT------VSRGGFAA--RPSSPWVSFDSLMSMLSKSMDSSRMN  282

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
             I     D R+ K+ R ++V+++R +AGD LL +I+K  RD
Sbjct  283  LIIRTYDDFRKRKIRRDQLVRKMREVAGDNLLAEIIKNHRD  323



>ref|XP_010498866.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
isoform X1 [Camelina sativa]
Length=325

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 171/286 (60%), Gaps = 22/286 (8%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI ++EGN EH +++  L+SG+  V     I +I KN  S  +  +A+  SF +F  AV 
Sbjct  47   LILLDEGNSEHDVIKACLLSGMGFVSSDTTIVTIRKNT-SDGITNRARFLSFRIFTDAVA  105

Query  755  EKSGFGNGNMQFAWL-GASKKELTSILQHGFDPSMNKD-GSF-------GHGVYLCPDHF  603
             K G G+ N+++ W  G+SK+E+ SI+ +GF    N+D G F       G G++  P   
Sbjct  106  RKRG-GDANVKYGWCAGSSKEEIESIVSYGFS---NRDVGKFEDDPCSHGVGIHFVPSKC  161

Query  602  PLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIV  423
             L   ++A  DE G+RH+L CR+ILGK EL   GS+Q +P+S EFD GVDDL  P+ Y+V
Sbjct  162  SLLAASAAEPDEEGLRHLLLCRLILGKPELTTSGSKQLYPSSPEFDSGVDDLRNPRNYVV  221

Query  422  WSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLP  243
            WS N+N+HILP YI+SF    L       V R   ++  +P+SP ++F SL+S L+K + 
Sbjct  222  WSCNMNSHILPSYIVSFRSPRLT------VSRGGFAA--RPSSPWVSFDSLMSMLSKSMD  273

Query  242  PQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
               M  I     + R+ K+ R ++VK++R +AGD LL +I+K  RD
Sbjct  274  SSRMNLIIRTYDEFRKRKIRRDQLVKKMREVAGDNLLAEIIKNHRD  319



>ref|XP_010552642.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Tarenaya hassleriana]
 ref|XP_010552643.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Tarenaya hassleriana]
 ref|XP_010552644.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Tarenaya hassleriana]
Length=322

 Score =   199 bits (505),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 110/281 (39%), Positives = 165/281 (59%), Gaps = 14/281 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI + EGN E  ++    +SGL  V       S+ KN  + SV+ KAK   F +F  AV 
Sbjct  44   LIPIGEGNPEFNLITASFLSGLGPVASDTTTLSVLKNS-TESVLTKAKFMVFRIFTAAVA  102

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGF-----DPSMNKDGSFGHGVYLCPDHFPLGC  591
             K+G G  NM++ W   SK+E+  I+  GF     +   N   S G G++L P    L  
Sbjct  103  RKNG-GVPNMKYGWFAGSKEEIRRIISLGFSGREIEKFANDAASHGVGIHLVPSKLSLAA  161

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
                  DE G+RH+L CR+ILGK+E +  GSRQ +P+S EFD GVD+L  P++YIVWS +
Sbjct  162  ALGTEPDEEGLRHLLLCRIILGKSEPLISGSRQMYPSSSEFDSGVDNLQNPQRYIVWSCS  221

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +N+HILP Y++SF      +  L G+ R+ +  L +P++  ++FP+L+S L+K L P  M
Sbjct  222  MNSHILPSYVVSF-----RSPRLGGISRDGI--LPRPSTTWVSFPALISLLSKSLDPPRM  274

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
              I     D R+ K+ R ++V+++R +AGD+LL+ I+K  R
Sbjct  275  NLILETYDDFRKRKLRRDKLVQKMREVAGDDLLVHIIKNYR  315



>ref|XP_007155430.1| hypothetical protein PHAVU_003G200500g [Phaseolus vulgaris]
 gb|ESW27424.1| hypothetical protein PHAVU_003G200500g [Phaseolus vulgaris]
Length=326

 Score =   199 bits (505),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 111/277 (40%), Positives = 169/277 (61%), Gaps = 28/277 (10%)
 Frame = -2

Query  923  EEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSG  744
            E+G R H     + V  L   G++  + +I KN  SS VM +A+ Q F +FA+A  E   
Sbjct  45   EDGCRVHT----RFVRSLTVNGLRPEVVTIAKNAHSS-VMARARAQCFQVFARAAGELHE  99

Query  743  FGNGNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGH----GVYLCPDHFPLGCLNSA  579
             G  N++ AW GAS K+E+  I QHGF          GH    G+ L P  +PL  + S+
Sbjct  100  -GQANVRLAWYGASGKEEIADIAQHGF----------GHAHCNGLRLSPLDYPLQSVKSS  148

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
              D +GVR++L C VILGKTE+V  GS Q   +S+E+D GVDDL+ PK+Y++W   +NTH
Sbjct  149  GVDSDGVRYLLLCSVILGKTEVVPRGSNQRRSSSEEYDSGVDDLLAPKEYVIWCNRLNTH  208

Query  398  ILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
            +LP Y++SFT+ +L  +        ++    +P+SP + FP+L+S L++ LPP  + +I 
Sbjct  209  VLPEYVLSFTLPSLKGN-------VNIREPLRPSSPWMPFPALISVLSRILPPAEVATIV  261

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
               KD+ E +++R EM++R+R +AGD+LLI I+K+ R
Sbjct  262  KIRKDYTELRISRYEMIQRVRNIAGDKLLISIIKSFR  298



>ref|XP_006356433.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2-like 
[Solanum tuberosum]
Length=316

 Score =   198 bits (504),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 102/272 (38%), Positives = 179/272 (66%), Gaps = 12/272 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I +EE ++EH +++   +SG+  +G +  + +I KN   S+++ +A+ +SFS++++A+ 
Sbjct  46   IIKLEERDQEHDLIKAGFLSGMGQLGNEIEVVAIHKNS-RSTILGQARSESFSIYSEAMR  104

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMN-KDGS-FGHGVYLCPDHFPLGCLNS  582
            +K G G+ N+++AW+G+SK E+  I+ HGF   M  K G  FG+GV+L P +  +  + S
Sbjct  105  KKCG-GDANIKYAWIGSSKDEICKIISHGFSTIMEPKSGDCFGNGVHLYPTN--IDGVFS  161

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A+ DENG+RH+L CRVILG TE++   S+Q+ PT Q+FD GVD+   PK YI+W +N+N+
Sbjct  162  AVEDENGLRHMLLCRVILGNTEVIEASSKQFQPTCQDFDSGVDNYFAPKTYIIWPSNMNS  221

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            HILP++++SF    L  ++      + +  +    +PRI F +L+  L+ FL P  M  I
Sbjct  222  HILPIFLVSFKGPLLLGNS------SKIKKIPLNPTPRIKFSNLLRVLSNFLHPSRMVLI  275

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIK  126
            +   +D ++ K++++  V++LR++AGD  L+K
Sbjct  276  SKIYEDFQKNKISKMVFVQKLRQIAGDTSLLK  307



>ref|XP_002890588.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66847.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/286 (39%), Positives = 167/286 (58%), Gaps = 15/286 (5%)
 Frame = -2

Query  947  RNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFA  768
            +   LI + EGN EH +++  L+SG+  V     I +I KN  S  +  +AK  SF +F 
Sbjct  36   KTDSLILLGEGNPEHDVIKTCLLSGMGVVSSDTTIVTIRKNS-SEGITTRAKFLSFRIFT  94

Query  767  KAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFD----PSMNKDG-SFGHGVYLCPDHF  603
             AV  K G G+ N+++ W   SK E+ SI+ +GF          DG S G G++L P   
Sbjct  95   DAVARKHG-GDANVKYGWYAGSKPEIQSIISYGFSNRDVGKFENDGCSHGIGIHLVPSKC  153

Query  602  PLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIV  423
             L   ++   DE G+R++L CR+ILGK EL+  GS+Q +P+S EFD GVDDL  P+ Y++
Sbjct  154  SLLAASATEPDEEGLRYLLLCRLILGKPELIISGSKQSYPSSAEFDSGVDDLHNPRNYVI  213

Query  422  WSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLP  243
            WS N+N+ ILP YI+SF    L       V R   ++  +P+SP ++F +L+S L+K + 
Sbjct  214  WSCNMNSFILPSYIVSFRSPRLR------VSRGGFAA--RPSSPWVSFAALMSMLSKSMD  265

Query  242  PQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
            P  M  I     D R+ K+ R ++V+++R +AGD LL +I+K  RD
Sbjct  266  PSRMNLIIRTYDDFRKRKIRRDQLVRKMREVAGDNLLAEIIKNHRD  311



>ref|XP_006305404.1| hypothetical protein CARUB_v10009796mg [Capsella rubella]
 gb|EOA38302.1| hypothetical protein CARUB_v10009796mg [Capsella rubella]
Length=315

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 162/280 (58%), Gaps = 18/280 (6%)
 Frame = -2

Query  920  EGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSS-SVMKKAKLQSFSLFAKAVEEKSG  744
            EGN ++ +++R L+SG+        I  I KN     S+  +AK  SF +F  AV  K+G
Sbjct  40   EGNEDYDVIKRCLISGMGSFSRDTKIAKIRKNSSEGISLTTQAKFFSFKVFTDAVASKNG  99

Query  743  FGNGNMQFAWLGASKKELTSILQHGFDPSMNKDG-------SFGHGVYLCPDHFPLGCLN  585
             G+ N+ + W  ASK+E+  I+ +GF      +G       S G G++L P  F L   +
Sbjct  100  -GDANVHYGWYAASKEEIERIVSYGFTNREVGNGAAPAAGDSHGIGIHLVPSRFSLLAAS  158

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            +   DE G+RH+L CR+ILG+ EL+  GS+Q +P+S EFD GVDDL  P+KY++WS N+N
Sbjct  159  ATEPDEEGLRHLLLCRLILGRPELINSGSKQSYPSSAEFDSGVDDLQNPRKYVIWSCNMN  218

Query  404  THILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQS  225
            ++ILP Y++SF    L   +             KP+SP ++F +L+S L+K + P  M  
Sbjct  219  SYILPSYVVSFKSPRLPGRDGLAA---------KPSSPWVSFAALMSLLSKSMEPSRMNL  269

Query  224  ITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
            I       R  ++ R ++V+++R +AGD LL +I+K +RD
Sbjct  270  IIQTYDAFRTRRIRRHQLVRKMREVAGDNLLAEIIKNERD  309



>ref|XP_010045553.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Eucalyptus grandis]
Length=352

 Score =   197 bits (501),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 175/281 (62%), Gaps = 11/281 (4%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            +S L  + EG++  +I+  + VS L   G  +    I +N FSS V  KA+ Q F L ++
Sbjct  69   SSGLTELSEGDQAFRIIRERFVSWLGAHGGGSRRGGIHQNSFSS-VSAKARAQVFQLCSQ  127

Query  764  AVEEKSGFGN-GNMQFAWLGASKKELTSILQHGFDPS---MNKDGSFGHGVYLCPDHFPL  597
            AV+++SG G+  N++ AW   S++E+ +I  +GF  S   MN    FG G+Y  P+   +
Sbjct  128  AVQQRSGGGDTANVRHAWYAISREEVPNIFSYGFGYSGKPMNS-ALFGRGLYFAPEIHLI  186

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
                 A  D +G+RH+L CRVILGK+ELV  GS Q HP+S+++D GVDDL+ P +YIVWS
Sbjct  187  ESAKYAPMDRDGLRHLLLCRVILGKSELVTFGSEQSHPSSEQYDSGVDDLLSPTRYIVWS  246

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            T++NTH+LP Y+ISF        +L    R S  S ++  SPR++  +L+SEL K L P 
Sbjct  247  THMNTHVLPEYVISFRAPC----DLRERLRTSEMS-REQTSPRVSCRNLISELLKILRPS  301

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
             M  +  + +DH  GK++R  +V+++R++ GD+LLI+I+ +
Sbjct  302  DMNLVAKHYEDHMRGKISRHVLVQKVRQIIGDKLLIEIINS  342



>ref|XP_004501930.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2-like 
[Cicer arietinum]
Length=319

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 172/280 (61%), Gaps = 15/280 (5%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            +S L+ + E +  H +++ + + GL  +G Q  I +I +N  S  V  +A+LQSF ++A+
Sbjct  37   DSFLLRIGESDVVHNLLKTRFLRGLGLLGAQTQILAIHRNACSDFV-SQARLQSFHVYAE  95

Query  764  AVEEKSGFGNGNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL  588
            AV +    GN N+++AW G S + ++  I+ HGF          GH + L PD  PL  +
Sbjct  96   AVSKLRA-GNANVRYAWYGTSGENDVNDIVSHGFS------HVHGHNLCLSPDDSPLQSV  148

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
               +   +G+RH++ CRVILG+TE+V+  ++Q +P+ +++D GVD    P KY++WS+ +
Sbjct  149  KRCVVGRDGMRHLILCRVILGRTEIVQDDTKQCYPSCEDYDSGVDSFAAPTKYMIWSSRM  208

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            NTH+ P Y+ISF + +      F     +     +P+SP + FP+L+S L+K LPP  + 
Sbjct  209  NTHVWPAYVISFRVPS------FKEIEKTEEEHVRPSSPWLPFPTLISVLSKVLPPLDIS  262

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
             I+ + K  +E K++R E+++++R++AGD+LLI ++K+ R
Sbjct  263  LISKFYKAKKERKISRHELIQKVRQIAGDKLLISVIKSYR  302



>ref|NP_173769.1| probable inactive poly [ADP-ribose] polymerase SRO2 [Arabidopsis 
thaliana]
 sp|Q9ZUD9.1|SRO2_ARATH RecName: Full=Probable inactive poly [ADP-ribose] polymerase 
SRO2; AltName: Full=Protein SIMILAR TO RCD ONE 2 [Arabidopsis 
thaliana]
 gb|AAC98011.1| F5O8.11 [Arabidopsis thaliana]
 gb|AAY25415.1| At1g23550 [Arabidopsis thaliana]
 gb|AEE30402.1| probable inactive poly [ADP-ribose] polymerase SRO2 [Arabidopsis 
thaliana]
Length=323

 Score =   194 bits (492),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 106/282 (38%), Positives = 163/282 (58%), Gaps = 14/282 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI + EGN EH +++  L+SG+  V     I +I KN     +  +AK  +F +F  AV 
Sbjct  45   LILLGEGNPEHDVIKTCLLSGMGVVSSDTTIVTISKNSSERGITTRAKFLAFRIFTDAVA  104

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPS-----MNKDGSFGHGVYLCPDHFPLGC  591
             K G G+ N+++ W   S+ E+  I+ +GF         N  GS G G++L P    L  
Sbjct  105  RKHG-GDANVKYGWYAGSRDEIQRIISYGFSNRDVGKFENDGGSHGIGIHLVPSKCSLLA  163

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
             ++   DE G+R++L CRVILGK E++  GS+Q +P+S EFD GVDDL  P+ Y++WS N
Sbjct  164  ASATEQDEEGLRYLLLCRVILGKPEIIISGSKQSYPSSAEFDSGVDDLHNPRNYVIWSCN  223

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +N+ ILP YI+SF    L       V R   +S  +P+SP ++F SL+S L+  + P  M
Sbjct  224  MNSCILPSYIVSFRSPRLR------VSRGGFAS--RPSSPWVSFASLMSMLSTSMDPSRM  275

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
              I     D R+ K+ R ++V+++R +AGD LL +I+K  ++
Sbjct  276  NLIIRTYDDFRKRKIRRDQLVRKMREVAGDNLLAEIIKNHKN  317



>ref|XP_004238657.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Solanum lycopersicum]
 ref|XP_010320568.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Solanum lycopersicum]
Length=315

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 179/276 (65%), Gaps = 13/276 (5%)
 Frame = -2

Query  947  RNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFA  768
            +++ ++ +EEG+++H +++   +SG+  +G +  + ++ KN   S+++ +A+ +SF +++
Sbjct  42   KSNEVMKLEEGDQDHDLIKAGFLSGMGQLGNEIEVVAVHKNS-CSTILGQARSESFRIYS  100

Query  767  KAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSM--NKDGSFGHGVYLCPDHFPLG  594
            +A+ +K   G+ N+++AW G+SK E+ +I+ HGF   M  N    FG+GV+L P +  + 
Sbjct  101  EAMRKKCS-GDANIKYAWFGSSKDEICNIISHGFSTIMEPNYGDCFGNGVHLYPAN--ID  157

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
             + SA+ DENG+RH+L CRVILG TE++   S+Q+ PT Q+FD GVD+ + PK YI+W +
Sbjct  158  GVFSAVEDENGLRHMLLCRVILGNTEVIEASSKQFQPTCQDFDSGVDNYLAPKTYIIWPS  217

Query  413  NINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQI  234
            N+N+HILP +++SF        +L       +    KP +PRI F +L+  L+ FL P  
Sbjct  218  NMNSHILPNFLVSFKGPLSLGTSL------KIKIPLKP-TPRIKFSNLLRVLSNFLHPSR  270

Query  233  MQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIK  126
            M  IT   +D ++ K++++  V++LR++AGD  L+K
Sbjct  271  MVLITKKYEDFQKNKISKMIFVQKLRQIAGDTSLLK  306



>gb|KFK27981.1| hypothetical protein AALP_AA8G456300 [Arabis alpina]
Length=314

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 112/281 (40%), Positives = 166/281 (59%), Gaps = 23/281 (8%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG++ + ++ R   SGL     Q  I SI +N F   V   AK ++F +F +AVE
Sbjct  43   LMELLEGDKAYDLIYRNCKSGLND---QCQIVSILRNGFKH-VGSLAKFKTFQVFQEAVE  98

Query  755  EKSG--FGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPL-GCL-  588
             K G   G   +++ W    + E+ SIL +GF    N DGS+G G+YL PD+  L  CL 
Sbjct  99   FKHGGESGGAKVKYGWCTVKRTEVKSILDYGFSQPRN-DGSYGRGLYLSPDNTSLLECLK  157

Query  587  ---NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
               +S  ++E+G+R +L CRVILGK+E+V  GS Q  P+SQEFD GVDDL  P KYIVWS
Sbjct  158  DDTSSEESEEDGIRFLLLCRVILGKSEIVSKGSTQSCPSSQEFDSGVDDLASPSKYIVWS  217

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            T++NTH+LP +++                 +   S+K+  SP + FP L+  L+KFLPP 
Sbjct  218  THMNTHVLPEFLVCIKAPL-----------HLTRSVKRLRSPWMAFPVLIKALSKFLPPS  266

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
             +  I  + KD +  +++R E+++R+R + GD LL  I+KA
Sbjct  267  QIFIIQKHYKDQQNRRISRSELIQRVRSITGDRLLADIIKA  307



>ref|XP_007138076.1| hypothetical protein PHAVU_009G178500g [Phaseolus vulgaris]
 gb|ESW10070.1| hypothetical protein PHAVU_009G178500g [Phaseolus vulgaris]
Length=409

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 179/291 (62%), Gaps = 19/291 (7%)
 Frame = -2

Query  968  VTDLHEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKL  789
             T+   Q ++  + + EG+  H +++R  V GL  +G +  + SI +N  S +V  +A+L
Sbjct  114  TTETMRQEDASFVRLPEGDVLHDLIKRGFVRGLGHLGPKTEVLSIHRNTCSGAV-SQARL  172

Query  788  QSFSLFAKAVEEKSGFGNGNMQFAWLGA-SKKELTSILQHGFDPSMNKDGSFGHG--VYL  618
            QSF L A+AV  K   GN N+++AW G   + ++  I+ HGF        +  HG  + L
Sbjct  173  QSFQLHARAVA-KLREGNSNVKYAWYGTRGEDDINDIVSHGF--------AHVHGPQLLL  223

Query  617  CPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFP  438
             PD  PL  +   +  ++GVRHVL CRVILG++ELV  G+ Q +P+SQ +D GVD    P
Sbjct  224  SPDDAPLQSVRGCVVGKDGVRHVLLCRVILGRSELVDGGTEQCYPSSQNYDSGVDSFSAP  283

Query  437  KKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSEL  258
             KYI+WS  +NTH+LP Y+ISF + +       G+++ S   L +P+SP + FP+L+S L
Sbjct  284  SKYIIWSNRMNTHVLPAYVISFRVPSFK-----GIEKKS-EELLRPSSPWMPFPTLISVL  337

Query  257  AKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
            +K L  + +  I+ + KD ++ K++R E+++R+R++AGD+LL  ++K+ R+
Sbjct  338  SKVLASRDIALISKFYKDKKDKKISRHELIQRVRQIAGDKLLFAVIKSYRE  388



>ref|XP_003601269.1| hypothetical protein MTR_3g077870 [Medicago truncatula]
 gb|AES71520.1| inactive poly [ADP-ribose] polymerase SRO4 [Medicago truncatula]
Length=327

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 177/296 (60%), Gaps = 27/296 (9%)
 Frame = -2

Query  968  VTDLHEQRNSR------LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSV  807
             T   EQR  R      L+ + EG+  + +++ + + GL  +  +A I +I++N  S +V
Sbjct  33   TTTGEEQRQRRQNSDSFLVWLGEGDSVYDLLKTRFLHGLGALSSKAEILAIQRNACSDAV  92

Query  806  MKKAKLQSFSLFAKAVEEKSGFGNGNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGH  630
              +A+L+SF ++A+AV +  G G+ N+++AW G+S + ++  IL +GF        S  H
Sbjct  93   -SQARLRSFLVYAEAVSKLRG-GDSNVKYAWYGSSGENDVRGILSNGF--------SHVH  142

Query  629  GVYLC--PDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGV  456
            G  +C  PD  PL  + S     +GVRH++ CRVILG+TE+V+  ++Q +P+  ++D GV
Sbjct  143  GNSICLSPDDSPLQSVKSCAVGRDGVRHLILCRVILGRTEIVQADTKQCYPSCADYDSGV  202

Query  455  DDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFP  276
            D    P KY++WS+ +NTH+ P Y++SF +S+L A  + G  R        P SP + FP
Sbjct  203  DSFSAPTKYMIWSSRMNTHVWPAYVLSFKVSSLKAVEIEGYGR--------PTSPSVPFP  254

Query  275  SLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            +L+S L+K  P   +  I  + K  +E K++R E+++++R++AGD+LL  I+K  R
Sbjct  255  TLISMLSKVSPQLDIALICKFYKARKEKKISRHELIEKVRQIAGDKLLFSIIKYYR  310



>ref|XP_010045554.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Eucalyptus grandis]
Length=343

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/280 (38%), Positives = 170/280 (61%), Gaps = 14/280 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ +EEG++ H+ ++ + VS L  +  Q  + +I ++  SSS   +++ Q+F ++++AV+
Sbjct  76   LMELEEGDKAHRFIKERFVSRLGALREQVTVAAIHRS-CSSSFAARSRAQAFQVYSEAVQ  134

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
            +K G    N++           +S +      S+           L P       L+ A 
Sbjct  135  KKGGGDTANVRLPR--------SSRMASATAGSLRTVACMAAEFILLPIIILSKALSPAP  186

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
             DE+G+RH+L C+VILGK+EL+  GS Q HP+S+++D GVDDL  PK+YIVW+T+INTH+
Sbjct  187  VDEDGLRHLLLCQVILGKSELIGFGSEQSHPSSEQYDSGVDDLSSPKRYIVWNTHINTHV  246

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LP Y++SF     +     G+ R S  S +KP SP + F  L+SEL+K LPP  + S++ 
Sbjct  247  LPEYVVSFRAPYCSR----GMLRTSGKS-RKPTSPWMPFRVLISELSKILPPSDINSMSK  301

Query  215  YVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQI  96
            Y KDH+EGK+ R  +V+++R++AGD LL +I+K+ R  Q 
Sbjct  302  YYKDHKEGKIPRHVLVRKVRQIAGDGLLTRIIKSSRTKQF  341



>gb|EYU31252.1| hypothetical protein MIMGU_mgv1a025306mg, partial [Erythranthe 
guttata]
Length=327

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/255 (39%), Positives = 158/255 (62%), Gaps = 10/255 (4%)
 Frame = -2

Query  863  VGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTS  684
            +G +  + ++ KN +SS V  +AKL++F +F++AV  + G G+ N+++ W G S  E+  
Sbjct  69   LGEEIDVVAVHKNMYSS-VAGQAKLEAFRVFSRAVAARRG-GDANVKYGWYGGSPDEIRD  126

Query  683  ILQHGFDPS--MNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELV  510
            ++ +GF  S    K  S G G++L P + P      A  DENGVRH+L CRVILG TE++
Sbjct  127  VVTYGFVGSGKFEKGISHGVGIHLSPVNSPFDSAMKAKEDENGVRHMLLCRVILGNTEII  186

Query  509  RPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQ  330
             PGS Q HP+S +FD G+D+ + P +YIVW++ +N+HI P YIISF      A  L G++
Sbjct  187  GPGSEQSHPSSTQFDSGIDNPIAPTQYIVWTSYMNSHIFPNYIISF-----RAPCLIGLR  241

Query  329  RNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRL  150
            R +  S   PNS  ++FP  +  L++F+ P  +  I  Y  + RE K+ R ++++RLR +
Sbjct  242  R-TWRSATTPNSLSMSFPVFLKVLSRFVHPSKVGLILNYYNEFRENKIVRSQLIRRLRNI  300

Query  149  AGDELLIKIVKAQRD  105
             GD+LL  ++K  R+
Sbjct  301  VGDKLLSSVIKLCRN  315



>ref|XP_009151374.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Brassica rapa]
 emb|CDY00302.1| BnaA06g22030D [Brassica napus]
Length=313

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 172/280 (61%), Gaps = 23/280 (8%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG++ + ++ R   SGL   G Q  + SI +N F + +  +AKL++F +F +AVE
Sbjct  43   LMELLEGDKAYDLIYRNCKSGL---GDQCQLLSILRNGFRT-IGSRAKLKTFQVFQEAVE  98

Query  755  EK-----SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGC  591
             K      G G   +++ W   +K EL SIL++GF    N DGS+G G+YL PD+  L C
Sbjct  99   MKHVGEGGGGGGSRVKYGWCAVTKTELKSILEYGFSQPSN-DGSYGRGLYLSPDNALLEC  157

Query  590  L-NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
            +  SA   E+G+R +L  RVILGK+E+V  GS Q  P+S EFD GVD+L  PKKYIVWST
Sbjct  158  VKGSAAESEDGMRFLLLSRVILGKSEVVPRGSTQSCPSSPEFDSGVDNLSSPKKYIVWST  217

Query  413  NINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQI  234
            ++NTH+LP +++                  + +S ++  SP + FP L+  L+KFLPP  
Sbjct  218  HMNTHVLPEFLVCLKTPF------------NFNSPRRLRSPWMPFPLLIKALSKFLPPPQ  265

Query  233  MQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
            +  I  + +D +  +++R E+++R+RR+ GD+LL+ I+KA
Sbjct  266  IVIIQKHYRDQQNMRISRSELIQRVRRITGDKLLVHIIKA  305



>emb|CDY61348.1| BnaC03g74760D [Brassica napus]
Length=311

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/278 (39%), Positives = 170/278 (61%), Gaps = 21/278 (8%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG++ + ++ R   SGL   G Q  + SI +N F + +  +AKL++F +F +AVE
Sbjct  43   LMELFEGDKAYDLIYRNCKSGL---GDQCQLLSILRNGFRT-LGSRAKLKTFQVFQEAVE  98

Query  755  EK---SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL-  588
             K      G   +++ W   +K EL  IL++GF    N DGS+G G+YL PD+  L C+ 
Sbjct  99   MKHVGEEGGGSRVKYGWCAVTKTELKPILEYGFSQPSN-DGSYGRGLYLSPDNALLECVK  157

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
             SA   E+G+R +L  RV+LGK+E+V  GS Q  P+S EFD GVD+L  PKKYIVWST++
Sbjct  158  GSAAESEDGMRFLLLSRVVLGKSEVVPRGSSQSCPSSPEFDSGVDNLSSPKKYIVWSTHM  217

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            NTH+LP +++                  + +S ++  SP + FP L+  L+KFLPP  + 
Sbjct  218  NTHVLPEFLVCLKTPF------------NFNSPRRLRSPWMPFPLLIKALSKFLPPPQIF  265

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
             I  + +D +  +++R E+++R+RR+ GD+LL+ I+KA
Sbjct  266  IIQKHYRDQQNMRISRSELIQRVRRITGDKLLVHIIKA  303



>ref|XP_009619110.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Nicotiana tomentosiformis]
 ref|XP_009619111.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Nicotiana tomentosiformis]
Length=337

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/284 (36%), Positives = 173/284 (61%), Gaps = 15/284 (5%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N+ L+ + + ++ ++++  K VSGL  +G    +E+I  N   SS + + + QSF L AK
Sbjct  58   NNDLVRLNQDHKVYKVVTDKFVSGLGALGSSLQVEAIHMN-VRSSFVSQTRFQSFLLVAK  116

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLN  585
             +E+K   G+ + +  W G SK+++  I+ +GF PS     S+ HGV      +PL CL 
Sbjct  117  TMEKKYN-GHASKKLGWYGTSKEKIIDIISNGFVPS-----SYRHGVQFSARDYPLDCLQ  170

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            +A+ D++G+RH+L C+++LG++ELV PGS Q+ P+S++ D GVD    P+ YIVWS+ ++
Sbjct  171  TAVQDKDGLRHLLLCKLVLGRSELVIPGSGQFQPSSEDLDSGVDSFTSPRTYIVWSSRLS  230

Query  404  THILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQS  225
            TH+ P  I+S  +S  +     GV      +L K  + RI+  +L++ L++ LP   ++ 
Sbjct  231  THVFPEVIVSVRVSPHSK----GVDEYR-PTLSKNVNLRISVDALITRLSRILPSHAIKL  285

Query  224  ITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK---AQRDM  102
            I  Y  D ++GK T  E V+++ ++AG+ LLI I+K   AQR++
Sbjct  286  IKEYYNDRQKGKTTAQEFVRQVSQVAGNSLLISIIKSISAQRNL  329



>gb|AAF79590.1|AC007945_10 F28C11.18 [Arabidopsis thaliana]
Length=329

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/288 (38%), Positives = 164/288 (57%), Gaps = 20/288 (7%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI + EGN EH +++  L+SG+  V     I +I KN     +  +AK  +F +F  AV 
Sbjct  45   LILLGEGNPEHDVIKTCLLSGMGVVSSDTTIVTISKNSSERGITTRAKFLAFRIFTDAVA  104

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPS-----MNKDGSFGHGVYLCPDHFPL--  597
             K G G+ N+++ W   S+ E+  I+ +GF         N  GS G G++L P    L  
Sbjct  105  RKHG-GDANVKYGWYAGSRDEIQRIISYGFSNRDVGKFENDGGSHGIGIHLVPSKCSLLA  163

Query  596  ---GCLNSAMA-DENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKY  429
                C  SA   DE G+R++L CRVILGK E++  GS+Q +P+S EFD GVDDL  P+ Y
Sbjct  164  ESYFCRASATEQDEEGLRYLLLCRVILGKPEIIISGSKQSYPSSAEFDSGVDDLHNPRNY  223

Query  428  IVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKF  249
            ++WS N+N+ ILP YI+SF    L       V R   +S  +P+SP ++F SL+S L+  
Sbjct  224  VIWSCNMNSCILPSYIVSFRSPRLR------VSRGGFAS--RPSSPWVSFASLMSMLSTS  275

Query  248  LPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
            + P  M  I     D R+ K+ R ++V+++R +AGD LL +I+K  ++
Sbjct  276  MDPSRMNLIIRTYDDFRKRKIRRDQLVRKMREVAGDNLLAEIIKNHKN  323



>ref|XP_006844999.1| hypothetical protein AMTR_s00058p00198960 [Amborella trichopoda]
 gb|ERN06674.1| hypothetical protein AMTR_s00058p00198960 [Amborella trichopoda]
Length=409

 Score =   190 bits (483),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 184/325 (57%), Gaps = 47/325 (14%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI +++G+ EH  ++ +  SGL  +     + SI K   SS    +A+LQ+FSL++ A+ 
Sbjct  51   LIELKKGDEEHCFVQGRFYSGLGFLMSYTGVVSIHKISHSS-FSGQARLQAFSLYSDAIA  109

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDG--SFGHGVYLCPDHFPLGCLNS  582
            +K G G+ N+++AW G+ K  ++ ++ HGF      +G  + G G+YL P+   +  L  
Sbjct  110  KKCG-GDANIRYAWHGSGKDGVSQVILHGFGLCNRPEGKGANGVGIYLSPEGSSIDSLVY  168

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            +  D++G +H+L CRVI+G  ELV  GS Q+HP+S+EFD GVD+ + P +YIVWST++NT
Sbjct  169  SNVDDDGQQHMLLCRVIMGNMELVPTGSEQFHPSSEEFDSGVDNPITPSRYIVWSTHMNT  228

Query  401  HILPLYIISFTIS-------------------TLNAHN--LFG-----------------  336
            HILP Y++SF +S                   +L A N  +FG                 
Sbjct  229  HILPEYVVSFKVSHPHLTKLLSLRNWKADSMESLIASNPHVFGNSPGKWMQLQQKKPAKV  288

Query  335  --VQRNSV---SSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEM  171
              V  + V   S+ +KP+S  + FP L+S LA  LPP  +  I  Y   + E ++TR  M
Sbjct  289  PFVVAHHVKGESAARKPSSAWMPFPRLISVLAGILPPSSISLIEKYHTSYLEKRITRECM  348

Query  170  VKRLRRLAGDELLIKIVKAQRDMQI  96
            +K++R++AGD++L+  +K+ R  Q+
Sbjct  349  IKKVRQIAGDKVLVAAIKSYRSKQL  373



>ref|XP_002308571.1| hypothetical protein POPTR_0006s24720g [Populus trichocarpa]
 gb|EEE92094.1| hypothetical protein POPTR_0006s24720g [Populus trichocarpa]
Length=347

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 171/289 (59%), Gaps = 24/289 (8%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I + E + +++ ++R+ ++G+        + ++ K    S++  +A+  +F ++  AV 
Sbjct  52   MIKIGEESSQYESVKRRFLAGMKQYARDTDVVALHKIS-GSTLAVQARFAAFRVYEGAVL  110

Query  755  EKS---------GFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHF  603
            +KS         G G  N+ + W G SK+E+T I+ HGF  S     S G GVYL P +F
Sbjct  111  KKSEGKWQGEGEGEGVANIMYGWYGGSKEEITQIISHGF--SRCNGQSHGVGVYLSPTNF  168

Query  602  PLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIV  423
             L  L S+ ADENG RH+L C V++GK E++  GS+Q +P+S+EFD GVD+L  P++ +V
Sbjct  169  LLDGLASSSADENGTRHMLLCNVLMGKMEVIPAGSKQMYPSSEEFDTGVDNLEAPRRLVV  228

Query  422  WSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKK--PNSPRITFPSLVSELAKF  249
            WS  +N+HI P++I+SF + +   H L    RN +S LKK  P S    FP LV    KF
Sbjct  229  WSAFMNSHIFPIHIVSFKVPSF--HVLL---RNQISELKKHGPISVAALFPVLV----KF  279

Query  248  LPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDE-LLIKIVKAQRD  105
            L P     +     D R+ K+TRL++VK LRR+ GD+ LLI I+++ RD
Sbjct  280  LGPTKKALMEKIFDDLRKCKITRLQLVKSLRRVVGDDQLLIAIIESYRD  328



>ref|XP_006416073.1| hypothetical protein EUTSA_v10008227mg [Eutrema salsugineum]
 gb|ESQ34426.1| hypothetical protein EUTSA_v10008227mg [Eutrema salsugineum]
Length=319

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 107/282 (38%), Positives = 170/282 (60%), Gaps = 14/282 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I + EGN EH ++   L+SGL  +     I ++ KN  S  +  +AK  +F +F +A+ 
Sbjct  41   MIPLGEGNPEHDVIRTCLLSGLGPISTDTTIVAVRKNS-SERITTRAKYLAFRIFTEAMA  99

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDP-----SMNKDGSFGHGVYLCPDHFPLGC  591
             K+G G+ N+++ W   SK+E+  I+ +GF       S N DGS G G++L P    L  
Sbjct  100  RKNG-GDPNVKYGWYAGSKEEIQGIISYGFSSREVRKSENGDGSHGIGIHLVPSKCSLFA  158

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
              +   DE G+RH+L CR+ILGK E++  GS+Q  P+S EFD GVD+L  P++Y++WS+ 
Sbjct  159  AGATEPDEEGLRHLLLCRLILGKPEVIISGSKQSSPSSVEFDSGVDNLQNPREYVIWSST  218

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +N++ILP YI+SF    L       + R   S+  +P+SP ++F +L+S L+K + P  M
Sbjct  219  MNSYILPSYIVSFRSPRLRV-----ISRGGFSA--RPSSPWVSFAALMSMLSKSMDPSRM  271

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
              I     D R+ K+ R ++V+++R +AGD LL +I+K QRD
Sbjct  272  NLIMRSYDDFRKRKIRRDQLVRKMREVAGDNLLAEIIKNQRD  313



>emb|CDY51640.1| BnaC05g50870D [Brassica napus]
Length=304

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/273 (36%), Positives = 158/273 (58%), Gaps = 12/273 (4%)
 Frame = -2

Query  920  EGNREHQIMERKLVSGL-MGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSG  744
            +GN+EH +++   +SGL         + S+ KN  +  +  +A+  +F +F +A+  K+G
Sbjct  41   QGNQEHDVIKACFLSGLGAAFAGDTTVASVRKNS-TEGMATRARYVAFRIFTEAMARKNG  99

Query  743  FGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAMADEN  564
             G+ N+++ W   S++E+  I+ +GF      DGS G G++L      L     A  D  
Sbjct  100  -GDPNVKYGWYAGSREEIEGIVSYGFSSREIDDGSHGIGIHLVASKCSLFAAVGAEPDGE  158

Query  563  GVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLY  384
            GVRH++ CRV+LGK E +  GS+Q HP+S EFD GVDDL  P KY+VWS+N+N++ILP Y
Sbjct  159  GVRHLILCRVLLGKPEQIASGSKQSHPSSSEFDSGVDDLQNPSKYVVWSSNMNSYILPSY  218

Query  383  IISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKD  204
            I+SF    L      G           P+SP ++F +L+S L+K +    M  I     D
Sbjct  219  ILSFRSPRLRVIGRGG---------PPPSSPWVSFTALISMLSKSVDASRMSLIMRTYDD  269

Query  203  HREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
             R+ K+ R ++V+ +R++AGD+LL +I++  RD
Sbjct  270  FRKRKIQRDQLVRMMRQVAGDDLLAQIIRNHRD  302



>gb|KDO82409.1| hypothetical protein CISIN_1g022829mg [Citrus sinensis]
Length=291

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 103/279 (37%), Positives = 160/279 (57%), Gaps = 21/279 (8%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            ++ +EEG+  H ++++  +SG+  +     I ++ KN   SS++ +A+L SF +FA AV 
Sbjct  1    MVKIEEGDMNHYLVKKCFLSGMGPLAADTRILALHKNS-CSSLIARARLDSFKIFANAVA  59

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS------FGHGVYLCPDHFPLG  594
            +K G GN N++ AW GAS+ E+  I+ HGF      DG+       G GV L P +  + 
Sbjct  60   KKCG-GNANIRPAWFGASRDEINEIVCHGFS-QCGGDGARKLGPMHGFGVQLLPINSSIN  117

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
             + S+ +DE G+RH+L CRVILGK E++  GS+Q+HPTS EFD GVD+L  P +Y VWS 
Sbjct  118  GVLSSESDEKGLRHILLCRVILGKMEVIPRGSKQFHPTSLEFDSGVDNLCKPSRYTVWSC  177

Query  413  NINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQI  234
             +N+HI   YI+SF +   +A            S  K  SP     +L++  ++FL P  
Sbjct  178  YMNSHIFVDYIVSFRVVCFSA------------SAIKTTSPWKGIQTLMAIFSRFLHPSK  225

Query  233  MQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            M  +  Y  D +  K+T  + V  L+++ GD+LL  + K
Sbjct  226  MALLAKYYNDLQNQKITSQQFVMNLKQVTGDKLLFTVTK  264



>ref|XP_006483865.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2-like 
[Citrus sinensis]
Length=334

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/282 (37%), Positives = 162/282 (57%), Gaps = 21/282 (7%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N+ ++ +EEG+  H ++++  +SG+  +     I ++ KN   SS++ +A+L SF +FA 
Sbjct  41   NNGMVKIEEGDMNHYLVKKCFLSGMGPLAADTRIVALHKNS-CSSLIARARLDSFKIFAN  99

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS------FGHGVYLCPDHF  603
            AV +K G GN N++ AW GAS+ E+  I+ HGF      DG+       G GV L P + 
Sbjct  100  AVAKKCG-GNANIRPAWFGASRDEINEIVCHGF-SQCGGDGARKLGPMHGFGVQLFPINS  157

Query  602  PLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIV  423
             +  + S+ +DE G+RH+L CRVILGK E++  GS+Q+HPTS EFD GVD+L  P +Y V
Sbjct  158  SINGVLSSESDEKGLRHILLCRVILGKMEVIPRGSKQFHPTSLEFDSGVDNLCKPSRYTV  217

Query  422  WSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLP  243
            WS  +N+HI   YI+SF +   +A            S  K  SP     +L++  ++FL 
Sbjct  218  WSCYMNSHIFVDYIVSFRVVCFSA------------SAIKTTSPWKGIQTLMAIFSRFLH  265

Query  242  PQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            P  M  +  Y  D +  K+T  + V  L+++ GD+LL  + K
Sbjct  266  PSKMALLAKYYNDLQNQKITSQQFVMNLKQVTGDKLLYTVTK  307



>ref|XP_011019501.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Populus euphratica]
Length=345

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/285 (38%), Positives = 172/285 (60%), Gaps = 18/285 (6%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I + E + +++ ++R+ ++G+        + ++ K    S++  +A+  +F ++  AV 
Sbjct  52   MIKIGEESSQYESVKRRFLAGMKQYARDTDVVALHKIS-GSTLAVQARFAAFRVYEGAVL  110

Query  755  EKS-------GFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPL  597
            +KS       G G  N+ + W G SK+E+T I+ HGF  S     S G GVYL P +F L
Sbjct  111  KKSEGKWQGEGEGVANIMYGWYGGSKEEITQIISHGF--SQCNGQSHGVGVYLSPTNFLL  168

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
              L S+ ADENG RH+L C V++GK E++  GS+Q +P+S++FD GVD+L  P++ +VWS
Sbjct  169  DGLASSSADENGTRHMLLCNVLMGKMEVIPAGSKQTYPSSEKFDTGVDNLEAPRRLVVWS  228

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
              +N+HI P++I+SF + +   H L    RN +S LKK + P I+  +L   LAK L P 
Sbjct  229  AFMNSHIFPIHIVSFKVPSF--HVLL---RNQISELKK-HGP-ISVAALFPVLAKLLGPA  281

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDE-LLIKIVKAQRD  105
                +     D R+ K+TRL++VK LRR+ GD+ LLI I+++ RD
Sbjct  282  KKALMAKIFDDLRKCKITRLQLVKSLRRVVGDDQLLIAIIESYRD  326



>ref|XP_010471034.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Camelina sativa]
Length=315

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 156/284 (55%), Gaps = 18/284 (6%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N   I + E   EH +++   +SG+     +  I S+ KN     +  KAK   F +F +
Sbjct  44   NDSTILLREDTLEHDLIKNCFISGMGSFSNETTIVSVRKNSTERRITTKAKFSVFKVFTE  103

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGF-----DPSMNKDGSFGHGVYLCPDHFP  600
            AV  K+  G+ N+++ W   SK+E+  I+ +GF     D   N  GS G G++L    + 
Sbjct  104  AVTRKNE-GDANVKYGWYSGSKEEIDRIVAYGFSNKEIDKFDNDAGSHGVGIHLVHHRYS  162

Query  599  LGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVW  420
            L        DE GV+HVL CRVILGK E++  GS+Q  P+S +FD GVD+L  P+KY++W
Sbjct  163  LVAALVGEGDEEGVKHVLLCRVILGKPEVIVAGSKQSCPSSYQFDSGVDNLENPRKYVIW  222

Query  419  STNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPP  240
            S+ +N++ILP YI+SF    L    L G  R          SP ++F  L+S L+K L  
Sbjct  223  SSTMNSYILPSYIVSFKSPRLRG--LIGRAR----------SPCVSFSVLMSILSKSLDQ  270

Query  239  QIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
              M  I T   D R+ K+ R ++VK++R + GD LL KI+K QR
Sbjct  271  PRMNLILTTYDDFRKRKLGREQLVKKMREVVGDHLLFKILKNQR  314



>ref|XP_004297628.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2-like 
[Fragaria vesca subsp. vesca]
Length=339

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 101/282 (36%), Positives = 169/282 (60%), Gaps = 14/282 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+  +E +  +  ++++L + +   G+ A + +I +N FS S  + A LQ+  +  KAV 
Sbjct  45   LLKAQENDPRYVNIKKQLAAAMQSAGVNANVVAIHRNTFSGST-RHATLQAHRIIEKAVA  103

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPS-MNKDGSFGHGVYLCPDHFPLGCLNSA  579
            EK G GN N+ + W G S+  +   + HGF  S  ++ G +G GV+L  ++    C  S+
Sbjct  104  EKCG-GNANVGWGWYGGSRDLICRTVLHGFFCSRSDQPGPYGIGVHLFSNNHSFDCARSS  162

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
             ADENG+RH+L CRVILGK E+V  GS+Q+ P+S EFD GVD LV PK++I+WS+++N+H
Sbjct  163  DADENGLRHILVCRVILGKREMVPFGSKQFSPSSMEFDSGVDSLVNPKRFIIWSSDMNSH  222

Query  398  ILPLYIISFTISTLNAHNLFGVQRN-----SVSSLKKP--NSPRITFPSLVSELAKFLPP  240
            ILPL+++SF        NL  + R+     + +++++P   S  +    +++ LA+ LP 
Sbjct  223  ILPLFVVSFRAPA----NLRDIPRSIQPSAAAAAVRQPARRSATLKVTDIMNALAEVLPA  278

Query  239  QIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
              M  +     D R  ++T  ++++R+  LAG ELL  +VK+
Sbjct  279  PSMVLLKKSATDFRAKRITSAQLIRRMGTLAGKELLASVVKS  320



>ref|XP_006302598.1| hypothetical protein CARUB_v10020702mg [Capsella rubella]
 gb|EOA35496.1| hypothetical protein CARUB_v10020702mg [Capsella rubella]
Length=307

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/280 (36%), Positives = 155/280 (55%), Gaps = 18/280 (6%)
 Frame = -2

Query  932  IGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEE  753
            I + E + E+ +++   +SG+     +  I S+ KN     +  KAK  +F +F +A+  
Sbjct  40   ILLSEDSFENDLIKNCFLSGMGSFSGETTIVSVRKNSTERRITTKAKFAAFKVFTEALTR  99

Query  752  KSGFGNGNMQFAWLGASKKELTSILQHGF-----DPSMNKDGSFGHGVYLCPDHFPLGCL  588
            K+  G  N+++ W   SK+E+  I+ +GF     +   N  GS G G++L    + L   
Sbjct  100  KNE-GVANVKYGWYSGSKEEIDRIVTYGFSNREIEKFENDAGSHGVGIHLVHHRYSLAAA  158

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
                 DE G +HVL CRVILGK E +  GS+Q+ P+S  FD GVD+L  P+KY++WS+N+
Sbjct  159  LVGEGDEEGTKHVLLCRVILGKPEQIVAGSKQFQPSSYRFDSGVDNLENPRKYVIWSSNM  218

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            N+HILP YI+SF    L               +++  SP ++F  L+S L+K L    M 
Sbjct  219  NSHILPTYIVSFKSPRLRGL------------IRRARSPCVSFSVLMSILSKSLDATRMN  266

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
             I T   D R+ K+ R ++VK++R + GD LL KI+K QR
Sbjct  267  MILTTYDDFRKRKLRREQLVKKMREVVGDHLLFKILKNQR  306



>emb|CDY54287.1| BnaC07g48280D [Brassica napus]
Length=307

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 164/277 (59%), Gaps = 9/277 (3%)
 Frame = -2

Query  932  IGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEE  753
            I + EG++EH ++ +  + G       A      + +  +++  +AK  +F +F +A+  
Sbjct  32   ILLREGDQEHDVITKCFLFGFGATLANATTIVTIRKKSPNAITTRAKSLAFRIFTEAMAR  91

Query  752  KSGFGNGNMQFAWLGASKKELTSILQHGFDP-SMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
            K+G G+ N+++ W   S+++L  I+ +GF    ++ D S G G++L P  F L    +  
Sbjct  92   KNG-GDPNVKYGWYAGSREDLERIITYGFSSREIDDDSSNGIGIHLVPSKFSLFAAEATE  150

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
             DE GVRH+L CR+ILGK E +  GS+Q +P+S EFD GVDD+  P+KY++WS+ +N++I
Sbjct  151  EDEEGVRHLLLCRLILGKPEEIISGSKQTYPSSIEFDSGVDDVQNPRKYVIWSSTMNSYI  210

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LP YI++F    L   +  G       S  +P+SPR++F +L+S L+K +    M  I  
Sbjct  211  LPTYIVTFKSPRLTVISNGG-------SPARPSSPRVSFDALMSSLSKSMDTLRMNLIIR  263

Query  215  YVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
               D R+ K+ R ++V+++R +AGD LL +I+K  RD
Sbjct  264  TFDDFRKRKIQRDQLVRKMREVAGDNLLAQIIKNHRD  300



>gb|KHN30903.1| Putative inactive poly [ADP-ribose] polymerase SRO5 [Glycine 
soja]
Length=315

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/276 (36%), Positives = 164/276 (59%), Gaps = 19/276 (7%)
 Frame = -2

Query  920  EGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF  741
            EG+  H +++ + + GL  +G +  + S+ +N   S V+ +A+L SF   A+AV    G 
Sbjct  34   EGDVVHDLIKTRFIRGLGMLGPKTEVVSVRRNA-CSDVVSQARLHSFHAHARAVARLRGG  92

Query  740  GN-GNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGHG--VYLCPDHFPLGCLNSAMA  573
            GN  N+++AW   + + ++  I+  GF         F HG  + L PD  PL        
Sbjct  93   GNHANVKYAWYRTNGEDDVNDIVSQGF--------GFAHGPKLVLSPDDAPLQSARGCGV  144

Query  572  DENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHIL  393
             ++GVRH L CRVILG++E+VR  +   +P+ +E+D GVD    P KYI+WS  +NTH+L
Sbjct  145  GKDGVRHALLCRVILGRSEIVRDNTEHCYPSCEEYDSGVDSFSGPTKYIIWSNRMNTHVL  204

Query  392  PLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTY  213
            P Y++SF +S+       G++++    L +P SP + FP+L+S L+K LPP  +  I+ +
Sbjct  205  PAYVVSFRVSSFK-----GMEKSEEEPL-RPTSPWMPFPTLISALSKVLPPCDIALISKF  258

Query  212  VKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
             KD ++ K+ R E+++R+R +AGD+LL+  +K+ RD
Sbjct  259  YKDKKDKKILRHELIQRVREIAGDKLLVAAIKSYRD  294



>ref|XP_003523079.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
isoform X1 [Glycine max]
Length=330

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/276 (36%), Positives = 164/276 (59%), Gaps = 19/276 (7%)
 Frame = -2

Query  920  EGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF  741
            EG+  H +++ + + GL  +G +  + S+ +N   S V+ +A+L SF   A+AV    G 
Sbjct  49   EGDVVHDLIKTRFIRGLGMLGPKTEVVSVRRNA-CSDVVSQARLHSFHAHARAVARLRGG  107

Query  740  GN-GNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGHG--VYLCPDHFPLGCLNSAMA  573
            GN  N+++AW   + + ++  I+  GF         F HG  + L PD  PL        
Sbjct  108  GNHANVKYAWYRTNGEDDVNDIVSQGF--------GFAHGPKLVLSPDDAPLQSARGCGV  159

Query  572  DENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHIL  393
             ++GVRH L CRVILG++E+VR  +   +P+ +E+D GVD    P KYI+WS  +NTH+L
Sbjct  160  GKDGVRHALLCRVILGRSEIVRDNTEHCYPSCEEYDSGVDSFSGPTKYIIWSNRMNTHVL  219

Query  392  PLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTY  213
            P Y++SF +S+       G++++    L +P SP + FP+L+S L+K LPP  +  I+ +
Sbjct  220  PAYVVSFRVSSFK-----GMEKSEEEPL-RPTSPWMPFPTLISALSKVLPPCDIALISKF  273

Query  212  VKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
             KD ++ K+ R E+++R+R +AGD+LL+  +K+ RD
Sbjct  274  YKDKKDKKILRHELIQRVREIAGDKLLVAAIKSYRD  309



>ref|XP_006578626.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like 
isoform X2 [Glycine max]
Length=329

 Score =   181 bits (459),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/276 (36%), Positives = 164/276 (59%), Gaps = 19/276 (7%)
 Frame = -2

Query  920  EGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF  741
            EG+  H +++ + + GL  +G +  + S+ +N   S V+ +A+L SF   A+AV    G 
Sbjct  49   EGDVVHDLIKTRFIRGLGMLGPKTEVVSVRRNA-CSDVVSQARLHSFHAHARAVARLRGG  107

Query  740  GN-GNMQFAWLGAS-KKELTSILQHGFDPSMNKDGSFGHG--VYLCPDHFPLGCLNSAMA  573
            GN  N+++AW   + + ++  I+  GF         F HG  + L PD  PL        
Sbjct  108  GNHANVKYAWYRTNGEDDVNDIVSQGF--------GFAHGPKLVLSPDDAPLQSARGCGV  159

Query  572  DENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHIL  393
             ++GVRH L CRVILG++E+VR  +   +P+ +E+D GVD    P KYI+WS  +NTH+L
Sbjct  160  GKDGVRHALLCRVILGRSEIVRDNTEHCYPSCEEYDSGVDSFSGPTKYIIWSNRMNTHVL  219

Query  392  PLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTY  213
            P Y++SF +S+       G++++    L +P SP + FP+L+S L+K LPP  +  I+ +
Sbjct  220  PAYVVSFRVSSFK-----GMEKSEEEPL-RPTSPWMPFPTLISALSKVLPPCDIALISKF  273

Query  212  VKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
             KD ++ K+ R E+++R+R +AGD+LL+  +K+ RD
Sbjct  274  YKDKKDKKILRHELIQRVREIAGDKLLVAAIKSYRD  309



>emb|CDY57852.1| BnaA07g38830D [Brassica napus]
Length=310

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/285 (36%), Positives = 169/285 (59%), Gaps = 10/285 (4%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKA  762
            S  I + E N E+ +++   +SG+     +  + S+ K   +  +  KAKL + ++FA+A
Sbjct  28   SSTILLREENHEYDVVKNCFLSGMGLHAAETTVVSVRKTS-AQRITAKAKLAASNVFAEA  86

Query  761  VEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSM-----NKDGSFGHGVYLCPDHFPL  597
            ++ K+G G+ N+++ W   SK+E+  I+ +GF  S        D S G GV+        
Sbjct  87   MKRKNG-GDANVRYGWYSGSKEEIERIVSYGFSSSEVEKFEKDDRSHGVGVHFLHHTCSK  145

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
                   ADE G+ H+L CR+ILGK E +  GS+Q +P+S E+DCGVD+L  P+KY++WS
Sbjct  146  AAAILGEADEEGIEHLLLCRLILGKPERIIVGSKQTYPSSSEYDCGVDNLENPRKYVIWS  205

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLP-P  240
             N+N++ILP +++SF   TL    L   +      L +  SP ++FP L+S L+K L  P
Sbjct  206  CNMNSYILPSHVVSFKSPTLRG-ILIHYKTYGGGGLGRARSPCVSFPILMSILSKSLDRP  264

Query  239  QIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
            ++   +TTYV D R+GK+ R ++++++R + GDELL+ I+K  R+
Sbjct  265  RMNVILTTYV-DFRKGKVRREQLIRKMREVVGDELLLDIIKNHRN  308



>ref|XP_010046157.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5 
[Eucalyptus grandis]
Length=408

 Score =   181 bits (460),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/275 (36%), Positives = 161/275 (59%), Gaps = 17/275 (6%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG+++++I++ + +S L  +G+Q  + +I KN FSS V  K + Q+F ++++AV+
Sbjct  74   LMELGEGDKDYRIIKERFISRLAALGVQVTLVAIHKNCFSS-VSAKGRAQAFQVYSQAVQ  132

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKD--GSFGHGVYLCPDHFPLGCLNS  582
             K    N N+++AW   SK+E+  IL +GF  S   +  G +G GVY  P   PL     
Sbjct  133  IKGRDNNANVKYAWYATSKEEVLKILSYGFGFSGKAENHGLYGCGVYFGPYDRPL-----  187

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
                E  +   L      GK+EL+ P   Q+HP+S+++D GVD L  P++YI+WST++NT
Sbjct  188  ----ERWLEASLALPGYTGKSELINPNLEQFHPSSEQYDSGVDHLSSPRRYIIWSTHLNT  243

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
            H+ P YIISF  S  +   L   + +      K   P I FP ++SEL+K LPP  +  I
Sbjct  244  HVSPEYIISFKASCCSKGCLTTPENS-----PKSTCPWIPFPIMISELSKVLPPSHVSLI  298

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            + Y++D  E K+ R E++++ R +AGD LL  I +
Sbjct  299  SKYLEDFNESKIPRHELIQKFREIAGDRLLNGIFE  333



>ref|XP_002888780.1| hypothetical protein ARALYDRAFT_476164 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65039.1| hypothetical protein ARALYDRAFT_476164 [Arabidopsis lyrata subsp. 
lyrata]
Length=304

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/280 (35%), Positives = 157/280 (56%), Gaps = 18/280 (6%)
 Frame = -2

Query  932  IGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEE  753
            I + E   EH +++   ++G+     +  I ++ KN     +  KAK   F +F +A+ +
Sbjct  37   ILLRESTFEHDLVKNCFLTGMGSFANETTIVTVRKNSTERRITTKAKFAVFKIFTEAMTK  96

Query  752  KSGFGNGNMQFAWLGASKKELTSILQHGF-----DPSMNKDGSFGHGVYLCPDHFPLGCL  588
            K+  G+ N+++ W   SK+E+  ++ +GF     +   N  GS G G++L    + L   
Sbjct  97   KNN-GDANVKYGWYSGSKEEIDRVITYGFSNREIEKFENDVGSHGVGIHLVHHRYSLAAA  155

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
                 DE G++++L CRVILGK E +  GS+Q +P+S  FD GVD+L  P+KY++WS+N+
Sbjct  156  LVGEGDEEGIKNILLCRVILGKPEQIEAGSKQSYPSSNRFDSGVDNLENPRKYVIWSSNM  215

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            N++ILP YI+SF    L    L G  R          SP ++F +L+S L+K L    M 
Sbjct  216  NSYILPTYIVSFKSPLLRG--LIGRAR----------SPCVSFSALMSILSKSLDVTRMN  263

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
             I T   D R+ K+ R ++V+++R + GD LL KI+K QR
Sbjct  264  LILTSYDDFRKRKLRREQLVRKIREVVGDHLLFKILKNQR  303



>ref|XP_009105706.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Brassica rapa]
Length=306

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 169/285 (59%), Gaps = 14/285 (5%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKA  762
            S  I + E N E+ +++   +SG+     +  + S+ K   +  +  KAKL + ++FA+A
Sbjct  28   SSTILLREENHEYDVVKNCFLSGMSLHAAETTVVSVRKTS-AQRITAKAKLAASNVFAEA  86

Query  761  VEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSM-----NKDGSFGHGVYLCPDHFPL  597
            ++ K+G G+ N+++ W   SK+E+  I+ +GF  S        D S G GV+        
Sbjct  87   MKRKNG-GDANVRYGWYSGSKEEIERIVSYGFSSSEVEKFEKDDRSHGVGVHFLHHTCSK  145

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
                   ADE G+ H+L CR+ILGK E +  GS+Q +P+S E+DCGVDDL  P+KY++WS
Sbjct  146  AAAVLGEADEEGIEHLLLCRLILGKPERIIAGSKQTYPSSSEYDCGVDDLENPRKYVIWS  205

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLP-P  240
             N+N++ILP +++SF   TL       + R     L +  SP ++FP L+S L+K L  P
Sbjct  206  CNMNSYILPSHVVSFKSPTLRG-----LIRGGGGGLGRARSPCVSFPILMSILSKSLDRP  260

Query  239  QIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
            ++   +TTYV D R+GK+ R ++++++R + GDELL+ I+K  R+
Sbjct  261  RMNVILTTYV-DFRKGKVRREQLIRKMREVVGDELLLDIIKNHRN  304



>ref|XP_003629911.1| hypothetical protein MTR_8g088250 [Medicago truncatula]
 gb|AET04387.1| inactive poly [ADP-ribose] polymerase SRO2, putative [Medicago 
truncatula]
Length=290

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/273 (36%), Positives = 157/273 (58%), Gaps = 13/273 (5%)
 Frame = -2

Query  926  VEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKS  747
            VEE + E+Q +++  + G+  +     I +I KN  S+++ K+A L SF +F+KAV  K 
Sbjct  16   VEEESGEYQFIKKGFLKGMGFMVDVTNIMAIHKNNVSTNLTKQASLDSFHIFSKAVSIKC  75

Query  746  GFGNGNMQFAWLGASKKELTSILQHGFDPSM----NKDGSFGHGVYLCPDHFPLGCLNSA  579
            G GN N++ AW G S  EL  I+  GF        + D S G G+ L   +F +    S 
Sbjct  76   G-GNANVRCAWYGGSLDELVDIVSFGFTGCNIHVDDDDESHGVGISLSSANFSIDSAMST  134

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
            +ADENG+RHVL C+VILG+ E V   S+Q  P+ +++D GVDD+  P+K+I+W+  +N+H
Sbjct  135  VADENGLRHVLLCKVILGRVENVPVDSKQSQPSCRQYDTGVDDISSPRKHIIWTAFMNSH  194

Query  398  ILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
            I P YI+SF  + +    +FG          KP S  +  P+LV++++  L P  M  + 
Sbjct  195  IHPEYIVSFNYNYVKDQGVFGTL--------KPQSEYVLLPNLVAKVSNHLKPSQMSLLL  246

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDELLIKIV  120
               + ++E K+TR   V ++R++ GD LL  ++
Sbjct  247  KSCRIYQEQKITRETWVNQVRKIVGDMLLHSVI  279



>gb|KCW83380.1| hypothetical protein EUGRSUZ_B00314 [Eucalyptus grandis]
Length=290

 Score =   177 bits (448),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 130/190 (68%), Gaps = 3/190 (2%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ +EEG++ H+ ++ + VS L  +  Q  + +I ++  SSSV   ++ Q+F +++ AV+
Sbjct  76   LMELEEGDKAHRFIKERFVSRLGALRAQVTVAAIHRS-CSSSVAVTSRAQAFQVYSAAVQ  134

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS--FGHGVYLCPDHFPLGCLNS  582
            +K G    N+++AW  ASK+E+  I  +GF  S   + S  +G GVY  PD+ PL  + S
Sbjct  135  KKGGGDTANVRYAWYPASKEEVAKIFSYGFGYSGKPENSGLYGRGVYFAPDNHPLQSVES  194

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A  DE+G+RH+L C+VILGK+EL+  GS Q HP S+++D GVDDL  PK+YI+W+T+INT
Sbjct  195  APVDEDGLRHLLLCQVILGKSELIGFGSEQSHPNSEQYDSGVDDLSSPKRYIIWNTHINT  254

Query  401  HILPLYIISF  372
            H+LP Y++SF
Sbjct  255  HVLPEYVVSF  264



>ref|XP_007159536.1| hypothetical protein PHAVU_002G245700g [Phaseolus vulgaris]
 gb|ESW31530.1| hypothetical protein PHAVU_002G245700g [Phaseolus vulgaris]
Length=273

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 162/268 (60%), Gaps = 12/268 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ VE+ + E+Q +E   + G+  +G    I ++ KN+ S S+ +KA+  SF +F+KA+E
Sbjct  12   LMKVEKESEEYQSIENGFLKGMGFMGHATTIMALHKNDISFSLARKARWDSFKIFSKAME  71

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
             K G G+ N+++AW GAS  +L  I+  GF+   N D S G G+ L   HF +      +
Sbjct  72   IKCG-GDANVRYAWYGASLDDLLEIVSAGFNGCKNHDESHGVGIPLFSVHFSIDSAMCTV  130

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
             DE+G+RHVL CRVILGK E V  GS+Q  P+SQ++D GVDD++ P K+I+W+  +N++I
Sbjct  131  GDEHGLRHVLLCRVILGKVESVACGSKQSQPSSQQYDSGVDDILAPTKHIIWTAFMNSYI  190

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
             P YI+SF             + + +    KP SP + FP+LV+ ++  L P+ M ++  
Sbjct  191  HPSYILSFK-----------YKYSVICGTLKPQSPYVLFPNLVAGVSNNLKPEQMTTLLR  239

Query  215  YVKDHREGKMTRLEMVKRLRRLAGDELL  132
              + ++E K++R   +K++R + GD LL
Sbjct  240  SYRVYQERKISREVWIKKVRLIVGDTLL  267



>ref|NP_177201.1| probable inactive poly [ADP-ribose] polymerase SRO3 [Arabidopsis 
thaliana]
 sp|O64592.2|SRO3_ARATH RecName: Full=Probable inactive poly [ADP-ribose] polymerase 
SRO3; AltName: Full=Protein SIMILAR TO RCD ONE 3 [Arabidopsis 
thaliana]
 gb|AEE35062.1| probable inactive poly [ADP-ribose] polymerase SRO3 [Arabidopsis 
thaliana]
Length=305

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/280 (35%), Positives = 156/280 (56%), Gaps = 18/280 (6%)
 Frame = -2

Query  932  IGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEE  753
            I + E   EH +++   +SG+     +  I ++ K      +  KAK   F LF +A++ 
Sbjct  38   ILLREATFEHNLIKNCFLSGMGSFATETTIVTVRKILTQRLITTKAKFAVFKLFTEAMKR  97

Query  752  KSGFGNGNMQFAWLGASKKELTSILQHGFD-----PSMNKDGSFGHGVYLCPDHFPLGCL  588
            K+  G  N+++ W   SK+E+  ++ +GF         N  GS G G++L    + L   
Sbjct  98   KNN-GYANIRYGWYSGSKEEIDRVITYGFSNREIKKVENDVGSHGVGIHLVHHRYSLAAA  156

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
                 DE G++++L CRVILGK E +  GS+Q +P+S +FD GVD+L  P+KY++WS N+
Sbjct  157  LVGEGDEEGIKNILLCRVILGKPEQIVTGSKQSYPSSNQFDSGVDNLENPRKYVIWSCNM  216

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            N++ILP YI+SF      +H L G+       + +  SP ++F  L+S L+K L    M 
Sbjct  217  NSYILPTYIVSF-----KSHLLRGL-------IGRARSPCVSFSVLMSILSKSLDAARMN  264

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
             I T   D R+ K+ R ++V+++R + GD LL KI+K QR
Sbjct  265  LILTSYDDFRKRKLRREQLVRKIREVVGDNLLFKILKNQR  304



>ref|XP_010427817.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Camelina sativa]
 ref|XP_010427819.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Camelina sativa]
Length=317

 Score =   175 bits (443),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 102/284 (36%), Positives = 154/284 (54%), Gaps = 18/284 (6%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N   I + E   EH +++   +SG+     +  I S+ KN     +  KAK   F +F +
Sbjct  46   NDSTILLREDTLEHDLIKNCFISGMGSFSNETTIVSVRKNSTEKRITTKAKFAVFKVFTQ  105

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFD----PSMNKD-GSFGHGVYLCPDHFP  600
            A+  K+  G+ N+++ W   SK+E+  I+ +GF         KD GS G G++L    + 
Sbjct  106  AMTRKNE-GDANVKYGWYSGSKEEIDRIVTYGFSNKEIEKFEKDAGSHGVGIHLVHHRYS  164

Query  599  LGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVW  420
            L        DE GV+HVL CR ILGK E++  GS+Q  P+S +FD GVD+L  P+KY++W
Sbjct  165  LVAALVGEGDEEGVKHVLLCRAILGKPEVIVAGSKQSCPSSYQFDSGVDNLENPRKYVIW  224

Query  419  STNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPP  240
            S+ +N++I+P YI+SF    L    L G  R          SP ++F  L+S L+K L  
Sbjct  225  SSTMNSYIVPTYIVSFKSPRLRG--LIGRGR----------SPCVSFSVLMSILSKSLDQ  272

Query  239  QIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
              M  I     D R+ K+ R ++VK++R + GD LL KI+K QR
Sbjct  273  PRMNLILATYDDFRKRKLRREQLVKKMREVVGDHLLFKILKNQR  316



>ref|XP_011009692.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Populus euphratica]
Length=332

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 163/277 (59%), Gaps = 11/277 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            ++ + E ++EH++++ + ++G+  +    ++ +I KN   S++  KA+ ++F     AV 
Sbjct  48   MMRIGEESKEHRVIKNQFLTGMNQLAEDTSVVTIHKN-ICSTMYMKARFKAFKSCVDAVR  106

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
            E+ G  + N++  W GASK+E+  I+  GF  S     S G GVYL    F L    S  
Sbjct  107  ERRG--DRNVKHGWYGASKQEILHIISFGF--SRCNGQSHGVGVYLSTSKFILETFPSTT  162

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
             DENG+RH+++C V +GK EL+R GS+Q +P+S+EFD GVD+L  P + +VWS  +N+ I
Sbjct  163  EDENGLRHMMFCYVEMGKMELIRAGSKQIYPSSEEFDSGVDNLEEPSRLVVWSAYMNSFI  222

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LPLYI+SF   + +  +L G Q N V    +    +++   L+  L K   P     I+ 
Sbjct  223  LPLYIVSFKAPSFSIGSLRG-QINEV----RTGGEKLSIAVLLPMLVKVFGPAKGDMISK  277

Query  215  YVKDHREGKMTRLEMVKRLRRLAG-DELLIKIVKAQR  108
             + DHR+ K+ R +M++ L+R+ G D +LI ++KA R
Sbjct  278  SLDDHRKCKINRDQMIQSLKRIIGNDRMLISVIKASR  314



>ref|XP_008790405.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
isoform X1 [Phoenix dactylifera]
Length=482

 Score =   178 bits (452),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 160/284 (56%), Gaps = 14/284 (5%)
 Frame = -2

Query  938  RLIGVE---EGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFA  768
            R  G E   +G+R  +++E+  + G+      A I SI K   S      ++L++F +  
Sbjct  206  RWPGAELLGDGDRYRKLVEKLFLDGMRKFAPDAVITSIHKCSHSGP-WGNSRLKAFQMRI  264

Query  767  KAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNK---DGSFGHGVYLCPDHFPL  597
            +    K+  G+GN++F W   S ++  +++ HGF    N+    G++G G++L P H P 
Sbjct  265  QMT--KANRGDGNVKFGWYATSARDTAAVISHGFGQPNNQVFGSGAYGVGIHLSPPHSPY  322

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
                 +  D+NG RH++ CR I+GK+E V  GS Q+HP+ +EFD GVDDL  PK YIVWS
Sbjct  323  TSSLLSEEDDNGERHIMLCRAIMGKSEKVEAGSLQFHPSGEEFDSGVDDLANPKWYIVWS  382

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            T +N+HILP Y++SF  S + + +     +  +S  KKP    ++FP L +E+A  LP  
Sbjct  383  TYMNSHILPEYVVSFK-SLMRSQD----PQRMMSPSKKPCLTSLSFPKLFAEMAGSLPSS  437

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
              Q +  +   ++ GKM++   +K LR + GD++L   ++  R+
Sbjct  438  RKQEMEIFYNHYKAGKMSKDTFIKHLRSIVGDKILASTIRRIRE  481



>ref|XP_011019509.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Populus euphratica]
Length=330

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 171/296 (58%), Gaps = 18/296 (6%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + E  RE+  +++  ++G+ G      + +I KN  S+S MK A+  +F  F + V 
Sbjct  40   LLKIGEETREYDGVKKTFLTGMKGHAKDTQVVAIYKNSASTSPMK-ARFAAFKAFEQVVS  98

Query  755  EKSGF-GNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSA  579
            +K+G  GN N+++ W   SK+E++ I+ HGF     +  S G GVYL P  F L  L S+
Sbjct  99   QKNGGQGNANVKYGWYSGSKEEISQIISHGFGCCNGQ--SHGVGVYLSPTSFLLDGLESS  156

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
             ADEN +RH+L C+VI+GK E++  GS+Q +P+S EFD GVD+L  P++ +VW+  +N+H
Sbjct  157  RADENDMRHILLCKVIMGKMEVIPAGSKQRYPSSGEFDSGVDNLEAPRRLVVWTAFMNSH  216

Query  398  ILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
            ILP YII F      A +   +  N +S ++  N   ++  +L   + KFL P     I+
Sbjct  217  ILPDYIIRF-----KAPSSTTLLMNRISEIR--NLGFVSVSALHLTMVKFLGPAKGALIS  269

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDE-LLIKIVKAQRDMQIYTSMGNKTGVRRNC  54
                D  + K+T +++ + +R++AGD+ LLI+I K+  + ++      +   RR C
Sbjct  270  RTYDDFVKRKVTGVQLFQAVRQIAGDDQLLIEIFKSSTNKRV------RRASRRTC  319



>gb|KHN34314.1| Putative inactive poly [ADP-ribose] polymerase SRO5 [Glycine 
soja]
Length=412

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 137/206 (67%), Gaps = 12/206 (6%)
 Frame = -2

Query  713  LGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRV  534
            L A K+E+  I+QHGF        +  +G+ L P   PL  + S++ D++G+RH+L CRV
Sbjct  184  LQARKEEINDIIQHGFG------HAHSNGLRLSPQDSPLESVKSSVVDKDGLRHLLLCRV  237

Query  533  ILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLN  354
            ILGKTE+V  GS Q   +SQEFD GVDDL  PK+Y++W   INTH+LP Y++SF + +  
Sbjct  238  ILGKTEVVPRGSYQCRSSSQEFDSGVDDLSNPKEYVIWCNQINTHVLPEYVLSFRLPS--  295

Query  353  AHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLE  174
               L G+ +  +    +P+SP + FP+L+S L+K LPP  + SI  + KD+RE +++R E
Sbjct  296  --PLKGIVK--IGEPLRPSSPWMAFPALISMLSKILPPSEVASIAKFHKDYREKRISRHE  351

Query  173  MVKRLRRLAGDELLIKIVKAQRDMQI  96
            +++++R +AGD+LL+ ++K+ R  +I
Sbjct  352  LIQKVRVIAGDKLLLSVIKSFRAKKI  377



>ref|XP_002308573.1| hypothetical protein POPTR_0006s24750g [Populus trichocarpa]
 gb|EEE92096.1| hypothetical protein POPTR_0006s24750g [Populus trichocarpa]
Length=330

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 102/296 (34%), Positives = 169/296 (57%), Gaps = 18/296 (6%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + E  RE+  +++  ++G+ G      + +I KN  S+S MK A+  +F  F + V 
Sbjct  40   LLKIGEETREYDGVKKTFLTGMKGHAKDTQVVAIYKNSASTSPMK-ARFAAFKAFEQVVS  98

Query  755  EKSGF-GNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSA  579
            +K+G  GN N+++ W   SK+ ++ I+ HGF     +  S G GVYL P  F L  L S+
Sbjct  99   QKNGGQGNANVKYGWYSGSKEGISQIISHGFGWCNGQ--SHGVGVYLSPTSFLLDGLESS  156

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
             ADEN  RH+L C+VI+GK E++  GS+Q +P+S EFD GVD+L  P++ +VW+T +N+H
Sbjct  157  RADENDTRHILLCKVIMGKMEVIPAGSKQRYPSSGEFDSGVDNLEAPRRLVVWTTFMNSH  216

Query  398  ILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
            ILP YIISF   +     +     N +S ++  N   ++  +L   + KFL P     I+
Sbjct  217  ILPDYIISFKAPSSTTLLI-----NRISEIR--NLGFVSVSALHLTMVKFLGPAKGALIS  269

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDE-LLIKIVKAQRDMQIYTSMGNKTGVRRNC  54
                D  + K+T +++ + +R++ GD+ LLI+I K+  + ++      +   RR C
Sbjct  270  RTYDDFAKRKVTGVQLFQAVRQITGDDQLLIEIFKSSTNKRV------RRASRRTC  319



>emb|CDY25790.1| BnaA07g09920D [Brassica napus]
Length=311

 Score =   172 bits (437),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 162/280 (58%), Gaps = 12/280 (4%)
 Frame = -2

Query  932  IGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEE  753
            I + EG++EH ++    +SGL      A      + +  +++  +AK  +F +F +A+  
Sbjct  29   ILLREGDQEHDVITTCFLSGLGATLANATTIVTIRKKSPNAITTRAKSLAFRIFTEAMAR  88

Query  752  KSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS----FGHGVYLCPDHFPLGCLN  585
            K+  G+ N+++ W  AS+++L  I+ +GF      D S     G G++L P  F L    
Sbjct  89   KNN-GDPNVKYGWYAASREDLERIVTYGFSSREIDDDSSSNGIGIGIHLVPSKFSLFAAE  147

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
            +   DE G+RH+L CR+ILGK E +  GS+Q +P+S EFD GVDD+  P+KY+VWS+ +N
Sbjct  148  ATEEDEEGLRHLLLCRLILGKPEEIVSGSKQAYPSSVEFDSGVDDVQNPRKYVVWSSTMN  207

Query  404  THILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQS  225
            ++ILP YI++F    L       V RN   S  + +SPR++F +L+  L+K +    M  
Sbjct  208  SYILPTYIVAFKSPRLT------VIRNG-GSPARLSSPRVSFAALMLSLSKSMDTFRMNL  260

Query  224  ITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
            I     D R+ K+ R ++V+++R +AGD LL +I++  RD
Sbjct  261  IIRTYDDFRKRKIQRDQLVRKMREVAGDNLLAQIIRNHRD  300



>ref|XP_006390889.1| hypothetical protein EUTSA_v10019788mg [Eutrema salsugineum]
 gb|ESQ28175.1| hypothetical protein EUTSA_v10019788mg [Eutrema salsugineum]
Length=314

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/297 (33%), Positives = 162/297 (55%), Gaps = 26/297 (9%)
 Frame = -2

Query  953  EQRNSRLIG---------VEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMK  801
            +  +SRL G         + E N E+ +++   +SG+     +  + ++ KN  +  V  
Sbjct  28   DNADSRLAGNFTGDSTVLLREDNHEYDVIKNCFLSGMGPFAGETTVVAVRKNS-TERVTT  86

Query  800  KAKLQSFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSM-----NKDGSF  636
            KAK  +  +F +A++ K+G GN N+++ W   SK+E+  I+ +GF         N +GS 
Sbjct  87   KAKFAASVVFTEAMKRKNG-GNANVRYGWYSGSKEEIDDIISYGFSSREIEKFENDNGSH  145

Query  635  GHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGV  456
            G G++L      L        DE G++H+L CR+ILGK E +  GS Q +P+S ++D GV
Sbjct  146  GVGIHLIHHKCSLAAAIVEEDDEEGLKHLLLCRLILGKPEQISSGSNQSYPSSVQYDSGV  205

Query  455  DDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFP  276
            D+L  P+KY++WS N+N++ILP +++SF    L    + G  R          SP ++  
Sbjct  206  DNLENPRKYVIWSCNMNSYILPSHVVSFRSPRLRDGGVLGRAR----------SPCVSLS  255

Query  275  SLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
             L+S L   L P  +  I T   D R+ K+ R ++V+++R + GDELL+ I+K QRD
Sbjct  256  LLMSILPNSLDPPRLNVILTAYDDFRKRKLKREQLVRKMREVVGDELLLDIIKNQRD  312



>ref|XP_009103166.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
isoform X2 [Brassica rapa]
Length=306

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 161/278 (58%), Gaps = 10/278 (4%)
 Frame = -2

Query  932  IGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEE  753
            I + EGN+EH ++    +SGL      A      + +  +++  +AK  +F +F +A+  
Sbjct  30   ILLREGNQEHDVITTCFLSGLGATLANATTIVTIRKKSPNAITTRAKSLAFRIFTEAMAR  89

Query  752  KSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSF--GHGVYLCPDHFPLGCLNSA  579
            K+  G+ N+++ W   S+++L  I+ +GF      D S   G G++L P  F L    + 
Sbjct  90   KNN-GDPNVKYGWYAGSREDLERIVTYGFSSREIDDDSSSNGIGIHLVPSKFSLFAAEAT  148

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
              DE G+RH+L CR+ILGK E +  GS+Q +P+S EFD GVDD+  P+KY+VWS+ +N++
Sbjct  149  EEDEEGLRHLLLCRLILGKPEEIGSGSKQAYPSSVEFDSGVDDVQNPRKYVVWSSTMNSY  208

Query  398  ILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
            ILP YI++F    L       V RN   S  + +SPR++F +L+  L+K +    M  I 
Sbjct  209  ILPTYIVAFKSPRLT------VIRNG-GSPARLSSPRVSFAALMLSLSKSMDTFRMNLII  261

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
                D R+ K+ R ++V+++R +AGD LL +I++  RD
Sbjct  262  RTYDDFRKRKIQRDQLVRKMREVAGDNLLAQIIRNHRD  299



>ref|XP_009103165.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
isoform X1 [Brassica rapa]
Length=310

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 161/278 (58%), Gaps = 10/278 (4%)
 Frame = -2

Query  932  IGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEE  753
            I + EGN+EH ++    +SGL      A      + +  +++  +AK  +F +F +A+  
Sbjct  30   ILLREGNQEHDVITTCFLSGLGATLANATTIVTIRKKSPNAITTRAKSLAFRIFTEAMAR  89

Query  752  KSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSF--GHGVYLCPDHFPLGCLNSA  579
            K+  G+ N+++ W   S+++L  I+ +GF      D S   G G++L P  F L    + 
Sbjct  90   KNN-GDPNVKYGWYAGSREDLERIVTYGFSSREIDDDSSSNGIGIHLVPSKFSLFAAEAT  148

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
              DE G+RH+L CR+ILGK E +  GS+Q +P+S EFD GVDD+  P+KY+VWS+ +N++
Sbjct  149  EEDEEGLRHLLLCRLILGKPEEIGSGSKQAYPSSVEFDSGVDDVQNPRKYVVWSSTMNSY  208

Query  398  ILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
            ILP YI++F    L       V RN   S  + +SPR++F +L+  L+K +    M  I 
Sbjct  209  ILPTYIVAFKSPRLT------VIRNG-GSPARLSSPRVSFAALMLSLSKSMDTFRMNLII  261

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
                D R+ K+ R ++V+++R +AGD LL +I++  RD
Sbjct  262  RTYDDFRKRKIQRDQLVRKMREVAGDNLLAQIIRNHRD  299



>ref|XP_004504414.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2-like 
[Cicer arietinum]
Length=286

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 151/269 (56%), Gaps = 13/269 (5%)
 Frame = -2

Query  896  MERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFGNGNMQFA  717
            +++  V G+  +G    + +I KN  SSS++++A+L SF +F+KAV  K G G+ N++ A
Sbjct  26   VKKGFVKGMGFMGHVTNVMAIHKNNVSSSLVRQARLDSFHIFSKAVSIKCG-GDANVKCA  84

Query  716  WLGASKKELTSILQHGFDPS---MNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVL  546
            W G S  EL  I+  GF      +  D S G G+ L   +F +      + DENG+RHV+
Sbjct  85   WYGGSLDELIEIVSIGFTGCHIHVEDDESHGVGISLFSANFSIDSAMCTVVDENGLRHVM  144

Query  545  YCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTI  366
             C+VILG  E V   S+Q  P+ +++D GVDD+  P KYI+W+  +N+HI P YIISF  
Sbjct  145  LCKVILGNVENVPADSKQSQPSCKKYDTGVDDISAPTKYIIWTAFMNSHIHPDYIISFNY  204

Query  365  STLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKM  186
            +       + +         KP S  + FP+LV+ ++  L P  M S+     +++E K+
Sbjct  205  NNYIKDTFWTI---------KPGSQYVMFPNLVARVSNHLSPSKMCSLLKSYWNYKEEKI  255

Query  185  TRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
             R   +KR+R++ GD+ L+  V    D+Q
Sbjct  256  RREIWIKRVRKIVGDDGLLHSVITHGDLQ  284



>ref|XP_010498867.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
isoform X2 [Camelina sativa]
Length=295

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 156/286 (55%), Gaps = 52/286 (18%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            LI ++EGN EH +++  L+SG+  V     I +I KN  S  +  +A+  SF +F  AV 
Sbjct  47   LILLDEGNSEHDVIKACLLSGMGFVSSDTTIVTIRKNT-SDGITNRARFLSFRIFTDAVA  105

Query  755  EKSGFGNGNMQFAWL-GASKKELTSILQHGFDPSMNKD-GSF-------GHGVYLCPDHF  603
             K G G+ N+++ W  G+SK+E+ SI+ +GF    N+D G F       G G++  P   
Sbjct  106  RKRG-GDANVKYGWCAGSSKEEIESIVSYGFS---NRDVGKFEDDPCSHGVGIHFVPSKC  161

Query  602  PLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIV  423
             L   ++A  DE G+RH+L CR+ILGK EL   GS+Q +P+S EFD GVDDL  P+ Y+V
Sbjct  162  SLLAASAAEPDEEGLRHLLLCRLILGKPELTTSGSKQLYPSSPEFDSGVDDLRNPRNYVV  221

Query  422  WSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLP  243
            WS N+N+HILP YI+SF    L       V R   ++  +P+SP                
Sbjct  222  WSCNMNSHILPSYIVSFRSPRLT------VSRGGFAA--RPSSP----------------  257

Query  242  PQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
                           + K+ R ++VK++R +AGD LL +I+K  RD
Sbjct  258  --------------WKRKIRRDQLVKKMREVAGDNLLAEIIKNHRD  289



>emb|CDY11593.1| BnaC06g31460D [Brassica napus]
Length=305

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/285 (35%), Positives = 166/285 (58%), Gaps = 15/285 (5%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKA  762
            S  I + E N E+ +++   +SG+     +  + S+ K   +  +  KAKL + ++FA+A
Sbjct  28   SSTILLREENHEYDVVKNCFLSGMGHHAAETTVVSVRKTS-AQRITAKAKLAASNVFAEA  86

Query  761  VEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSM-----NKDGSFGHGVYLCPDHFPL  597
            ++ K+G G+ N+++ W   SK+E+  I+ +GF  S        D S G GV+       L
Sbjct  87   MKRKNG-GDANVRYGWYSGSKEEIERIVSYGFSSSEVEKDEKDDRSHGVGVHFLHHTCSL  145

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
                   ADE G++ +L CR+ILGK E +  GS+Q +P+S  +DCGVD+L  P+KY++WS
Sbjct  146  AAAVLGEADEEGIQRLLLCRLILGKPERIISGSKQSYPSSSGYDCGVDNLENPRKYVIWS  205

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLP-P  240
             N+N++I P +++SF   TL               L +  SP ++FP L+S L+K L  P
Sbjct  206  CNMNSYIFPSHVVSFKSPTLRG------LIRGGGGLGRARSPCVSFPILMSILSKSLDRP  259

Query  239  QIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
            ++   +TTYV D R+GK+ R ++++++R + GDELL+ I+K  R+
Sbjct  260  RMNVILTTYV-DFRKGKVRREQLIRKMREVVGDELLLDIIKNHRN  303



>ref|XP_006585197.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2-like 
isoform X2 [Glycine max]
Length=284

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 148/263 (56%), Gaps = 13/263 (5%)
 Frame = -2

Query  884  LVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFGNGNMQFAWLGA  705
             + G+  VG      +I KN  S SV ++A+  SF +F+KAV  KSG G+ N+ +AW G+
Sbjct  30   FLKGMGFVGHATDAMAIYKNMLSFSVARQARWVSFKIFSKAVAIKSG-GDANIGYAWYGS  88

Query  704  SKKELTSILQHGFD-----PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYC  540
            S  +L  I+  GF         + D   G G+ L   +F L      +ADE+G RHVL C
Sbjct  89   SLDDLLEIVSGGFHGCKKHDDNDDDECHGIGIPLFAANFSLDSAMCTVADEHGFRHVLLC  148

Query  539  RVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST  360
            +VILGK E V  GS+Q  P+S+++D GVDD+  P+++ +W+  +NTHI P YII F  + 
Sbjct  149  KVILGKVEAVHAGSKQSQPSSKQYDTGVDDISAPRRHTIWTAYLNTHIHPNYIICFKYNN  208

Query  359  LNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTR  180
                    ++   +    KP SP ++FP+L++ ++  L P  M  +    + ++E K++R
Sbjct  209  Y-------IKDPEMHGALKPQSPYVSFPNLLARVSNHLKPAQMSMLLKDYRIYKEQKISR  261

Query  179  LEMVKRLRRLAGDELLIKIVKAQ  111
             + V ++R + GDELL  ++  Q
Sbjct  262  EQWVNKVRLIVGDELLRLVITTQ  284



>ref|XP_010551574.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Tarenaya hassleriana]
Length=318

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/291 (35%), Positives = 159/291 (55%), Gaps = 15/291 (5%)
 Frame = -2

Query  965  TDLHEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQ  786
            +  H      L+ + +GN E+ I+    ++GL  +    AI S+ KN  + S   KAK  
Sbjct  31   SGFHPLSADGLVPISQGNPEYNIITACFLAGLGPLADGTAIVSVLKNS-TGSCSTKAKFI  89

Query  785  SFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGF-----DPSMNKDGSFGHGVY  621
            +F  F +AV  K+G G  N+++ W   SK+E+  I+  GF     +   N+  S G GV+
Sbjct  90   AFRAFMEAVARKNG-GVANVKYGWFPGSKEEIKRIISLGFSGREVEKFANEATSHGVGVH  148

Query  620  LCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVF  441
            L P + PL     A  DE G+RH+L CRVI G  E +  GSRQ +P+S EF  GVDDL+ 
Sbjct  149  LVPSNIPLAAALGAEPDEEGLRHLLLCRVIQGNPEKIVSGSRQMYPSSSEFHSGVDDLLS  208

Query  440  PKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSE  261
            P+ YI+WS ++N ++LP Y ++F    L       + R  +    +P S  ++F +L+S 
Sbjct  209  PRHYIIWSCSMNAYLLPSYAVTFRSPHL-------IPRG-IGLCPRPGSTWVSFAALLSI  260

Query  260  LAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            L++ L P  M  I     + R  ++ R ++V+++R +AGD+LL  I+K  R
Sbjct  261  LSESLDPPRMNMILKTYSEFRRREVRRDKLVRKMREVAGDDLLKHIIKRYR  311



>ref|XP_010936236.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Elaeis guineensis]
Length=483

 Score =   173 bits (439),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 158/281 (56%), Gaps = 15/281 (5%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            ++ V +G+R  +++E+  + G+        I SI K   SS     ++L++F  + +   
Sbjct  211  VVVVGDGDRYCKLVEKLFLDGMRRFAPDTVITSIHKCSHSSR-SGNSRLKAFQTWIQMT-  268

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGF---DPSMNKDGSFGHGVYLCPDHFPLGCLN  585
             K+  G+G ++F W   S +++ +++ HGF   +  +   G++G G++L P H P     
Sbjct  269  -KANRGDGGVKFGWYATSARDVAAVVSHGFGRPNGQLFGSGAYGVGIHLSPPHSPYASSL  327

Query  584  SAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNIN  405
             A  D NG RH++ CR I+GK+E V  GS Q+HP+S+EFD GVDDL  PK YIVWST++N
Sbjct  328  LAEEDGNGERHIILCRAIMGKSEKVEAGSLQFHPSSEEFDSGVDDLANPKWYIVWSTHMN  387

Query  404  THILPLYIISF--TISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +HILP Y++SF  ++ + + H +       +S  KKP    ++FP L +E+   LP    
Sbjct  388  SHILPEYVVSFKSSMHSQDPHTM-------MSPSKKPCLTSLSFPKLFAEMGGSLPSSRK  440

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            Q++      ++ GK+ R   +K+LR   GD+ L   ++  R
Sbjct  441  QNLEILYNHYKAGKIRRDTFIKQLRSTVGDKTLASTIRRLR  481



>ref|XP_006404346.1| hypothetical protein EUTSA_v10011103mg [Eutrema salsugineum]
 gb|ESQ45799.1| hypothetical protein EUTSA_v10011103mg [Eutrema salsugineum]
Length=325

 Score =   170 bits (430),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 165/284 (58%), Gaps = 34/284 (12%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + + ++ ++++ R   S L     Q  I SI ++ F S  + +AKL++F ++  +V 
Sbjct  57   LMELPKDDKVYELIHRHCQSNLTP---QFQIISILRSGFQSP-LGQAKLKAFRIYTDSVA  112

Query  755  EKSGFGNGN-------MQFAWLGASKKELTSILQHGFDPSM--NKDGSFGHGVYLCPDHF  603
            EK+G G G        +++ W G  K EL  IL +GF      N DG     ++L PD+ 
Sbjct  113  EKNG-GCGKAAAEAARVKYGWCGVEKNELKEILMYGFSQQKLNNNDGL----LHLSPDNA  167

Query  602  PLGCLNSAMADENGVRHVLYCRVILGKTELVRP--GSRQWHPTSQEFDCGVDDLVFPKKY  429
            PL CL  +  DE+G+R +L  RVILGK+E+V P   + Q  P+S EFD GVD L  P+KY
Sbjct  168  PLQCLKDS-GDEDGIRFLLLSRVILGKSEIVVPQGSTTQSCPSSTEFDSGVDSLTTPRKY  226

Query  428  IVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKF  249
            I+WST++NTH+LP +++              ++  S+   K P SP ++FP L+  ++KF
Sbjct  227  IIWSTHMNTHVLPEFVVC-------------IKAPSILKRKNPKSPWVSFPILIKSISKF  273

Query  248  LPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            L P  ++ I  + K+ +E K++R E++KRLR + GD LL+ I+K
Sbjct  274  LNPSQIRLIQKHYKELQERKISRSELIKRLRSITGDRLLVHIIK  317



>ref|XP_008444977.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Cucumis melo]
Length=467

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 152/280 (54%), Gaps = 19/280 (7%)
 Frame = -2

Query  926  VEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EK  750
            + EG+  + ++   L+  +  V    +I +I +    +  ++KA+L    +F K  E   
Sbjct  203  LNEGDSGYSLVSNSLLPSMKKVDSTFSISAIHRCT-RTGPLEKARLD---VFLKQNEITA  258

Query  749  SGFGNGNMQFAWLGASKKELTSILQHGFDPSMN---KDGSFGHGVYLCPDHFPLGCLNSA  579
            +  G  NM +AW GAS K L  IL HGF   +     D + G GVYL P   P      +
Sbjct  259  AARGVSNMVYAWYGASAKTLAGILAHGFGEPVQIPASDATHGIGVYLSPWGLPHLSSKLS  318

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
             AD NGV+H++ CRVILG  E +  GSRQ HP+S EFD GVDD   PK+YIVW +N+N H
Sbjct  319  EADGNGVKHMILCRVILGNMEKIEAGSRQSHPSSTEFDTGVDDPTCPKRYIVWCSNMNRH  378

Query  398  ILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
            ILP YI+SF  S+    +L G  R S  +       +     L+S++   LPP  +Q + 
Sbjct  379  ILPEYIVSFKSSS----HLPGKLRESTET-------KYPLAKLLSKMRNSLPPSKVQEVA  427

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
            T  +  + G++ +  +VKRLR +AGDE+L+ I +  R  Q
Sbjct  428  TLFQKFKVGQLAKDVLVKRLRSIAGDEMLLSIFRESRGCQ  467



>ref|NP_974981.1| probable inactive poly [ADP-ribose] polymerase SRO5 [Arabidopsis 
thaliana]
 gb|AED97617.1| probable inactive poly [ADP-ribose] polymerase SRO5 [Arabidopsis 
thaliana]
Length=241

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 126/188 (67%), Gaps = 6/188 (3%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            L+ + EG++ H ++ R   SGL   G Q  I S+ +N F + V  +AKL++F +F +AV+
Sbjct  42   LMELLEGDKAHDLIYRNCKSGL---GDQCQILSVLRNGFRN-VGSRAKLKTFQVFQEAVQ  97

Query  755  EK-SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL-NS  582
             K  G G   +++ W   SK EL +I ++GF   +  DGSFG G+YL PD+ PL CL +S
Sbjct  98   MKHGGDGGAKVKYGWCSVSKHELKTIFEYGFSEPLRNDGSFGRGLYLSPDNSPLDCLKDS  157

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A   E+G+R +L CRV+LGK+E+V  GS +  P+S EFD GVDDLV  KKYIVWST++NT
Sbjct  158  ASESEDGMRFLLLCRVLLGKSEIVPQGSTRSCPSSPEFDSGVDDLVSTKKYIVWSTHMNT  217

Query  401  HILPLYII  378
            H+LP +++
Sbjct  218  HVLPEFLV  225



>ref|XP_002324757.2| hypothetical protein POPTR_0018s05040g [Populus trichocarpa]
 gb|EEF03322.2| hypothetical protein POPTR_0018s05040g [Populus trichocarpa]
Length=335

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/277 (34%), Positives = 162/277 (58%), Gaps = 11/277 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            ++ + E ++EH++++ + ++G+  +    ++ +I +N   S++  KA+ ++F     AV 
Sbjct  51   MMRIGEESKEHRVIKNQFLTGMNQLAEDTSVVTIHRN-ICSTMYMKARFEAFKSCVDAVR  109

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
            E+ G  + N++  W GASK+E+  I+  GF  S     S G GVYL    F L    S +
Sbjct  110  ERRG--DRNVKCGWYGASKQEILHIISFGF--SRCNGQSHGVGVYLSTSKFILETFPSTI  165

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
             DENG+RH+L C V +GK EL+R GS+Q +P+S EFD GVD+L  P + +VWS  +N+ I
Sbjct  166  EDENGLRHMLLCYVEMGKMELIRAGSKQIYPSSVEFDSGVDNLEDPSRLVVWSAYMNSFI  225

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LP+YI+SF   + +  +L    R  ++ + +    +++   L+  L K   P     I+ 
Sbjct  226  LPIYIVSFKAPSFSIGSL----REQINEV-RTGGEKLSIAVLLPILVKVFGPAKGDMISK  280

Query  215  YVKDHREGKMTRLEMVKRLRRLAG-DELLIKIVKAQR  108
             + DHR+ K+ R +M++ L+R+ G D +LI ++KA R
Sbjct  281  SLDDHRKCKINRDQMIQSLKRIIGNDRMLISVIKASR  317



>ref|XP_009411334.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Musa acuminata subsp. malaccensis]
Length=454

 Score =   171 bits (433),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 157/290 (54%), Gaps = 11/290 (4%)
 Frame = -2

Query  968  VTDLHEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKL  789
             + L + R      V +G++  +I+E+  +SG         + SI K    S  ++ ++L
Sbjct  171  TSSLDQPRWPGAEAVRDGDKYFKIVEKLFLSGFRRFAPNTIVTSIHKCS-QSGPLRASRL  229

Query  788  QSFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKD---GSFGHGVYL  618
            ++F +  +    K+  G+ N++F W GAS  E+ +I+ HGF    N+    G+ G GV+L
Sbjct  230  KTFRMHVEMT--KAARGDANVRFGWYGASATEMATIVSHGFGQPNNRSLASGARGVGVHL  287

Query  617  CPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFP  438
               H P     S  AD +G RH++ CRVI+G+ E+V  GS Q+HP+S+EFD GVDD+  P
Sbjct  288  SEPHSPYLSSLSTDADASGERHMVLCRVIVGRPEMVEEGSVQYHPSSEEFDSGVDDIAHP  347

Query  437  KKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSEL  258
              Y+VWST++NTHILP  I+S+  ST            SV+S + P +  I+ P L+ EL
Sbjct  348  TWYVVWSTHMNTHILPESIVSYKPSTTQPQG----PPQSVNSARNP-ALDISIPRLLEEL  402

Query  257  AKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
             + LP      +    K +   KM++    + +R + GDE+LI  +K  R
Sbjct  403  GRCLPASSTAPLQMIFKQYMGRKMSKKTFFRCIRSITGDEVLISTIKRMR  452



>gb|AFK40348.1| unknown [Medicago truncatula]
Length=334

 Score =   167 bits (423),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 151/290 (52%), Gaps = 37/290 (13%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            L G     + + +E   FSS++M    L    LF K  E  K+  G+ N+Q+AWL +SK 
Sbjct  36   LKGTSSFGSADIVEIYPFSSTMM----LSRLELFEKQAEITKNCRGDANIQYAWLASSKG  91

Query  695  ELTSILQHGFDPS--MNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
            EL+++++ G           + G GV+L    FP    +    DENGVRH+++CRVI+G 
Sbjct  92   ELSTMMKCGLGHCGISTSKCTHGFGVHLAAATFPFASASHCDIDENGVRHLVFCRVIMGN  151

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNA---  351
             EL+RPG+RQ+ P+S ++D GVDD+  P+ YIVW+ N NTHI P Y++SF +S+      
Sbjct  152  MELLRPGTRQFRPSSSDYDSGVDDIHNPRYYIVWNMNTNTHICPEYVVSFKVSSATEGLL  211

Query  350  ------HNLFGVQRNSVS-------------------SLKKPNSPRITFPSLVSELAKFL  246
                  +N+FGV   S S                   S + P SP + FP L+  L   +
Sbjct  212  LGSKTKNNIFGVNSASRSPKILSRSESSTVDTGIASGSRRGPTSPSMPFPVLIDALKNKV  271

Query  245  PPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIK--IVKAQRDM  102
              + M+ I  +    R  +MTR +  K+LR +  D+ L++  IV  Q  M
Sbjct  272  SAKDMEVINMHYLQFRAKRMTRDDFAKKLRLIVRDDALLRATIVGLQSKM  321



>ref|XP_010939313.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
isoform X1 [Elaeis guineensis]
Length=486

 Score =   169 bits (428),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/283 (35%), Positives = 161/283 (57%), Gaps = 14/283 (5%)
 Frame = -2

Query  938  RLIGVE---EGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFA  768
            R  GVE   +G+R ++++E+  + G+     +  I SI K    SS    ++L++F +  
Sbjct  210  RWTGVEVLGDGDRYYKVVEKLFLDGMRKFAPETVITSIHKC-LHSSPSGNSRLKAFQIQM  268

Query  767  KAVEEKSGFGNGNMQFAWLGASKKELTSILQHGF-DPSMNKDGS--FGHGVYLCPDHFPL  597
            +    K+  G+ N++F W G S +++ +++ HGF  P+ +  GS   G G++L P H P 
Sbjct  269  QMT--KANRGDDNVKFGWYGTSARDVAAVISHGFGQPNNSTLGSDACGVGIHLSPPHSPF  326

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
                 +  D NG RHV+ CRVI+G++E V  GS Q+HP+S++FD GVDDL  PK YI+WS
Sbjct  327  ASSLLSEVDANGERHVILCRVIMGRSEKVEAGSLQFHPSSEDFDSGVDDLENPKWYILWS  386

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            T +NT ILP Y++SF  S+  + +   +   S    KKP+   ++F  L +++ + L   
Sbjct  387  TCMNTRILPEYVVSFK-SSKQSQDPGRIMNPS----KKPSLTSLSFQKLFADMGRSLSSS  441

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
              Q I      ++ GKM++   +K LR  AGD+LL  I++  R
Sbjct  442  QRQDIEISYDHYKAGKMSKDTFIKHLRSTAGDKLLASIIRRIR  484



>ref|NP_190356.2| probable inactive poly [ADP-ribose] polymerase SRO4 [Arabidopsis 
thaliana]
 sp|Q9STU1.2|SRO4_ARATH RecName: Full=Probable inactive poly [ADP-ribose] polymerase 
SRO4; AltName: Full=Protein SIMILAR TO RCD ONE 4 [Arabidopsis 
thaliana]
 gb|AEE78322.1| probable inactive poly [ADP-ribose] polymerase SRO4 [Arabidopsis 
thaliana]
Length=316

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/286 (33%), Positives = 168/286 (59%), Gaps = 36/286 (13%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMG-VGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAV  759
            L  + + ++ ++++ R   S L   +  Q  I SI KN F +  + +AKL++F ++A++V
Sbjct  46   LTELPKDDKVYELIYRHCQSKLTSHLSNQFEIVSILKNGFQTP-LGQAKLKAFQIYAESV  104

Query  758  EEKSGFGNGN---------MQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDH  606
             +KSG   GN         +++   G  K+EL +IL +GF           + + L PD+
Sbjct  105  AKKSGSCCGNKAAVAEAARVKYGCCGVEKEELKAILMYGFS---------NNALCLSPDN  155

Query  605  FPLGCL--NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKK  432
             PL C+   S+  +E+G+  +L+ R+I+GK+E+V   S Q +P+S EFD GVD L  P K
Sbjct  156  APLQCMIDPSSSCNEDGISFLLFSRIIMGKSEVVCSTS-QSYPSSMEFDSGVDSLTSPNK  214

Query  431  YIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAK  252
            YI+WST++NTH+LP +++              ++  S+   K P SP I+FP L++ ++K
Sbjct  215  YIIWSTHMNTHVLPEFVVC-------------IKTPSILKRKNPKSPWISFPVLINSISK  261

Query  251  FLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
            FL    ++ I  + K+H++ +++R E+++RLR + GD LL++I+K+
Sbjct  262  FLNQSQIRLIHKHYKEHQDRRISRCELIQRLRSITGDSLLVQIIKS  307



>ref|XP_009775772.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Nicotiana sylvestris]
Length=549

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/281 (37%), Positives = 155/281 (55%), Gaps = 9/281 (3%)
 Frame = -2

Query  968  VTDLHEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKL  789
             T+LH  R  +   + E  + +Q+++  L+SGL  V     + SI +    +  ++KA+L
Sbjct  267  ATELHSPRWPKARSLREEEKGYQMVKGLLLSGLRTVDPGVTVTSIHQC-VRTGPLEKARL  325

Query  788  QSFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHG--VYLC  615
            + F    + ++   G GN N+ +AW G S K +  IL+HGF       GS  HG  VYL 
Sbjct  326  EVFHTNMEIIKRARG-GNLNVVYAWYGTSAKNVEIILRHGFGMPSVVHGSNAHGLGVYLS  384

Query  614  PDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPK  435
            P   P      +  DE G +H++ CRVILGK E V  GS+Q +P+S +FD GVDDL  PK
Sbjct  385  PLRQPQNSAMMSEVDEYGEKHIVLCRVILGKLEKVELGSQQRYPSSVDFDTGVDDLTNPK  444

Query  434  KYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELA  255
             Y+VWS N+NTHILP  I+S+      +      Q N  SS+K          +L+S+L+
Sbjct  445  WYVVWSANMNTHILPECIVSYKSGRHKSG-----QANGASSMKWAPHASNAMGTLISKLS  499

Query  254  KFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
              LPP  +Q + +    +REGK+ +   +++LR +AGDELL
Sbjct  500  TLLPPPKVQELQSLYGSYREGKLGKEVFMRQLRSVAGDELL  540



>ref|XP_008785694.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
isoform X1 [Phoenix dactylifera]
Length=502

 Score =   168 bits (426),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 97/280 (35%), Positives = 155/280 (55%), Gaps = 14/280 (5%)
 Frame = -2

Query  929  GVE---EGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAV  759
            GVE   +G+R ++++E+  + G+        I SI K    S     ++L++F +  +  
Sbjct  229  GVEVLGDGDRYYKVVEKLFLDGMRKFAPDTVITSIHKC-LHSGPTGNSRLKAFQIQMQMT  287

Query  758  EEKSGFGNGNMQFAWLGASKKELTSILQHGF-DPSMNKDGS--FGHGVYLCPDHFPLGCL  588
              K+  G+ N++F W G   +++T++L HGF  P+    GS   G G++L P H P    
Sbjct  288  --KANRGDDNVKFGWYGTPARDVTAVLSHGFGQPNNGTLGSDACGVGIHLSPPHSPYTSS  345

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
              + AD NG RH++ CR I+GK E V  GS Q+HP+SQ+FD GVDDL  PK YI+WST +
Sbjct  346  LLSEADVNGERHIILCRAIMGKPEKVEAGSLQFHPSSQDFDSGVDDLANPKWYILWSTRM  405

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            NTHILP Y++SF  S  +           +S  +KP+   ++F  L +++   L     Q
Sbjct  406  NTHILPEYVVSFKSSRKSQD-----PERIMSPSRKPSITSLSFQKLFADIGGSLSSSRRQ  460

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            +I  +   ++ GKM++   +K LR + GD+LL   ++  R
Sbjct  461  AIEIFYDHYKAGKMSKGTFIKHLRSIVGDKLLASTIRRIR  500



>ref|XP_002875860.1| hypothetical protein ARALYDRAFT_323380 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52119.1| hypothetical protein ARALYDRAFT_323380 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   164 bits (416),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 176/305 (58%), Gaps = 40/305 (13%)
 Frame = -2

Query  968  VTDLHEQRNS-----RLIGVEEGNREHQIMERKLVSGLMG-VGMQAAIESIEKNEFSSSV  807
            V+D  +Q +S      L+ + + ++ ++++     S L   +G Q  I SI KN F +  
Sbjct  42   VSDCDQQHSSIANELGLMELPKDDKAYKLIYGHCQSKLTSHLGNQFQIVSILKNGFKTP-  100

Query  806  MKKAKLQSFSLFAKAVEEKSGF-----GN-------GNMQFAWLGASKKELTSILQHGFD  663
            + +AKL++F ++ ++V +KSG      GN         +++   G  K+EL +IL +GF 
Sbjct  101  LGQAKLKAFQIYTESVAKKSGSYCECGGNKAAAGEAARVKYGCCGVEKEELKAILMYGFS  160

Query  662  PSMNKDGSFGHGVYLCPDHFPLGCL--NSAMADENGVRHVLYCRVILGKTELVRPGSRQW  489
               N +G     + L PD+  L C+   S+  +E+G R +L+ R+I+GK+E V   + Q 
Sbjct  161  QFRNNNG-----LCLSPDNASLQCMIDPSSSCNEDGTRFLLFSRIIMGKSE-VMGSTAQS  214

Query  488  HPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSL  309
            +P+S EFD GVD L+ PKKY++WST++NTH+LP +++              ++  S+   
Sbjct  215  YPSSPEFDSGVDSLISPKKYMIWSTHMNTHVLPEFVVC-------------IKTPSILRS  261

Query  308  KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLI  129
            K P SP I FP L+  ++KFL P  ++ I  + K+++E ++ R E+++RLR +AGD LL+
Sbjct  262  KNPKSPWILFPILIKSISKFLNPSQIRLIQKHYKEYQESRILRFELIQRLRTIAGDRLLV  321

Query  128  KIVKA  114
            +I+K+
Sbjct  322  QIIKS  326



>ref|XP_009341582.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO1 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009341583.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO1 
isoform X1 [Pyrus x bretschneideri]
Length=600

 Score =   169 bits (427),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/320 (34%), Positives = 164/320 (51%), Gaps = 66/320 (21%)
 Frame = -2

Query  908  EHQIMERKLVSGLMGVGMQA--AIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-G  738
            E + ++R  V  +   GM +   +E ++  + S ++M+ A+L+   LF K VE    F G
Sbjct  269  EKEKLDRDTVHKIFLKGMSSFDVVEVLDIYQCSITLMQ-ARLE---LFQKQVEITKTFRG  324

Query  737  NGNMQFAWLGASKKELTSILQHGFDPS---MNKDGSFGHGVYLCPDHFPLGCLNSAMADE  567
            + N+++AWL +SK EL++I+ +G   S   MNK   +G GV+L    F   C NS   DE
Sbjct  325  DANIRYAWLASSKGELSTIMMYGLGHSGLAMNKS-IYGTGVHLTEASFSNTCANSCDVDE  383

Query  566  NGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPL  387
            NG+RH+L+CRVI+G  EL+ PGS Q+HP+S++FD GVD L  PK YIVW+ N+NTHI P 
Sbjct  384  NGIRHMLFCRVIMGNMELLHPGSTQFHPSSKDFDSGVDGLEDPKHYIVWNMNMNTHIYPE  443

Query  386  YIISFTISTLNAHNLFGVQR-------------------------------------NSV  318
            +++SF I +    +L G +                                      N++
Sbjct  444  FVVSFKIISNAEGHLIGTENKLGASGVATSCQGPQGSSAVDTGSETQPLSDSGKSHGNNI  503

Query  317  SSLKKPN------------------SPRITFPSLVSELAKFLPPQIMQSITTYVKDHREG  192
              + KP                   SP + FP L S +   +PP++M+ +  +    R  
Sbjct  504  QMVSKPGGFQGESTTTGSAPQRAPKSPWMPFPMLFSAIENKVPPEVMKQVNVHYDLFRVK  563

Query  191  KMTRLEMVKRLRRLAGDELL  132
            K+TR E VK+LR + GD LL
Sbjct  564  KITRDEFVKKLRLVVGDTLL  583



>ref|XP_004148400.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Cucumis 
sativus]
 ref|XP_004168437.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Cucumis 
sativus]
 gb|KGN62785.1| hypothetical protein Csa_2G372800 [Cucumis sativus]
Length=465

 Score =   167 bits (422),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 102/277 (37%), Positives = 151/277 (55%), Gaps = 19/277 (7%)
 Frame = -2

Query  926  VEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EK  750
            + EG+  + ++   L+  +  V    +I +I +    +  ++KA+L    +F K  E   
Sbjct  203  LNEGDSGYSLVSNSLLPSMKKVDSTFSISAIHRCT-RTGPLEKARLD---VFLKQNEITT  258

Query  749  SGFGNGNMQFAWLGASKKELTSILQHGFDPSMN---KDGSFGHGVYLCPDHFPLGCLNSA  579
            +  G  NM +AW GAS K L  IL HGF   +     D + G GVYL P   P      +
Sbjct  259  AARGVSNMVYAWYGASAKTLAGILAHGFGEPVQIPASDTTHGIGVYLSPLGLPHLSSKLS  318

Query  578  MADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTH  399
             AD NGV+H++ CRVILG  E V  GSRQ HP+S EFD GVDD   PK+YIVW +N+N H
Sbjct  319  EADGNGVKHMILCRVILGNMEKVGAGSRQSHPSSTEFDTGVDDPTCPKRYIVWCSNMNRH  378

Query  398  ILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSIT  219
            ILP YI+SF  ++    +L G  R S  +       +     L+S++   LPP  +Q + 
Sbjct  379  ILPEYIVSFKSTS----HLPGNLRESTET-------KYPLVKLLSKMRNSLPPSKVQEVA  427

Query  218  TYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            T  +  + G++ +  +VKRLR +AGD++L+ I +  R
Sbjct  428  TLFQKFKVGQLAKDVLVKRLRSIAGDQMLLSIFRESR  464



>ref|XP_003561862.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Brachypodium distachyon]
Length=439

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/282 (31%), Positives = 161/282 (57%), Gaps = 13/282 (5%)
 Frame = -2

Query  938  RLIGVEEGNREHQIMERKLVSGLMGVGMQA-AIESIEKNEFSSSVMKKAKLQSFSLFAKA  762
            + + +EE ++ +Q++++ L+SG+  +G +  A+ ++ K      V +  + ++F L  + 
Sbjct  164  KAVKLEETDKFYQLVKKLLLSGIAPMGGRGVAMTAVHK------VAQGPRSRAFQLQGQL  217

Query  761  VEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNK---DGSFGHGVYLCPDHFPLGC  591
            +  + G G GN +FAW GA   ++ + ++HGF  + ++     + G GV+L P   P   
Sbjct  218  LAAQRGAGGGNAKFAWYGAPSVDVAAAVEHGFGKTNSRVLGHRAHGDGVHLSPPQSPYAS  277

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
               A ADE+G  H++ CRV++G+ E +  GS Q HP+S  +D  VD++  PK Y+VWST+
Sbjct  278  AMLAKADESGEAHIVLCRVLMGRPEAIPAGSSQCHPSSDNYDSAVDNIQNPKWYVVWSTD  337

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNS-PRITFPSLVSELAKFLPPQI  234
            +NT ILP Y++SF    L    + G    + S LKKP+   R  FP+L++E+ +F+P   
Sbjct  338  MNTRILPEYVVSFKCPNL--QQMQGSSSRATSELKKPSPVARDMFPTLLAEIQRFVPSSK  395

Query  233  MQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            +Q++       ++G+M + + ++ LR   GD +L  + +  R
Sbjct  396  LQTLQGTYNCFKKGQMKKDQFIRFLRTFIGDRVLTTVAQKLR  437



>ref|XP_010515080.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO4 
[Camelina sativa]
Length=331

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/307 (34%), Positives = 172/307 (56%), Gaps = 47/307 (15%)
 Frame = -2

Query  965  TDLHEQRNSRL---IGVEE---GNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVM  804
            +D H+Q++  +   +G+ E    ++ ++++ R   + L     Q  I SI KN F +  M
Sbjct  37   SDCHQQQSFSIANELGLMELLKDDKAYELIYRHCQTKLTS---QFQIVSILKNGFQTP-M  92

Query  803  KKAKLQSFSLFAKAVEEKSGFG----NGN---------MQFAWLGASKKELTSILQHGFD  663
             +AKL++F ++ ++V +K G       GN         + +      K+EL +IL +GF 
Sbjct  93   GQAKLKAFQIYTESVAKKCGSCCCECRGNKAAAAEAARVTYGCCSVEKEELKTILMYGFS  152

Query  662  PSMNKDGSFGHGVYLCPDHFPLGCLN---SAMADENGVRHVLYCRVILGKTELVRPGSRQ  492
               N  G     +YL PD+ PL C+    S+  DE+G+R +L+ R+I+GK+E+V   + Q
Sbjct  153  HFRNNTG-----LYLSPDNAPLQCMRDPPSSSCDEDGMRFLLFSRIIMGKSEVV-GSTAQ  206

Query  491  WHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISF-TISTLNAHNLFGVQRNSVS  315
             +P+S EFD GVD L  PKKY +WST++NTH+LP +++   T STL   N          
Sbjct  207  SYPSSTEFDSGVDSLTSPKKYFIWSTHMNTHVLPEFVVCIKTPSTLKRKN----------  256

Query  314  SLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDEL  135
                P SP I FP L+  ++KFL P  +  I  + K+H++ +++R E+++RLR + GD L
Sbjct  257  ----PQSPWIMFPVLIKSISKFLNPSQICLIQKHYKEHQDRRISRSELIQRLRSITGDRL  312

Query  134  LIKIVKA  114
            L++ +K+
Sbjct  313  LVQTIKS  319



>ref|XP_003613057.1| hypothetical protein MTR_5g032190 [Medicago truncatula]
 gb|AES96015.1| inactive poly [ADP-ribose] polymerase RCD1 [Medicago truncatula]
Length=573

 Score =   167 bits (424),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 151/290 (52%), Gaps = 37/290 (13%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            L G     + + +E   FSS++M    L    LF K  E  K+  G+ N+Q+AWL +SK 
Sbjct  275  LKGTSSFGSADIVEIYPFSSTMM----LSRLELFEKQAEITKNCRGDANIQYAWLASSKG  330

Query  695  ELTSILQHGFDPS--MNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
            EL+++++ G           + G GV+L    FP    +    DENGVRH+++CRVI+G 
Sbjct  331  ELSTMMKCGLGHCGISTSKCTHGFGVHLAAATFPFASASHCDIDENGVRHLVFCRVIMGN  390

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNA---  351
             EL+RPG+RQ+ P+S ++D GVDD+  P+ YIVW+ N NTHI P Y++SF +S+      
Sbjct  391  MELLRPGTRQFRPSSSDYDSGVDDIHNPRYYIVWNMNTNTHICPEYVVSFKVSSATEGLL  450

Query  350  ------HNLFGVQRNSVS-------------------SLKKPNSPRITFPSLVSELAKFL  246
                  +N+FGV   S S                   S + P SP + FP L+  L   +
Sbjct  451  LGSKTKNNIFGVNSASRSPKILSRSESSTVDTGIASGSRRGPTSPSMPFPVLIDALKNKV  510

Query  245  PPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIK--IVKAQRDM  102
              + M+ I  +    R  +MTR +  K+LR +  D+ L++  IV  Q  M
Sbjct  511  SAKDMEVINMHYLQFRAKRMTRDDFAKKLRLIVRDDALLRATIVGLQSKM  560



>ref|XP_009618750.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Nicotiana tomentosiformis]
Length=549

 Score =   167 bits (423),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/280 (36%), Positives = 156/280 (56%), Gaps = 9/280 (3%)
 Frame = -2

Query  965  TDLHEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQ  786
            T+LH  R  +   + E  + +Q+++  L+SGL  V     + SI +    +  ++KA+L+
Sbjct  268  TELHSPRWPKARSLREEEKGYQMVKGLLLSGLRTVDPGVTVTSIHQC-VRTGPLEKARLE  326

Query  785  SFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGV--YLCP  612
             F    + ++   G GN N+ +AW G S K +  IL+HGF       GS  HGV  YL P
Sbjct  327  VFQTNMEIIKRTRG-GNLNVVYAWYGTSAKNVEIILRHGFGMPSVVHGSNAHGVGVYLSP  385

Query  611  DHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKK  432
               P      +  DE G +H++ CRVILGK E V  GS+Q +P+S +FD GVDDL  PK 
Sbjct  386  LRQPQNSAIMSEVDEYGEKHIVLCRVILGKLEKVELGSQQRYPSSVDFDTGVDDLTNPKW  445

Query  431  YIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAK  252
            Y+VWS N+NTHILP  ++S+        ++ G Q N  SS+K          +L+S+L+ 
Sbjct  446  YVVWSANMNTHILPECVVSYKY----GRHMSG-QANCASSMKWAPHASNAMGTLISKLST  500

Query  251  FLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
             LPP  +Q + +    +REGK+ +   +++LR + GDE+L
Sbjct  501  LLPPPKVQELQSLYGSYREGKLGKEVFMRQLRSVVGDEML  540



>emb|CAB41855.1| putative protein [Arabidopsis thaliana]
Length=326

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/291 (33%), Positives = 170/291 (58%), Gaps = 36/291 (12%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMG-VGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAV  759
            L  + + ++ ++++ R   S L   +  Q  I SI KN F +  + +AKL++F ++A++V
Sbjct  46   LTELPKDDKVYELIYRHCQSKLTSHLSNQFEIVSILKNGFQTP-LGQAKLKAFQIYAESV  104

Query  758  EEKSGFGNGN---------MQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDH  606
             +KSG   GN         +++   G  K+EL +IL +GF           + + L PD+
Sbjct  105  AKKSGSCCGNKAAVAEAARVKYGCCGVEKEELKAILMYGFS---------NNALCLSPDN  155

Query  605  FPLGCL--NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKK  432
             PL C+   S+  +E+G+  +L+ R+I+GK+E+V   S Q +P+S EFD GVD L  P K
Sbjct  156  APLQCMIDPSSSCNEDGISFLLFSRIIMGKSEVVCSTS-QSYPSSMEFDSGVDSLTSPNK  214

Query  431  YIVWSTNINTHILPLYIISFTISTL-----NAHNLFGVQRNSVSSLKKPNSPRITFPSLV  267
            YI+WST++NTH+LP +++     ++     +   LF ++         P SP I+FP L+
Sbjct  215  YIIWSTHMNTHVLPEFVVCIKTPSILKRIADLVCLFDIEN--------PKSPWISFPVLI  266

Query  266  SELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKA  114
            + ++KFL    ++ I  + K+H++ +++R E+++RLR + GD LL++I+K+
Sbjct  267  NSISKFLNQSQIRLIHKHYKEHQDRRISRCELIQRLRSITGDSLLVQIIKS  317



>ref|XP_010503382.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO4 
[Camelina sativa]
Length=339

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 178/312 (57%), Gaps = 48/312 (15%)
 Frame = -2

Query  968  VTDLHEQRNSR------LIGVEEGNREHQIMERKLVSGLMGVGM---QAAIESIEKNEFS  816
            ++D  +Q++S       LI + + ++ ++++ R   + LM   +   Q  I SI KN F 
Sbjct  37   LSDCDQQQSSSIAKELGLIELLKDDKAYELIYRHCQTKLMTSHLADDQFQIVSILKNGFQ  96

Query  815  SSVMKKAKLQSFSLFAKAVEEKSG-------------FGNGNMQFAWLGASKKELTSILQ  675
            +  + +AKL++F ++ ++V +KSG                  + +      K+EL +IL 
Sbjct  97   TP-LGQAKLKAFQIYTESVAKKSGSCCCERGVNKAAAAEAARVTYGCCSVEKEELKTILI  155

Query  674  HGFDPSMNKDGSFGHGVYLCPDHFPLGCL----NSAMADENGVRHVLYCRVILGKTELVR  507
            +GF    N +G     +YL PD+ PL  +    +S+  DE+G+R++L+ R+I+GK+E+V 
Sbjct  156  YGFSHFRNNNG-----LYLSPDNAPLQSMIDPPSSSNCDEDGMRYLLFSRIIMGKSEVV-  209

Query  506  PGS-RQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQ  330
             GS  Q +P+S EFD GVD L  PKKY +WST++NTH+LP +++              ++
Sbjct  210  -GSIAQSYPSSPEFDSGVDSLTSPKKYFIWSTHMNTHVLPEFVVC-------------IK  255

Query  329  RNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRL  150
              S+   K P SP I FP L+  ++KFL P  ++ +  + K+H++ +++R E+++RLR +
Sbjct  256  TPSILKRKNPKSPWIMFPVLIKSISKFLNPSQIRLVQKHYKEHQDRRISRSELIQRLRSI  315

Query  149  AGDELLIKIVKA  114
             GD LL++I+K+
Sbjct  316  TGDRLLVQIIKS  327



>ref|XP_004489757.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Cicer 
arietinum]
Length=582

 Score =   167 bits (422),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 155/288 (54%), Gaps = 38/288 (13%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            L G+      + +E   FSS++M+        LF K  E  K   G+ N+Q+AWL +SK 
Sbjct  285  LNGMSSFGRADLVEIYPFSSTLMQ----SRLELFEKQAEITKHCHGDANVQYAWLASSKG  340

Query  695  ELTSILQHGFDP---SMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILG  525
            EL+++++ G      S +K  ++G GV+L     P    +    DENGVRH+++CRVI+G
Sbjct  341  ELSTMMKCGLGHCGLSASK-CTYGIGVHLAAATCPFASASYCDVDENGVRHLVFCRVIMG  399

Query  524  KTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST-----  360
              EL+RPG+RQ+ P+S ++D GVDD+  P+ YIVW+ N+NTHI P +++SF +S      
Sbjct  400  NMELLRPGTRQFRPSSCDYDSGVDDIHSPRYYIVWNMNVNTHIHPEFVVSFKVSADVEGL  459

Query  359  ----LNAHNLFGVQRNS------------------VSSL-KKPNSPRITFPSLVSELAKF  249
                 + +N+FGV   S                   +SL K P SP + FP L + +   
Sbjct  460  LSRNKSKNNIFGVNSASQGPKSLSRSESSTVDTGITTSLPKAPTSPWMPFPMLFAAITNN  519

Query  248  LPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL-IKIVKAQR  108
            +P + M+ I  +    R  KMTR E VK+LR + GD LL   I   QR
Sbjct  520  VPAKDMELINMHYLHFRAKKMTRDEFVKKLRLIVGDALLRATITSLQR  567



>gb|AAC18815.1| F17O7.2 [Arabidopsis thaliana]
Length=327

 Score =   161 bits (407),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 94/291 (32%), Positives = 158/291 (54%), Gaps = 19/291 (7%)
 Frame = -2

Query  932  IGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEE  753
            I + E   EH +++   +SG+     +  I ++ K      +  KAK   F LF +A++ 
Sbjct  38   ILLREATFEHNLIKNCFLSGMGSFATETTIVTVRKILTQRLITTKAKFAVFKLFTEAMKR  97

Query  752  KSGFGNGNMQFAWLGASKKELTSILQHGFD-----PSMNKDGSFGHGVYLCPDHFPLGCL  588
            K+  G  N+++ W   SK+E+  ++ +GF         N  GS G G++L    + L   
Sbjct  98   KNN-GYANIRYGWYSGSKEEIDRVITYGFSNREIKKVENDVGSHGVGIHLVHHRYSLAAA  156

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
                 DE G++++L CRVILGK E +  GS+Q +P+S +FD GVD+L  P+KY++WS N+
Sbjct  157  LVGEGDEEGIKNILLCRVILGKPEQIVTGSKQSYPSSNQFDSGVDNLENPRKYVIWSCNM  216

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            N++ILP YI+SF      +H L G+       + +  SP ++F  L+S L+K L    M 
Sbjct  217  NSYILPTYIVSF-----KSHLLRGL-------IGRARSPCVSFSVLMSILSKSLDAARMN  264

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQIYTSMGNK  75
             I T   D R+ K+ R ++V+++R +   +L  ++ K Q+ + I   +G K
Sbjct  265  LILTSYDDFRKRKLRREQLVRKIREVDVTDLP-ELAKVQQQLMIRNGVGLK  314



>ref|XP_010426219.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO4 
[Camelina sativa]
 ref|XP_010426220.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO4 
[Camelina sativa]
 ref|XP_010426221.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO4 
[Camelina sativa]
Length=337

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 175/310 (56%), Gaps = 45/310 (15%)
 Frame = -2

Query  968  VTDLHEQRNSRL---IGVEE---GNREHQIMERKLVSGLMGVGM---QAAIESIEKNEFS  816
            ++D  +Q++S +   +G+ E    ++ ++++ R   + LM   +      I SI KN F 
Sbjct  36   LSDCDQQQSSSIAKELGLMELLKDDKAYELIYRHCQTKLMTYNLADDHFQIISILKNGFQ  95

Query  815  SSVMKKAKLQSFSLFAKAVEEKSG-------------FGNGNMQFAWLGASKKELTSILQ  675
            +  + +AKL++F ++ ++V +KSG                  + +      K+EL +IL 
Sbjct  96   TP-LGQAKLKAFQIYIESVAKKSGSCCCERGVNKAAAAEAARVTYGCCSVEKEELKTILM  154

Query  674  HGFDPSMNKDGSFGHGVYLCPDHFPLGCL---NSAMADENGVRHVLYCRVILGKTELVRP  504
            +GF    N +G     +YL PD+ PL C+    S+  DE+G+R +L+ R+I+GK+E+V  
Sbjct  155  YGFSHFRNNNG-----LYLSPDNAPLQCMIGPPSSSCDEDGMRFLLFSRIIMGKSEVV-G  208

Query  503  GSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRN  324
             + Q +P+S EFD GVD L  PKKY +WST++NTH+LP +++              ++  
Sbjct  209  STAQSYPSSPEFDSGVDSLTSPKKYFIWSTHMNTHVLPEFVVC-------------IKTP  255

Query  323  SVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAG  144
            S+   K P SP I FP L+  ++KFL    ++ I  + K+H+E +++R E+++RLR + G
Sbjct  256  SMLKRKNPKSPWILFPVLIKSISKFLNSSQIRLIHKHYKEHQERRISRSELIQRLRIITG  315

Query  143  DELLIKIVKA  114
            D LLI+I+K+
Sbjct  316  DRLLIQIIKS  325



>gb|EMT23623.1| hypothetical protein F775_03099 [Aegilops tauschii]
Length=439

 Score =   163 bits (412),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/283 (31%), Positives = 159/283 (56%), Gaps = 14/283 (5%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMG-VGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
             R + +EE ++ +Q++++  +SG+   VG   AI ++ K      V +  + ++F    +
Sbjct  164  GRAVRLEETDKFYQVVKKLFLSGIAPRVGGGVAITAVHK------VAQGPRCRAFQQQGQ  217

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNK---DGSFGHGVYLCPDHFPLG  594
             +    G   GN +FAW GA   ++ + ++HGF  + ++     + G GV+L P   P  
Sbjct  218  LLAAARGADGGNAKFAWYGAPSADVAAAVEHGFGRTNSRVLGHRAHGDGVHLSPPQSPYA  277

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
                A ADENG  H++ CRV++G+ E +  GS Q HP+S ++D  VD++  P+ Y+VWS 
Sbjct  278  SAMLANADENGEAHIVLCRVLMGRPEAIPAGSSQLHPSSDDYDSAVDNMQNPQWYVVWSK  337

Query  413  NINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNS-PRITFPSLVSELAKFLPPQ  237
            ++NT ILP Y++SF   +L  H + G    + S+LKKP+   R  FP+L++E+ +F+P  
Sbjct  338  DMNTRILPEYVVSFKCPSL--HQMQG-SSGATSALKKPSPVARDMFPTLLAEIQRFVPSS  394

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
             ++++       ++G+M + + ++ LR   GD +L  + K  R
Sbjct  395  KLETLQGTYNRFKKGQMKKDQFIRFLRAFIGDRVLTAVAKKLR  437



>ref|XP_002988021.1| hypothetical protein SELMODRAFT_447190 [Selaginella moellendorffii]
 gb|EFJ10813.1| hypothetical protein SELMODRAFT_447190 [Selaginella moellendorffii]
Length=790

 Score =   166 bits (419),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 103/279 (37%), Positives = 155/279 (56%), Gaps = 12/279 (4%)
 Frame = -2

Query  938  RLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAV  759
            RL  +E G+ +   ++   ++GL  + + A + S+ K  +      +A+ ++F   +   
Sbjct  172  RLAKLEAGDPKLVDVKAAFLAGLGRLSVVADVTSVCKVRYDCP-GGQARREAFETLSDLT  230

Query  758  EEKSGFGNGNMQFAWLGASKKELTSILQHGFD-PSMNKDGSFGHGVYLCPDHFPLGCLNS  582
             +  G G+ N+Q AW G S+ EL S+++HGF  PS+  D ++G G+YL P+         
Sbjct  231  AKVRG-GDANLQQAWYGCSRNELLSVIKHGFGRPSV--DSTYGVGIYLSPESLSRLSCRG  287

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A  DENG +HVL CR ILGK ELVR GS+Q+HP+S   D GVD+L  PK++IVWST +NT
Sbjct  288  ADIDENGEQHVLLCRAILGKAELVRAGSKQFHPSSDLVDTGVDNLANPKRFIVWSTRMNT  347

Query  401  HILPLYIISFTISTLNAHNLF--GVQRNSVSSLKK----PNSPRITFPSLVSELAKFLPP  240
            HILPLY+ SF       H +     + ++ S +K+    P    +T P L S L   L  
Sbjct  348  HILPLYVASFKFPR-KWHGIMEASAKCSNSSEIKEKVIAPKQSSVTVPMLFSVLKPELSS  406

Query  239  QIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKI  123
              M  +     + +  K++R E +KR+R L GDE L KI
Sbjct  407  SEMNIVVQDYLELKNAKISREEFLKRVRTLIGDEKLKKI  445



>emb|CBI33838.3| unnamed protein product [Vitis vinifera]
Length=390

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 108/312 (35%), Positives = 161/312 (52%), Gaps = 59/312 (19%)
 Frame = -2

Query  905  HQIMERKLVSGLMGVGMQAAIES--IEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-GN  735
            H  ++   V  +   GM + I +  IE    SS+ M+ A+L+   LF K +E  S +  +
Sbjct  52   HGSLDFDTVRDMFTSGMNSLISADIIEVYRGSSASME-ARLE---LFQKQIEITSKYRAD  107

Query  734  GNMQFAWLGASKKELTSILQHGFD---PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADEN  564
             N+++AWL ASK+ L+SI+ +G     PS  K   +G GV+L   +F    +N    DEN
Sbjct  108  ANVKYAWLAASKEALSSIMMYGLGHCRPSKVKP-VYGIGVHLTAANFSYPSVNYCDVDEN  166

Query  563  GVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLY  384
            GV+H++ CRVI+G  ELV PGS Q HP+S+ FD GVDDL  PK YI+W+ N+NTHI P Y
Sbjct  167  GVQHIVLCRVIMGNMELVHPGSGQCHPSSENFDSGVDDLQNPKHYIIWNMNMNTHIYPEY  226

Query  383  IISFTIST-LNAHN-LFGVQRN--------------------------------------  324
            ++SF +S+ + A   L G + N                                      
Sbjct  227  VVSFKVSSRVGAEGYLIGNESNYDISGVTTCQGQSQGHSKLGLHPVGLGNDSHPTPSLGR  286

Query  323  --------SVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMV  168
                      S+L+ P SP + FP L + ++K +P + MQ + T  +  R  K++R + V
Sbjct  287  SLGKATTLGSSTLRVPKSPWMPFPMLFAAISKKVPLKDMQLVDTQYELFRRKKISRADFV  346

Query  167  KRLRRLAGDELL  132
            K+LR + GD LL
Sbjct  347  KKLRLIVGDTLL  358



>ref|XP_006293007.1| hypothetical protein CARUB_v10019284mg [Capsella rubella]
 gb|EOA25905.1| hypothetical protein CARUB_v10019284mg [Capsella rubella]
Length=330

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 154/263 (59%), Gaps = 36/263 (14%)
 Frame = -2

Query  854  QAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFG----NGN---------MQFAW  714
            Q  I SI KN F +  + +AKL++F ++ ++V +KSG       GN         +++  
Sbjct  79   QFQIVSILKNGFGTP-LGQAKLKAFQIYTESVAKKSGTSFCECRGNKAAAAEAAKVKYGC  137

Query  713  LGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCL---NSAMADENGVRHVLY  543
                K+EL +IL +GF    N +G     + L  D+ PL C+    ++  +E+G+R +L+
Sbjct  138  CSVEKEELKTILMYGFSHFRNING-----LCLSSDNAPLQCMIDPAASSCEEDGIRFLLF  192

Query  542  CRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIS  363
             R+I+GK+E+V   S Q +P+S EFD GVD L  PKKYI+WST++NTH+LP +++ F   
Sbjct  193  SRIIMGKSEVVGSNS-QSYPSSPEFDSGVDSLTTPKKYIIWSTHMNTHVLPEFVVCF---  248

Query  362  TLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMT  183
                      +  S+   K P SP I FP L+  ++KFL    ++ I  + K+H++ +++
Sbjct  249  ----------KTPSILKRKNPKSPWILFPDLIKSISKFLNQSQIRLIQKHYKEHQDRRIS  298

Query  182  RLEMVKRLRRLAGDELLIKIVKA  114
            R E+++RLR + GD LLI+I+K+
Sbjct  299  RSELIQRLRSITGDRLLIQIIKS  321



>ref|XP_008375548.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Malus 
domestica]
 ref|XP_008375549.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Malus 
domestica]
Length=600

 Score =   162 bits (411),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 143/286 (50%), Gaps = 61/286 (21%)
 Frame = -2

Query  815  SSVMKKAKLQSFSLFAKAVEEKSGF-GNGNMQFAWLGASKKELTSILQHGFDPS--MNKD  645
            SS + +A+L+   LF K VE    F G+ N+++AWL +SK EL +I+ +G   S      
Sbjct  301  SSTLMQARLE---LFQKQVEITKTFRGDANIRYAWLASSKGELATIMMYGLGHSGLATNK  357

Query  644  GSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFD  465
              +G GV+L    F   C +S   DENG RH++ CRVI+G  EL+ PGS+Q+HP+S++FD
Sbjct  358  SIYGTGVHLTEASFSNXCASSCDVDENGARHMILCRVIMGNMELLHPGSKQFHPSSKDFD  417

Query  464  CGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQR--------------  327
             GVD L  PK YIVW+ N+NTHI P +++SF I++    +L G +               
Sbjct  418  SGVDGLQDPKHYIVWNMNMNTHIYPEFVVSFKITSNTEGHLIGTENKLGASGVGTSCQGP  477

Query  326  -----------------------NSVSSLKKP------------------NSPRITFPSL  270
                                   N+   + KP                   SP + FP L
Sbjct  478  QGSSAVDTGSETQPLSDSGKSHGNNSQMISKPXRFQGETTNTGSAPQRTPKSPWMPFPML  537

Query  269  VSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
             S +   +PP+ M+ +  +    RE K+TR E VK+LR + GD LL
Sbjct  538  FSAIENKVPPEDMKQVNVHYDLFRERKITRDEFVKKLRLVVGDTLL  583



>emb|CDP18551.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 100/278 (36%), Positives = 139/278 (50%), Gaps = 49/278 (18%)
 Frame = -2

Query  782  FSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKD--GSFGHGVYLCP  612
            F LF K V   KS  G+ N+++AWL +SK+   SI+++G   S+       +G GV+L P
Sbjct  5    FELFKKQVAITKSCRGDANVRYAWLPSSKETAASIMKYGLGFSLPTKLRPVYGIGVHLIP  64

Query  611  DHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKK  432
             +      N +  DENGVRH+++CRVI+G TELV PGS Q+HP+S++FD G+DD   P  
Sbjct  65   ANCTELSANYSDVDENGVRHMVFCRVIMGNTELVHPGSEQFHPSSEDFDSGMDDFQNPSH  124

Query  431  YIVWSTNINTHILPLYIISFTIS------------------TLNAHNLFGVQRNSVS---  315
            Y+VW+ N N+HI P Y ISF IS                  T   H +   Q N  S   
Sbjct  125  YVVWNMNANSHIYPEYAISFKISSDAEGVLAKTEGKIDLKGTSICHQVPEGQVNMDSSTT  184

Query  314  ------------------------SLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVK  207
                                    SL+ P SP + FP L+  +A  +P + M  + +   
Sbjct  185  DLASECNQVLNGRPPEKAGNQVSNSLRTPKSPWMPFPMLLDAIADEVPEKDMNVVRSNYD  244

Query  206  DHREGKMTRLEMVKRLRRLAGDELL-IKIVKAQRDMQI  96
            + R  KMTR + VK LR + GD LL   I   Q  MQ+
Sbjct  245  EFRNKKMTRDDFVKNLRMIVGDSLLRSTITSLQSKMQL  282



>ref|XP_008231814.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Prunus 
mume]
 ref|XP_008231815.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Prunus 
mume]
 ref|XP_008231816.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Prunus 
mume]
 ref|XP_008231817.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Prunus 
mume]
 ref|XP_008231818.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Prunus 
mume]
 ref|XP_008231819.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Prunus 
mume]
Length=608

 Score =   162 bits (411),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 155/311 (50%), Gaps = 69/311 (22%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-GNGNMQFAWLGASKK  696
            L GV     +E ++  + SS++M+ A+L+   LF K VE    F G+ N+++AWL +SK 
Sbjct  286  LKGVSTFDGVEVLDIYQCSSNLMQ-ARLE---LFQKQVEITKAFRGDANVRYAWLASSKG  341

Query  695  ELTSILQHGFDP---SMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILG  525
            EL++I+ +G      + NK   +G GV+L    F   C +    DENG RH+L+CRVI+G
Sbjct  342  ELSTIMMYGLGHCGLATNK-SIYGTGVHLTAASFSNTCASYCDVDENGARHMLFCRVIVG  400

Query  524  KTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHN  345
              EL+ PGS+Q+HP S++FD GVDDL  PK YIVW+ N+NTHI P +++SF +S+ +  +
Sbjct  401  NMELLHPGSKQFHPGSKDFDSGVDDLQDPKHYIVWNMNMNTHIYPEFVVSFKVSSKSEGH  460

Query  344  LFGVQRN------------------------SVSSLKKPNS-------------------  294
            L G +                             S  +PNS                   
Sbjct  461  LVGTENKLGVSGVATSCHGPQGLMQLESSAVDTGSENQPNSDSGKSHGSNGQMVSKSGRY  520

Query  293  -----------------PRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVK  165
                             P + FP L + +   +PP+ M+ I  +    R  K++R E VK
Sbjct  521  QGETTATGSTPERTPKSPWMPFPMLFAAIGNEVPPKDMEQINIHYDLFRAKKISRDEFVK  580

Query  164  RLRRLAGDELL  132
            +LR + GD LL
Sbjct  581  KLRLIVGDTLL  591



>ref|XP_001777080.1| predicted protein [Physcomitrella patens]
 gb|EDQ58073.1| predicted protein [Physcomitrella patens]
Length=253

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/203 (42%), Positives = 128/203 (63%), Gaps = 18/203 (9%)
 Frame = -2

Query  938  RLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAV  759
            RL+ +++G+ E++I+E+K + G+  V     I  I ++   +S    A+ ++F      V
Sbjct  18   RLVPLKKGDSEYEIVEKKFMHGIGRVASDTIITGIHRD---TSAGAAARQEAFVRQTALV  74

Query  758  EEKSGFGNGNMQFAWLGASKKELTSILQHGF-DPSMNKDGS-FGHGVYLCPDHFPLG---  594
            E+  G  N N++F W G SKK +  I  HGF  P  +K+GS +G GVYL    FPLG   
Sbjct  75   EKTRG--NANLRFGWHGTSKKAVEGIFLHGFGQPKTSKNGSTYGVGVYLACS-FPLGHLL  131

Query  593  -----CLNSAMAD--ENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPK  435
                 C ++  AD  ENG +HV+ C+VI G +E+V+PGS Q+HP+++ FD GVDD+  PK
Sbjct  132  NVVYMCCSALYADNDENGEQHVVLCQVIAGASEVVKPGSEQFHPSTEHFDTGVDDINSPK  191

Query  434  KYIVWSTNINTHILPLYIISFTI  366
            + IVWST++NTHILPLY++SF +
Sbjct  192  RLIVWSTHMNTHILPLYVVSFKL  214



>ref|XP_002276953.2| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Vitis 
vinifera]
Length=599

 Score =   160 bits (406),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 108/312 (35%), Positives = 161/312 (52%), Gaps = 59/312 (19%)
 Frame = -2

Query  905  HQIMERKLVSGLMGVGMQAAIES--IEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-GN  735
            H  ++   V  +   GM + I +  IE    SS+ M+ A+L+   LF K +E  S +  +
Sbjct  261  HGSLDFDTVRDMFTSGMNSLISADIIEVYRGSSASME-ARLE---LFQKQIEITSKYRAD  316

Query  734  GNMQFAWLGASKKELTSILQHGFD---PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADEN  564
             N+++AWL ASK+ L+SI+ +G     PS  K   +G GV+L   +F    +N    DEN
Sbjct  317  ANVKYAWLAASKEALSSIMMYGLGHCRPSKVKP-VYGIGVHLTAANFSYPSVNYCDVDEN  375

Query  563  GVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLY  384
            GV+H++ CRVI+G  ELV PGS Q HP+S+ FD GVDDL  PK YI+W+ N+NTHI P Y
Sbjct  376  GVQHIVLCRVIMGNMELVHPGSGQCHPSSENFDSGVDDLQNPKHYIIWNMNMNTHIYPEY  435

Query  383  IISFTIST-LNAHN-LFGVQRN--------------------------------------  324
            ++SF +S+ + A   L G + N                                      
Sbjct  436  VVSFKVSSRVGAEGYLIGNESNYDISGVTTCQGQSQGHSKLGLHPVGLGNDSHPTPSLGR  495

Query  323  --------SVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMV  168
                      S+L+ P SP + FP L + ++K +P + MQ + T  +  R  K++R + V
Sbjct  496  SLGKATTLGSSTLRVPKSPWMPFPMLFAAISKKVPLKDMQLVDTQYELFRRKKISRADFV  555

Query  167  KRLRRLAGDELL  132
            K+LR + GD LL
Sbjct  556  KKLRLIVGDTLL  567



>emb|CAN61759.1| hypothetical protein VITISV_006105 [Vitis vinifera]
Length=604

 Score =   160 bits (406),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 108/312 (35%), Positives = 161/312 (52%), Gaps = 59/312 (19%)
 Frame = -2

Query  905  HQIMERKLVSGLMGVGMQAAIES--IEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-GN  735
            H  ++   V  +   GM + I +  IE    SS+ M+ A+L+   LF K +E  S +  +
Sbjct  261  HGSLDFDTVRDMFTSGMNSLISADIIEVYRGSSASME-ARLE---LFQKQIEITSKYRAD  316

Query  734  GNMQFAWLGASKKELTSILQHGFD---PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADEN  564
             N+++AWL ASK+ L+SI+ +G     PS  K   +G GV+L   +F    +N    DEN
Sbjct  317  ANVKYAWLAASKEALSSIMMYGLGHCRPSKVKP-VYGIGVHLTAANFSYPSVNYCDVDEN  375

Query  563  GVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLY  384
            GV+H++ CRVI+G  ELV PGS Q HP+S+ FD GVDDL  PK YI+W+ N+NTHI P Y
Sbjct  376  GVQHIVLCRVIMGNMELVHPGSGQCHPSSENFDSGVDDLQNPKHYIIWNMNMNTHIYPEY  435

Query  383  IISFTIST-LNAHN-LFGVQRN--------------------------------------  324
            ++SF +S+ + A   L G + N                                      
Sbjct  436  VVSFKVSSRVGAEGYLIGNESNYDISGVTTCQGQSQGHSKLGLHPVGLXNDSHPTPSLGR  495

Query  323  --------SVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMV  168
                      S+L+ P SP + FP L + ++K +P + MQ + T  +  R  K++R + V
Sbjct  496  SLGKATTLGSSTLRVPKSPWMPFPMLFAAISKKVPLKDMQLVDTQYELFRRKKISRADFV  555

Query  167  KRLRRLAGDELL  132
            K+LR + GD LL
Sbjct  556  KKLRLIVGDTLL  567



>ref|XP_001757896.1| predicted protein [Physcomitrella patens]
 gb|EDQ77138.1| predicted protein [Physcomitrella patens]
Length=733

 Score =   161 bits (408),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 104/314 (33%), Positives = 167/314 (53%), Gaps = 41/314 (13%)
 Frame = -2

Query  926  VEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKS  747
            V EG  E++ +    + GL   G +  + +I ++   +S   +A+ Q+F    ++ E+  
Sbjct  261  VPEGTEEYENITSMFLKGLGKFGSETIVTNIYRD---TSSRGQARQQAFQKLVESTEKTR  317

Query  746  GFGNGNMQFAWLGASKKELTSILQHGF-DPSMNKDGS-FGHGVYLCPDHFPLGCLNSAMA  573
            G  + N++FAW G SK  ++ I  HGF  P   K+GS +G GVYL P+         A  
Sbjct  318  G--DANVRFAWHGTSKAGVSGIFLHGFGQPRTPKNGSAYGVGVYLAPEERSHVSAVYADN  375

Query  572  DENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHIL  393
            D++G +HV+  RV+LG +ELV+ GS Q+HP+S+++D GVDDLV PK+ IVWST++NTHIL
Sbjct  376  DDSGEQHVVLVRVVLGTSELVKQGSDQFHPSSEKYDTGVDDLVSPKRLIVWSTHMNTHIL  435

Query  392  PLYIISFTIST--------------------------LNAHNLFGVQRNSV----SSLKK  303
            PLY++SF +                            L A   F V  N +    SS + 
Sbjct  436  PLYVVSFKLPPLWHKMMSAFHGKKASTICRLASIKRHLTARKEFQVSENGMGTCSSSKQG  495

Query  302  PNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKI  123
            P SP I+FP L   L   L P  ++ +    ++ +  ++ R E+++ +R   G E L+  
Sbjct  496  PTSPAISFPDLFLLLTPLLHPNSLEYLRNSYQEFQAKRLPRSELIQHVRNEVGAERLLHA  555

Query  122  VK----AQRDMQIY  93
            +K    +Q +M++Y
Sbjct  556  IKLLQGSQINMKLY  569



>ref|XP_008790406.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
isoform X2 [Phoenix dactylifera]
Length=458

 Score =   159 bits (401),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/275 (32%), Positives = 144/275 (52%), Gaps = 35/275 (13%)
 Frame = -2

Query  920  EGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF  741
            +G+R  +++E+  + G+      A I SI K   S      ++L++F +  +    K+  
Sbjct  215  DGDRYRKLVEKLFLDGMRKFAPDAVITSIHKCSHSGP-WGNSRLKAFQMRIQMT--KANR  271

Query  740  GNGNMQFAWLGASKKELTSILQHGFDPSMNK---DGSFGHGVYLCPDHFPLGCLNSAMAD  570
            G+GN++F W   S ++  +++ HGF    N+    G++G G++L P H P      +  D
Sbjct  272  GDGNVKFGWYATSARDTAAVISHGFGQPNNQVFGSGAYGVGIHLSPPHSPYTSSLLSEED  331

Query  569  ENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILP  390
            +NG RH++ CR I+GK+E V  GS Q+HP+ +EFD GVDDL  PK YIVWST +N+HILP
Sbjct  332  DNGERHIMLCRAIMGKSEKVEAGSLQFHPSGEEFDSGVDDLANPKWYIVWSTYMNSHILP  391

Query  389  LYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYV  210
             Y++SF                   SL +             E+A  LP    Q +  + 
Sbjct  392  EYVVSF------------------KSLMRSQ-----------EMAGSLPSSRKQEMEIFY  422

Query  209  KDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
              ++ GKM++   +K LR + GD++L   ++  R+
Sbjct  423  NHYKAGKMSKDTFIKHLRSIVGDKILASTIRRIRE  457



>ref|XP_009400059.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=452

 Score =   158 bits (400),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 148/273 (54%), Gaps = 9/273 (3%)
 Frame = -2

Query  926  VEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKS  747
            + +G+R ++++E+  + G+        I S+ K    SS    ++L++F    +    K+
Sbjct  182  LSDGDRHYKVVEKLFLDGMRRFDPNVTITSVRKC-LHSSFRGNSRLEAFQTLIQTT--KA  238

Query  746  GFGNGNMQFAWLGASKKELTSILQHGFDPSMNKD-GSFGHGVYLCPDHFPLGCLNSAMA-  573
              G+ N++F W G +  +L  ++ HGF  + N   GS  HGV +          +S ++ 
Sbjct  239  ARGHENVRFGWYGTTASDLAVVIGHGFGRTNNSLLGSHAHGVGVHLSPPHSPHSSSTLSE  298

Query  572  -DENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
             D NG RH+L CR I+GK+E V  GS Q+HP+S EFD GVDDL  PK YIVWST++N HI
Sbjct  299  VDSNGDRHILLCRAIMGKSEKVEAGSLQYHPSSDEFDSGVDDLTTPKWYIVWSTHMNAHI  358

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LP YI+SF  S   +    G + +S       ++   +F  L +E+AK LP  +   +  
Sbjct  359  LPEYIVSFRSSCHQSQAGHGRRMSSRRRPSISST---SFSKLFAEIAKLLPSSMSAILGI  415

Query  215  YVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
                 REGK+++   ++ LR   GD+LLI  ++
Sbjct  416  KYNQFREGKISKESFIRYLRSTVGDKLLISTIR  448



>ref|XP_006849443.1| hypothetical protein AMTR_s00024p00059840 [Amborella trichopoda]
 gb|ERN11024.1| hypothetical protein AMTR_s00024p00059840 [Amborella trichopoda]
Length=733

 Score =   160 bits (405),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 103/325 (32%), Positives = 166/325 (51%), Gaps = 56/325 (17%)
 Frame = -2

Query  938  RLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAV  759
            +L+ ++ G  ++ +++   V+G       + I  I  N  +SS ++ A+LQSF    K +
Sbjct  408  KLVRLDRGCNDYDMVQNMFVAGFGMFLTASNIVGIYCNSPTSSSVQ-ARLQSFQ---KQI  463

Query  758  E-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMN---KDG-SFGHGVYLCPDHFPLG  594
            E  KS  GN N++ AW G+ K  ++ I+ HGF    +   ++G ++G G+YL P+     
Sbjct  464  EITKSYRGNANVRQAWHGSFKLGVSGIMLHGFGFGQSGKPRNGVAYGIGIYLSPEDCSYI  523

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
              N    DENGV+H++ CR+I+G  E V+PG+ Q+HP+S++FD GVDDL  PK YI+WST
Sbjct  524  SANYCDVDENGVQHMVLCRIIMGNMEQVQPGAEQFHPSSEKFDSGVDDLQNPKHYIIWST  583

Query  413  NINTHILPLYIISFTISTLNAHNLFG----------------------------------  336
            ++NTHI P Y++SF +   N    +G                                  
Sbjct  584  HMNTHIYPEYVVSFKVPP-NIQEYWGGLKGTWSPVGVPRVPLRDSQLKHEASSVDLARDG  642

Query  335  ------------VQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREG  192
                        +Q N   ++K P S  + FP L + + K + P     +  Y  D +  
Sbjct  643  QKSDILKGSEEKLQENVPKTVKMPTSAWMPFPVLFAAIEKNISPVDKDLLDRYYTDFKTK  702

Query  191  KMTRLEMVKRLRRLAGDELLIKIVK  117
            K+TR E++K+LR + GD+LLI  +K
Sbjct  703  KITREELIKKLRLVIGDKLLISTLK  727



>ref|XP_009388429.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Musa acuminata subsp. malaccensis]
Length=340

 Score =   155 bits (391),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/274 (32%), Positives = 155/274 (57%), Gaps = 11/274 (4%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            ++ V + + E  ++  +  S +  +    ++  + +  +S+   ++ + ++F    +AV 
Sbjct  57   MVRVSKDSEEFILLRHRFYSSIGSLVPHCSLVDLHRVLYSTPT-RRTRWEAFHRSLEAVA  115

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKD--GSFGHGVYLCPDHFPLGCLNS  582
            +K   GN N +FA+  ASK  +  I+  GFD S   +  G FG G+Y+ P+   +  + S
Sbjct  116  QKHD-GNANDKFAFAEASKDRIIQIVNDGFDVSGTPEDGGYFGLGLYVTPEPVAINSVMS  174

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            ++ D +G+RHV+ CRVILG+TE V  GS Q  P S +FD GVDD+ FP +Y+VW   +N+
Sbjct  175  SVVDRDGLRHVMLCRVILGRTEEVVRGSGQSQPGSVDFDSGVDDMKFPTRYVVWYPEVNS  234

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSI  222
             +LPLY++S  +   +     G+ +  +S   +P SP I+  +L+  L+K LP   M  I
Sbjct  235  RVLPLYVLSIKVDFRSR----GLHQEPIS---RPTSPWISIRNLICVLSKCLPRSTMCQI  287

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIV  120
                 +  E K +R ++V R+R++AGD++L+  +
Sbjct  288  KKIHCEFMERKFSRQQLVSRIRQVAGDKILLAAI  321



>ref|XP_010518915.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X2 [Tarenaya hassleriana]
Length=584

 Score =   158 bits (400),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 146/269 (54%), Gaps = 32/269 (12%)
 Frame = -2

Query  818  SSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPS--MNK  648
            SS  M +A+L+   LF K VE  +   GN N+++AWL A K+ L  I+ HG   S    +
Sbjct  297  SSCEMSRARLE---LFQKQVEITRKLRGNANVRYAWLPAKKELLPMIMMHGLRQSGAFIR  353

Query  647  DGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEF  468
               +G GV++   + P         DENGVRH++ CRVI+G  EL+     Q++   +E+
Sbjct  354  KSMYGVGVHVTAANCPYFSARYCDIDENGVRHMVLCRVIMGNMELLGGDKAQFYAGGEEY  413

Query  467  DCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNA-----------HNLFGV----  333
            D GVDD+  P+ YIVW+ N+NTHI P +++SF +ST NA           H+  GV    
Sbjct  414  DNGVDDVENPRHYIVWNMNMNTHIFPEFVVSFKLSTTNAEGNLMVATQSKHDNSGVTSEG  473

Query  332  -----------QRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKM  186
                       Q ++ SS  +P SP + FP+L + ++  +P + M  ITT  +  RE K+
Sbjct  474  PKPPAKLEVNGQDSAGSSTTRPKSPWMPFPTLFAAISNKIPEKDMDLITTDYQLLREKKL  533

Query  185  TRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
            TR + V++LR + GDELL   + A +  Q
Sbjct  534  TRADFVRKLRLIVGDELLKSTITALQGQQ  562



>ref|XP_009400060.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=451

 Score =   157 bits (396),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 149/273 (55%), Gaps = 10/273 (4%)
 Frame = -2

Query  926  VEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKS  747
            + +G+R ++++E+  + G+        I S+ K    SS    ++L++F    +    K+
Sbjct  182  LSDGDRHYKVVEKLFLDGMRRFDPNVTITSVRKC-LHSSFRGNSRLEAFQTLIQTT--KA  238

Query  746  GFGNGNMQFAWLGASKKELTSILQHGFDPSMNKD-GSFGHGVYLCPDHFPLGCLNSAMA-  573
              G+ N++F W G +  +L  ++ HGF  + N   GS  HGV +          +S ++ 
Sbjct  239  ARGHENVRFGWYGTTASDLAVVIGHGFGRTNNSLLGSHAHGVGVHLSPPHSPHSSSTLSE  298

Query  572  -DENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
             D NG RH+L CR I+GK+E V  GS Q+HP+S EFD GVDDL  PK YIVWST++N HI
Sbjct  299  VDSNGDRHILLCRAIMGKSEKVEAGSLQYHPSSDEFDSGVDDLTTPKWYIVWSTHMNAHI  358

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LP YI+SF  S   +          +SS ++P+    +F  L +E+AK LP  +   +  
Sbjct  359  LPEYIVSFRSSCHQSQG----HGRRMSSRRRPSISSTSFSKLFAEIAKLLPSSMSAILGI  414

Query  215  YVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
                 REGK+++   ++ LR   GD+LLI  ++
Sbjct  415  KYNQFREGKISKESFIRYLRSTVGDKLLISTIR  447



>ref|XP_010518916.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X3 [Tarenaya hassleriana]
Length=583

 Score =   158 bits (399),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 144/264 (55%), Gaps = 32/264 (12%)
 Frame = -2

Query  818  SSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPS--MNK  648
            SS  M +A+L+   LF K VE  +   GN N+++AWL A K+ L  I+ HG   S    +
Sbjct  297  SSCEMSRARLE---LFQKQVEITRKLRGNANVRYAWLPAKKELLPMIMMHGLRQSGAFIR  353

Query  647  DGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEF  468
               +G GV++   + P         DENGVRH++ CRVI+G  EL+     Q++   +E+
Sbjct  354  KSMYGVGVHVTAANCPYFSARYCDIDENGVRHMVLCRVIMGNMELLGGDKAQFYAGGEEY  413

Query  467  DCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNA-----------HNLFGV----  333
            D GVDD+  P+ YIVW+ N+NTHI P +++SF +ST NA           H+  GV    
Sbjct  414  DNGVDDVENPRHYIVWNMNMNTHIFPEFVVSFKLSTTNAEGNLMVATQSKHDNSGVTSEG  473

Query  332  -----------QRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKM  186
                       Q ++ SS  +P SP + FP+L + ++  +P + M  ITT  +  RE K+
Sbjct  474  PKPPAKLEVNGQDSAGSSTTRPKSPWMPFPTLFAAISNKIPEKDMDLITTDYQLLREKKL  533

Query  185  TRLEMVKRLRRLAGDELLIKIVKA  114
            TR + V++LR + GDELL   + A
Sbjct  534  TRADFVRKLRLIVGDELLKSTITA  557



>gb|KEH44337.1| inactive poly [ADP-ribose] polymerase RCD1 [Medicago truncatula]
Length=566

 Score =   157 bits (398),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 146/276 (53%), Gaps = 34/276 (12%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            L G G   +   +E   FSS++++        LF K  E  K+  G+ N+++AWL +SK 
Sbjct  282  LKGTGSFGSAYIVEIYPFSSTLVQ----SRLELFEKQAEIAKNCRGDANVRYAWLASSKG  337

Query  695  ELTSILQHGFD---PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILG  525
            EL ++++ G     PS  K    G GV+L     P    +    DENGVRH+++CRVI+G
Sbjct  338  ELPTMMKCGLGHCVPSAPK-CMHGIGVHLAAATCPFASASYCDVDENGVRHIVFCRVIMG  396

Query  524  KTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST-----  360
              EL+ PG+RQ+ P+S ++D GVDD+  P+ +IVW+ N+NTHI P +++SF +S+     
Sbjct  397  NMELLHPGTRQYRPSSSDYDSGVDDIHNPRNFIVWNMNMNTHIYPEFVVSFKVSSDAEGL  456

Query  359  ----LNAHNLFGVQRNS----------------VSSLKKPNSPRITFPSLVSELAKFLPP  240
                   +N+FGV   S                  S +   SPR  F +L + +   +P 
Sbjct  457  LLGCERKNNIFGVNSASYGPKILPRSESSRGIPTGSPEASTSPRFPFSTLFAAIINKVPA  516

Query  239  QIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
            + M+ I  Y    R  KMTR + +K LR + GD+LL
Sbjct  517  EDMKLIHMYHLHFRAKKMTRDDFLKNLRSVVGDDLL  552



>ref|XP_008785695.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
isoform X2 [Phoenix dactylifera]
Length=478

 Score =   157 bits (396),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 95/280 (34%), Positives = 151/280 (54%), Gaps = 38/280 (14%)
 Frame = -2

Query  929  GVE---EGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAV  759
            GVE   +G+R ++++E+  + G+        I SI K    S     ++L++F +  +  
Sbjct  229  GVEVLGDGDRYYKVVEKLFLDGMRKFAPDTVITSIHKC-LHSGPTGNSRLKAFQIQMQMT  287

Query  758  EEKSGFGNGNMQFAWLGASKKELTSILQHGF-DPSMNKDGS--FGHGVYLCPDHFPLGCL  588
              K+  G+ N++F W G   +++T++L HGF  P+    GS   G G++L P H P    
Sbjct  288  --KANRGDDNVKFGWYGTPARDVTAVLSHGFGQPNNGTLGSDACGVGIHLSPPHSPYTSS  345

Query  587  NSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNI  408
              + AD NG RH++ CR I+GK E V  GS Q+HP+SQ+FD GVDDL  PK YI+WST +
Sbjct  346  LLSEADVNGERHIILCRAIMGKPEKVEAGSLQFHPSSQDFDSGVDDLANPKWYILWSTRM  405

Query  407  NTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQ  228
            NTHILP Y++SF  S+  + ++ G    S+SS ++                        Q
Sbjct  406  NTHILPEYVVSFK-SSRKSQDIGG----SLSSSRR------------------------Q  436

Query  227  SITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            +I  +   ++ GKM++   +K LR + GD+LL   ++  R
Sbjct  437  AIEIFYDHYKAGKMSKGTFIKHLRSIVGDKLLASTIRRIR  476



>ref|XP_010518913.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010518914.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X1 [Tarenaya hassleriana]
Length=609

 Score =   157 bits (398),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 144/264 (55%), Gaps = 32/264 (12%)
 Frame = -2

Query  818  SSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPS--MNK  648
            SS  M +A+L+   LF K VE  +   GN N+++AWL A K+ L  I+ HG   S    +
Sbjct  297  SSCEMSRARLE---LFQKQVEITRKLRGNANVRYAWLPAKKELLPMIMMHGLRQSGAFIR  353

Query  647  DGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEF  468
               +G GV++   + P         DENGVRH++ CRVI+G  EL+     Q++   +E+
Sbjct  354  KSMYGVGVHVTAANCPYFSARYCDIDENGVRHMVLCRVIMGNMELLGGDKAQFYAGGEEY  413

Query  467  DCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNA-----------HNLFGV----  333
            D GVDD+  P+ YIVW+ N+NTHI P +++SF +ST NA           H+  GV    
Sbjct  414  DNGVDDVENPRHYIVWNMNMNTHIFPEFVVSFKLSTTNAEGNLMVATQSKHDNSGVTSEG  473

Query  332  -----------QRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKM  186
                       Q ++ SS  +P SP + FP+L + ++  +P + M  ITT  +  RE K+
Sbjct  474  PKPPAKLEVNGQDSAGSSTTRPKSPWMPFPTLFAAISNKIPEKDMDLITTDYQLLREKKL  533

Query  185  TRLEMVKRLRRLAGDELLIKIVKA  114
            TR + V++LR + GDELL   + A
Sbjct  534  TRADFVRKLRLIVGDELLKSTITA  557



>ref|XP_009341584.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X2 [Pyrus x bretschneideri]
Length=524

 Score =   156 bits (395),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 102/265 (38%), Positives = 152/265 (57%), Gaps = 32/265 (12%)
 Frame = -2

Query  908  EHQIMERKLVSGLMGVGMQA--AIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-G  738
            E + ++R  V  +   GM +   +E ++  + S ++M+ A+L+   LF K VE    F G
Sbjct  269  EKEKLDRDTVHKIFLKGMSSFDVVEVLDIYQCSITLMQ-ARLE---LFQKQVEITKTFRG  324

Query  737  NGNMQFAWLGASKKELTSILQHGFDPS---MNKDGSFGHGVYLCPDHFPLGCLNSAMADE  567
            + N+++AWL +SK EL++I+ +G   S   MNK   +G GV+L    F   C NS   DE
Sbjct  325  DANIRYAWLASSKGELSTIMMYGLGHSGLAMNK-SIYGTGVHLTEASFSNTCANSCDVDE  383

Query  566  NGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPL  387
            NG+RH+L+CRVI+G  EL+ PGS Q+HP+S++FD GVD L  PK YIVW+ N+NTHI P 
Sbjct  384  NGIRHMLFCRVIMGNMELLHPGSTQFHPSSKDFDSGVDGLEDPKHYIVWNMNMNTHIYPE  443

Query  386  YIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVK  207
            +++SF I +    +L G + N + +     S +               PQ   ++ T VK
Sbjct  444  FVVSFKIISNAEGHLIGTE-NKLGASGVATSCQ--------------GPQGSSAVDT-VK  487

Query  206  DHREGKMTRLEMVKRLRRLAGDELL  132
                 K+TR E VK+LR + GD LL
Sbjct  488  -----KITRDEFVKKLRLVVGDTLL  507



>gb|KDO50333.1| hypothetical protein CISIN_1g013071mg [Citrus sinensis]
Length=335

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 151/301 (50%), Gaps = 52/301 (17%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            LMG+   + ++ ++    SS+ +    L  F LF K +E      G+ N+++AWL  SK 
Sbjct  3    LMGMSPSSGVDILDVQRCSSASL----LARFELFQKQLEITNKCRGDANVRYAWLATSKG  58

Query  695  ELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
             L++++ +G     +     ++G GV+L     P    +    DENGVRH++ CRVI+G 
Sbjct  59   ALSTMIMYGLGHCGASTTKSTYGIGVHLAAASCPDTSASYTDVDENGVRHMVLCRVIMGN  118

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST------  360
             E + PG++Q+HP+S++FD GVDDL  P+ YIVW+ N+NTHI P +++SF  S+      
Sbjct  119  MEPLFPGTKQFHPSSEDFDSGVDDLQNPRHYIVWNMNMNTHIFPEFVVSFKFSSNVEGHL  178

Query  359  ------------------------LNAHNLFG---------------VQRNSVSSLKKPN  297
                                    L++   FG                   S S+ + P 
Sbjct  179  IRSESQRAISVLTTSSQGLQGHLRLDSSADFGDVSHPVSDSGGSQGKAPSTSSSTPRAPK  238

Query  296  SPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            SP + FP L + ++  + P++M+ I+   +  R  K+ R + VK+LR + GD+LL   + 
Sbjct  239  SPWMPFPMLFASISNKVSPKVMEQISNQYELFRAKKVNRDDFVKKLRLIVGDDLLRSTIT  298

Query  116  A  114
            A
Sbjct  299  A  299



>gb|KDO50334.1| hypothetical protein CISIN_1g013071mg [Citrus sinensis]
Length=324

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 151/301 (50%), Gaps = 52/301 (17%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            LMG+   + ++ ++    SS+ +    L  F LF K +E      G+ N+++AWL  SK 
Sbjct  3    LMGMSPSSGVDILDVQRCSSASL----LARFELFQKQLEITNKCRGDANVRYAWLATSKG  58

Query  695  ELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
             L++++ +G     +     ++G GV+L     P    +    DENGVRH++ CRVI+G 
Sbjct  59   ALSTMIMYGLGHCGASTTKSTYGIGVHLAAASCPDTSASYTDVDENGVRHMVLCRVIMGN  118

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST------  360
             E + PG++Q+HP+S++FD GVDDL  P+ YIVW+ N+NTHI P +++SF  S+      
Sbjct  119  MEPLFPGTKQFHPSSEDFDSGVDDLQNPRHYIVWNMNMNTHIFPEFVVSFKFSSNVEGHL  178

Query  359  ------------------------LNAHNLFG---------------VQRNSVSSLKKPN  297
                                    L++   FG                   S S+ + P 
Sbjct  179  IRSESQRAISVLTTSSQGLQGHLRLDSSADFGDVSHPVSDSGGSQGKAPSTSSSTPRAPK  238

Query  296  SPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            SP + FP L + ++  + P++M+ I+   +  R  K+ R + VK+LR + GD+LL   + 
Sbjct  239  SPWMPFPMLFASISNKVSPKVMEQISNQYELFRAKKVNRDDFVKKLRLIVGDDLLRSTIT  298

Query  116  A  114
            A
Sbjct  299  A  299



>gb|KEH44339.1| inactive poly [ADP-ribose] polymerase RCD1 [Medicago truncatula]
Length=569

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 146/279 (52%), Gaps = 37/279 (13%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            L G G   +   +E   FSS++++        LF K  E  K+  G+ N+++AWL +SK 
Sbjct  282  LKGTGSFGSAYIVEIYPFSSTLVQ----SRLELFEKQAEIAKNCRGDANVRYAWLASSKG  337

Query  695  ELTSILQHGFD---PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILG  525
            EL ++++ G     PS  K    G GV+L     P    +    DENGVRH+++CRVI+G
Sbjct  338  ELPTMMKCGLGHCVPSAPK-CMHGIGVHLAAATCPFASASYCDVDENGVRHIVFCRVIMG  396

Query  524  KTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST-----  360
              EL+ PG+RQ+ P+S ++D GVDD+  P+ +IVW+ N+NTHI P +++SF +S+     
Sbjct  397  NMELLHPGTRQYRPSSSDYDSGVDDIHNPRNFIVWNMNMNTHIYPEFVVSFKVSSDAEGL  456

Query  359  ----LNAHNLFGVQRNS-------------------VSSLKKPNSPRITFPSLVSELAKF  249
                   +N+FGV   S                     S +   SPR  F +L + +   
Sbjct  457  LLGCERKNNIFGVNSASYGPKILPRSESSRVSTGIPTGSPEASTSPRFPFSTLFAAIINK  516

Query  248  LPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
            +P + M+ I  Y    R  KMTR + +K LR + GD+LL
Sbjct  517  VPAEDMKLIHMYHLHFRAKKMTRDDFLKNLRSVVGDDLL  555



>gb|KHN48060.1| Putative inactive poly [ADP-ribose] polymerase SRO2 [Glycine 
soja]
Length=261

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 131/234 (56%), Gaps = 16/234 (7%)
 Frame = -2

Query  884  LVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFGNGNMQFAWLGA  705
             + G+  VG      +I KN  S SV ++A+  SF +F+KAV  KSG G+ N+ +AW G+
Sbjct  30   FLKGMGFVGHATDAMAIYKNMLSFSVARQARWVSFKIFSKAVAIKSG-GDANIGYAWYGS  88

Query  704  SKKELTSILQHGFD-----PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYC  540
            S  +L  I+  GF         + D   G G+ L   +F L      +ADE+G RHVL C
Sbjct  89   SLDDLLEIVSGGFHGCKKHDDNDDDECHGIGIPLFAANFSLDSAMCTVADEHGFRHVLLC  148

Query  539  RVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST  360
            +VILGK E V  GS+Q  P+S+++D GVDD+  P+++ +W+  +NTHI P YII F  + 
Sbjct  149  KVILGKVEAVHAGSKQSQPSSKQYDTGVDDISAPRRHTIWTAYLNTHIHPNYIICFKYNN  208

Query  359  LNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHR  198
                    ++   +    KP SP ++FP+L++ ++  L P  M  +   +KD+R
Sbjct  209  Y-------IKDPEMHGALKPQSPYVSFPNLLARVSNHLKPAQMSML---LKDYR  252



>ref|XP_010939314.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
isoform X2 [Elaeis guineensis]
Length=462

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 93/283 (33%), Positives = 148/283 (52%), Gaps = 38/283 (13%)
 Frame = -2

Query  938  RLIGVE---EGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFA  768
            R  GVE   +G+R ++++E+  + G+     +  I SI K    SS    ++L++F +  
Sbjct  210  RWTGVEVLGDGDRYYKVVEKLFLDGMRKFAPETVITSIHKC-LHSSPSGNSRLKAFQIQM  268

Query  767  KAVEEKSGFGNGNMQFAWLGASKKELTSILQHGF-DPSMNKDGS--FGHGVYLCPDHFPL  597
            +    K+  G+ N++F W G S +++ +++ HGF  P+ +  GS   G G++L P H P 
Sbjct  269  QMT--KANRGDDNVKFGWYGTSARDVAAVISHGFGQPNNSTLGSDACGVGIHLSPPHSPF  326

Query  596  GCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWS  417
                 +  D NG RHV+ CRVI+G++E V  GS Q+HP+S++FD GVDDL  PK YI+WS
Sbjct  327  ASSLLSEVDANGERHVILCRVIMGRSEKVEAGSLQFHPSSEDFDSGVDDLENPKWYILWS  386

Query  416  TNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQ  237
            T +NT ILP Y++SF  S  +                              ++ + L   
Sbjct  387  TCMNTRILPEYVVSFKSSKQS-----------------------------QDMGRSLSSS  417

Query  236  IMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
              Q I      ++ GKM++   +K LR  AGD+LL  I++  R
Sbjct  418  QRQDIEISYDHYKAGKMSKDTFIKHLRSTAGDKLLASIIRRIR  460



>ref|XP_006438378.1| hypothetical protein CICLE_v10032827mg [Citrus clementina]
 gb|ESR51618.1| hypothetical protein CICLE_v10032827mg [Citrus clementina]
Length=191

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 118/192 (61%), Gaps = 9/192 (5%)
 Frame = -2

Query  908  EHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFGNGN  729
             H ++++  +SG+  +     I ++ KN   SS++ +A+L SF +FA AV +K G GN N
Sbjct  2    NHYLVKKCFLSGMGPLAADTRIVALHKNS-CSSLIARARLDSFKIFANAVAKKCG-GNAN  59

Query  728  MQFAWLGASKKELTSILQHGFDPSMNKDGS------FGHGVYLCPDHFPLGCLNSAMADE  567
            ++ AW GAS+ E+  I+ HGF      DG+       G GV L P +  +  + S+ +DE
Sbjct  60   IRPAWFGASRDEINEIVCHGFS-QCGGDGARKLGPMHGFGVQLFPINSSINGVLSSESDE  118

Query  566  NGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPL  387
             G+RH+L CRVILGK E++  GS+Q+HPTS EFD GVD+L  P +Y VWS  +N+HI   
Sbjct  119  KGLRHILLCRVILGKMEVIPRGSKQFHPTSLEFDSGVDNLCKPSRYTVWSCYMNSHIFVD  178

Query  386  YIISFTISTLNA  351
            YI+SF +   + 
Sbjct  179  YIVSFRVVCFSG  190



>ref|XP_006585196.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2-like 
isoform X1 [Glycine max]
Length=288

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/234 (36%), Positives = 131/234 (56%), Gaps = 16/234 (7%)
 Frame = -2

Query  884  LVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGFGNGNMQFAWLGA  705
             + G+  VG      +I KN  S SV ++A+  SF +F+KAV  KSG G+ N+ +AW G+
Sbjct  30   FLKGMGFVGHATDAMAIYKNMLSFSVARQARWVSFKIFSKAVAIKSG-GDANIGYAWYGS  88

Query  704  SKKELTSILQHGFD-----PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYC  540
            S  +L  I+  GF         + D   G G+ L   +F L      +ADE+G RHVL C
Sbjct  89   SLDDLLEIVSGGFHGCKKHDDNDDDECHGIGIPLFAANFSLDSAMCTVADEHGFRHVLLC  148

Query  539  RVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST  360
            +VILGK E V  GS+Q  P+S+++D GVDD+  P+++ +W+  +NTHI P YII F  + 
Sbjct  149  KVILGKVEAVHAGSKQSQPSSKQYDTGVDDISAPRRHTIWTAYLNTHIHPNYIICFKYNN  208

Query  359  LNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHR  198
                    ++   +    KP SP ++FP+L++ ++  L P  M  +   +KD+R
Sbjct  209  Y-------IKDPEMHGALKPQSPYVSFPNLLARVSNHLKPAQMSML---LKDYR  252



>ref|XP_006432737.1| hypothetical protein CICLE_v10001062mg [Citrus clementina]
 gb|ESR45977.1| hypothetical protein CICLE_v10001062mg [Citrus clementina]
Length=435

 Score =   154 bits (388),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 151/301 (50%), Gaps = 52/301 (17%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            LMG+   + ++ ++    SS+ +    L  F LF K +E      G+ N+++AWL  SK 
Sbjct  135  LMGMSPSSGVDILDVQRCSSASL----LARFELFQKQLEITNKCRGDANVRYAWLATSKG  190

Query  695  ELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
             L++++ +G     +     ++G GV+L     P    +    DENGVRH++ CRVI+G 
Sbjct  191  ALSTMIMYGLGHCGASTTKSTYGIGVHLAAASCPDTSASYTDVDENGVRHMVLCRVIMGN  250

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST------  360
             E + PG++Q+HP+S++FD GVDDL  P+ YIVW+ N+NTHI P +++SF  S+      
Sbjct  251  MEPLFPGTKQFHPSSEDFDSGVDDLQNPRHYIVWNMNMNTHIFPEFVVSFKFSSNVEGHL  310

Query  359  ------------------------LNAHNLFG---------------VQRNSVSSLKKPN  297
                                    L++   FG                   S S+ + P 
Sbjct  311  IRSESQRAISVLTTSSQGLQGHLRLDSSADFGDVSHPVSDSGGSQGKAPSTSSSTPRAPK  370

Query  296  SPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            SP + FP L + ++  + P++M+ I+   +  R  K+ R + VK+LR + GD+LL   + 
Sbjct  371  SPWMPFPMLFASISNKVSPKVMEQISNQYELFRAKKVNRDDFVKKLRLIVGDDLLRSTIT  430

Query  116  A  114
            A
Sbjct  431  A  431



>ref|XP_006432739.1| hypothetical protein CICLE_v10001062mg [Citrus clementina]
 gb|ESR45979.1| hypothetical protein CICLE_v10001062mg [Citrus clementina]
Length=436

 Score =   154 bits (388),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 151/301 (50%), Gaps = 52/301 (17%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            LMG+   + ++ ++    SS+ +    L  F LF K +E      G+ N+++AWL  SK 
Sbjct  135  LMGMSPSSGVDILDVQRCSSASL----LARFELFQKQLEITNKCRGDANVRYAWLATSKG  190

Query  695  ELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
             L++++ +G     +     ++G GV+L     P    +    DENGVRH++ CRVI+G 
Sbjct  191  ALSTMIMYGLGHCGASTTKSTYGIGVHLAAASCPDTSASYTDVDENGVRHMVLCRVIMGN  250

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST------  360
             E + PG++Q+HP+S++FD GVDDL  P+ YIVW+ N+NTHI P +++SF  S+      
Sbjct  251  MEPLFPGTKQFHPSSEDFDSGVDDLQNPRHYIVWNMNMNTHIFPEFVVSFKFSSNVEGHL  310

Query  359  ------------------------LNAHNLFG---------------VQRNSVSSLKKPN  297
                                    L++   FG                   S S+ + P 
Sbjct  311  IRSESQRAISVLTTSSQGLQGHLRLDSSADFGDVSHPVSDSGGSQGKAPSTSSSTPRAPK  370

Query  296  SPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            SP + FP L + ++  + P++M+ I+   +  R  K+ R + VK+LR + GD+LL   + 
Sbjct  371  SPWMPFPMLFASISNKVSPKVMEQISNQYELFRAKKVNRDDFVKKLRLIVGDDLLRSTIT  430

Query  116  A  114
            A
Sbjct  431  A  431



>gb|KDO50332.1| hypothetical protein CISIN_1g013071mg [Citrus sinensis]
Length=450

 Score =   154 bits (388),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 151/301 (50%), Gaps = 52/301 (17%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            LMG+   + ++ ++    SS+ +    L  F LF K +E      G+ N+++AWL  SK 
Sbjct  118  LMGMSPSSGVDILDVQRCSSASL----LARFELFQKQLEITNKCRGDANVRYAWLATSKG  173

Query  695  ELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
             L++++ +G     +     ++G GV+L     P    +    DENGVRH++ CRVI+G 
Sbjct  174  ALSTMIMYGLGHCGASTTKSTYGIGVHLAAASCPDTSASYTDVDENGVRHMVLCRVIMGN  233

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST------  360
             E + PG++Q+HP+S++FD GVDDL  P+ YIVW+ N+NTHI P +++SF  S+      
Sbjct  234  MEPLFPGTKQFHPSSEDFDSGVDDLQNPRHYIVWNMNMNTHIFPEFVVSFKFSSNVEGHL  293

Query  359  ------------------------LNAHNLFG---------------VQRNSVSSLKKPN  297
                                    L++   FG                   S S+ + P 
Sbjct  294  IRSESQRAISVLTTSSQGLQGHLRLDSSADFGDVSHPVSDSGGSQGKAPSTSSSTPRAPK  353

Query  296  SPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            SP + FP L + ++  + P++M+ I+   +  R  K+ R + VK+LR + GD+LL   + 
Sbjct  354  SPWMPFPMLFASISNKVSPKVMEQISNQYELFRAKKVNRDDFVKKLRLIVGDDLLRSTIT  413

Query  116  A  114
            A
Sbjct  414  A  414



>ref|XP_006432738.1| hypothetical protein CICLE_v10001062mg [Citrus clementina]
 gb|ESR45978.1| hypothetical protein CICLE_v10001062mg [Citrus clementina]
Length=467

 Score =   153 bits (387),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 151/301 (50%), Gaps = 52/301 (17%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            LMG+   + ++ ++    SS+ +    L  F LF K +E      G+ N+++AWL  SK 
Sbjct  135  LMGMSPSSGVDILDVQRCSSASL----LARFELFQKQLEITNKCRGDANVRYAWLATSKG  190

Query  695  ELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
             L++++ +G     +     ++G GV+L     P    +    DENGVRH++ CRVI+G 
Sbjct  191  ALSTMIMYGLGHCGASTTKSTYGIGVHLAAASCPDTSASYTDVDENGVRHMVLCRVIMGN  250

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST------  360
             E + PG++Q+HP+S++FD GVDDL  P+ YIVW+ N+NTHI P +++SF  S+      
Sbjct  251  MEPLFPGTKQFHPSSEDFDSGVDDLQNPRHYIVWNMNMNTHIFPEFVVSFKFSSNVEGHL  310

Query  359  ------------------------LNAHNLFG---------------VQRNSVSSLKKPN  297
                                    L++   FG                   S S+ + P 
Sbjct  311  IRSESQRAISVLTTSSQGLQGHLRLDSSADFGDVSHPVSDSGGSQGKAPSTSSSTPRAPK  370

Query  296  SPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            SP + FP L + ++  + P++M+ I+   +  R  K+ R + VK+LR + GD+LL   + 
Sbjct  371  SPWMPFPMLFASISNKVSPKVMEQISNQYELFRAKKVNRDDFVKKLRLIVGDDLLRSTIT  430

Query  116  A  114
            A
Sbjct  431  A  431



>ref|XP_010266789.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Nelumbo nucifera]
Length=506

 Score =   154 bits (388),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 151/277 (55%), Gaps = 9/277 (3%)
 Frame = -2

Query  926  VEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EK  750
            +++G+  + ++ +  +SGL  +   A I +I    +    M  +      +F K +E  K
Sbjct  234  LDDGDENYSLINKVFLSGLKKIDPDATITAI----YRCLHMGPSGGARLEVFRKQMEMTK  289

Query  749  SGFGNGNMQFAWLGASKKELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
               G  N++ AW G S K +  I+ HGF     +   GS+G G+YL P + P      + 
Sbjct  290  VARGTSNVRLAWHGTSAKGVAGIVAHGFGLPNKLCGFGSYGVGIYLSPPYSPQTSALVSE  349

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
            AD +G RHV+ CRVILG  E +  GSRQ+HP+S+EFD GVDDL  PK YIVWST++N +I
Sbjct  350  ADNDGERHVVLCRVILGNVEKIEAGSRQFHPSSEEFDTGVDDLRNPKWYIVWSTHMNRYI  409

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LP  I+S+  S+       G+ R S S L++  +  ++F  L SE+   L    ++ +  
Sbjct  410  LPECIVSYK-SSHRPEGPEGLFRGS-SVLRRIPASSMSFTRLFSEMKSSLSTITIKELED  467

Query  215  YVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRD  105
                ++ GK+ +   +K+LR   GDE+L+  V+  +D
Sbjct  468  LYNLYKVGKVAKDVFIKQLRLHVGDEILLSAVQKVQD  504



>ref|XP_002309510.2| hypothetical protein POPTR_0006s24760g [Populus trichocarpa]
 gb|EEE93033.2| hypothetical protein POPTR_0006s24760g [Populus trichocarpa]
Length=376

 Score =   151 bits (382),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 95/290 (33%), Positives = 154/290 (53%), Gaps = 14/290 (5%)
 Frame = -2

Query  956  HEQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFS  777
            H  RN  +I + +   E+  M+ + + G+        + ++ KN    + +K A+  +F 
Sbjct  38   HFARNG-MIKIGKETEEYVSMKTQFLMGMKQYANDTEVIALHKN-MGFTPLKLARFFAFK  95

Query  776  LFAKAVEEKSG-FGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFP  600
             F K + +K G  G+  +   W GASK+E+  I+ +GF  S     S G GVYL P  F 
Sbjct  96   SFEKVILQKRGALGDAKVDHGWFGASKEEIIQIISYGF--SRCNGQSHGLGVYLSPFEFL  153

Query  599  LGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVW  420
            L  +   +ADEN +R++L C + +G  E++  GS+Q +P+S EFD GVD+L  P++ IVW
Sbjct  154  LDAVKFTIADENDMRYMLLCHLTMGNMEVIPAGSKQVYPSSVEFDTGVDNLEAPRRLIVW  213

Query  419  STNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLK----KPNSPRITFPSLVSELAK  252
            S  +N+HI P YII+F          F + R+ +S L       +   +TFP+L   L K
Sbjct  214  SAFMNSHICPAYIITFKAPFFG----FVLSRDQISELPGITLSFHGSALTFPALFPILVK  269

Query  251  FLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAG-DELLIKIVKAQRD  105
             + P     I   + D ++ K+T+ +M++  RR+ G D  LI I+K+  D
Sbjct  270  VIGPAKAGLIYKSLVDRKKCKITQEQMIQTTRRIIGNDRRLIAIIKSSID  319



>ref|XP_006651191.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Oryza 
brachyantha]
Length=448

 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/285 (31%), Positives = 152/285 (53%), Gaps = 17/285 (6%)
 Frame = -2

Query  938  RLIGVEEGNREHQIMERKLVSGLMG--VGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            + + ++E  R ++++E+  +S +         AI ++ K      V    + ++F+L  +
Sbjct  171  KAVRLDETERFYKVVEKLFLSRMASFEAARGVAITAVHK------VALGPRARAFNLQGQ  224

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPS---MNKDGSFGHGVYLCPDHFPLG  594
             +    G G  N +FAW GA  +++T+  +HGF  +   +    + G G++L P   P  
Sbjct  225  LLAAARGSGGSNAKFAWYGAPAEDVTAAGEHGFGRTNGWLLGGRAHGDGIHLSPPQHPYA  284

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
                   DE+G  H++ CRV++G+ E V  GS Q+HP+S  +D  VD++  PK YIVWS 
Sbjct  285  SAMLTKPDEDGEAHIVLCRVLMGRPEAVPAGSSQFHPSSDYYDSAVDNMENPKWYIVWSA  344

Query  413  NINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRIT---FPSLVSELAKFLP  243
            ++NT ILP Y++SF   +L           S S LKKP+SP +T   FP L++E+ +F+P
Sbjct  345  DMNTRILPEYVVSFKYPSLPQME---GSLGSASKLKKPSSPAVTRDMFPMLLTEIQRFVP  401

Query  242  PQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
                Q++       ++G+M + + ++ LR   GD++L  + K  R
Sbjct  402  SPKWQNLQRTYNCFKKGQMKKDQFIRFLRSTIGDKVLTTVAKKLR  446



>ref|XP_010055259.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1 [Eucalyptus 
grandis]
 ref|XP_010055260.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1 [Eucalyptus 
grandis]
Length=512

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 138/283 (49%), Gaps = 40/283 (14%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-GNGNMQFAWLGASKK  696
            +MG+G     + IE N   S  M+        LF K VE      G+ N+++AWL A+K 
Sbjct  206  VMGMGFPMCSDIIEINRCFSHSMQS----QLELFEKQVEITRNLRGDPNVKYAWLAANKD  261

Query  695  ELTSILQHGFDPS-MNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKT  519
             + SI+ HG       +  ++G GV+L               DENGV+HV+ CRVILG  
Sbjct  262  AVHSIMMHGPGAGGFKRVCTYGSGVHLTSVDNTHISAKFCDDDENGVKHVVLCRVILGTV  321

Query  518  ELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLF  339
            ELV PGSRQ+ P+S  FD GVDDL  P+ YIVW+ N+NTHI P ++ISF I      +L 
Sbjct  322  ELVHPGSRQFCPSSSNFDSGVDDLQNPQYYIVWNMNMNTHIFPEFVISFKIRASAGGHLA  381

Query  338  GVQRNSV----------------------------------SSLKKPNSPRITFPSLVSE  261
            G    +V                                  SS K P SP + FP L   
Sbjct  382  GKNCRNVLLETTVSKGPVDQAALRQSPVEPRLQGKDNTLGSSSAKTPKSPWMPFPLLFDA  441

Query  260  LAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
            ++K +  + M +I    K  R  +++R + +KRLR + GDELL
Sbjct  442  ISKEVAAEDMNTIDANYKLFRTKRISRNDFIKRLRSIVGDELL  484



>gb|KCW71724.1| hypothetical protein EUGRSUZ_E00230 [Eucalyptus grandis]
Length=573

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/283 (35%), Positives = 138/283 (49%), Gaps = 40/283 (14%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-GNGNMQFAWLGASKK  696
            +MG+G     + IE N   S  M+        LF K VE      G+ N+++AWL A+K 
Sbjct  261  VMGMGFPMCSDIIEINRCFSHSMQS----QLELFEKQVEITRNLRGDPNVKYAWLAANKD  316

Query  695  ELTSILQHGFDPS-MNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKT  519
             + SI+ HG       +  ++G GV+L               DENGV+HV+ CRVILG  
Sbjct  317  AVHSIMMHGPGAGGFKRVCTYGSGVHLTSVDNTHISAKFCDDDENGVKHVVLCRVILGTV  376

Query  518  ELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLF  339
            ELV PGSRQ+ P+S  FD GVDDL  P+ YIVW+ N+NTHI P ++ISF I      +L 
Sbjct  377  ELVHPGSRQFCPSSSNFDSGVDDLQNPQYYIVWNMNMNTHIFPEFVISFKIRASAGGHLA  436

Query  338  GVQRNSV----------------------------------SSLKKPNSPRITFPSLVSE  261
            G    +V                                  SS K P SP + FP L   
Sbjct  437  GKNCRNVLLETTVSKGPVDQAALRQSPVEPRLQGKDNTLGSSSAKTPKSPWMPFPLLFDA  496

Query  260  LAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
            ++K +  + M +I    K  R  +++R + +KRLR + GDELL
Sbjct  497  ISKEVAAEDMNTIDANYKLFRTKRISRNDFIKRLRSIVGDELL  539



>ref|XP_006471515.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X2 [Citrus sinensis]
Length=585

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 151/301 (50%), Gaps = 52/301 (17%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            LMG+   + ++ ++    SS+ +    L  F LF K +E      G+ N+++AWL  SK 
Sbjct  285  LMGMSPSSGVDILDVQRCSSASL----LARFELFQKQLEITNKCRGDANVRYAWLATSKG  340

Query  695  ELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
             L++++ +G     +     ++G GV+L     P    +    DENGVRH++ CRVI+G 
Sbjct  341  ALSTMIMYGLGHCGASTTKSTYGIGVHLAAASCPDTSASYTDVDENGVRHMVLCRVIMGN  400

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST------  360
             E + PG++Q+HP+S++FD GVDDL  P+ YIVW+ N+NTHI P +++SF  S+      
Sbjct  401  MEPLFPGTKQFHPSSEDFDSGVDDLQNPRHYIVWNMNMNTHIFPEFVVSFKFSSNVEGHL  460

Query  359  ------------------------LNAHNLFG---------------VQRNSVSSLKKPN  297
                                    L++   FG                   S S+ + P 
Sbjct  461  IRSESQRAISVLTTSSQGLQGHLRLDSSADFGDVSHPVSDSGGSQGKAPSTSSSTPRAPK  520

Query  296  SPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            SP + FP L + ++  + P++M+ I+   +  R  K+ R + VK+LR + GD+LL   + 
Sbjct  521  SPWMPFPMLFASISNKVSPKVMEQISNQYELFRAKKVNRDDFVKKLRLIVGDDLLRSTIT  580

Query  116  A  114
            A
Sbjct  581  A  581



>ref|XP_007158260.1| hypothetical protein PHAVU_002G137600g [Phaseolus vulgaris]
 ref|XP_007158261.1| hypothetical protein PHAVU_002G137600g [Phaseolus vulgaris]
 gb|ESW30254.1| hypothetical protein PHAVU_002G137600g [Phaseolus vulgaris]
 gb|ESW30255.1| hypothetical protein PHAVU_002G137600g [Phaseolus vulgaris]
Length=558

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/252 (35%), Positives = 141/252 (56%), Gaps = 32/252 (13%)
 Frame = -2

Query  797  AKLQS-FSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDP---SMNKDGSFG  633
            A +Q+   LF K V+  K   GN N+Q+AWL ++K EL +++++G      S +K G +G
Sbjct  291  ASMQARLDLFLKQVDITKKCHGNANVQYAWLASTKGELYTMMEYGLGHCRLSASK-GIYG  349

Query  632  HGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVD  453
             GV+L    +P         DENGVRH++ CRVI+G  E++ PG+ Q+ P+S E+D GVD
Sbjct  350  TGVHLAAVTYPDTSARYCDVDENGVRHLVLCRVIMGNMEILHPGTGQFQPSSCEYDNGVD  409

Query  452  DLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLF-GVQR-NSVSSL----------  309
            D+  P+ Y+VW+ N+NTHI P +++SF +   +A  LF G +R N+VS +          
Sbjct  410  DIQCPRYYVVWNMNMNTHIYPEFVVSFKVP-FDAEALFCGSERKNTVSGVMTACHGPQGL  468

Query  308  -------------KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMV  168
                         + P SP + FP L + +   +PP  M+ +  + +  R  +++R + V
Sbjct  469  LNSCAVVKGTTAARGPTSPWMPFPLLFAAIRNKVPPNDMELVRRHYEQFRSKQISREDFV  528

Query  167  KRLRRLAGDELL  132
            K LR + GD LL
Sbjct  529  KNLRLIVGDALL  540



>ref|XP_006471514.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X1 [Citrus sinensis]
Length=617

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/301 (30%), Positives = 151/301 (50%), Gaps = 52/301 (17%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            LMG+   + ++ ++    SS+ +    L  F LF K +E      G+ N+++AWL  SK 
Sbjct  285  LMGMSPSSGVDILDVQRCSSASL----LARFELFQKQLEITNKCRGDANVRYAWLATSKG  340

Query  695  ELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
             L++++ +G     +     ++G GV+L     P    +    DENGVRH++ CRVI+G 
Sbjct  341  ALSTMIMYGLGHCGASTTKSTYGIGVHLAAASCPDTSASYTDVDENGVRHMVLCRVIMGN  400

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST------  360
             E + PG++Q+HP+S++FD GVDDL  P+ YIVW+ N+NTHI P +++SF  S+      
Sbjct  401  MEPLFPGTKQFHPSSEDFDSGVDDLQNPRHYIVWNMNMNTHIFPEFVVSFKFSSNVEGHL  460

Query  359  ------------------------LNAHNLFG---------------VQRNSVSSLKKPN  297
                                    L++   FG                   S S+ + P 
Sbjct  461  IRSESQRAISVLTTSSQGLQGHLRLDSSADFGDVSHPVSDSGGSQGKAPSTSSSTPRAPK  520

Query  296  SPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            SP + FP L + ++  + P++M+ I+   +  R  K+ R + VK+LR + GD+LL   + 
Sbjct  521  SPWMPFPMLFASISNKVSPKVMEQISNQYELFRAKKVNRDDFVKKLRLIVGDDLLRSTIT  580

Query  116  A  114
            A
Sbjct  581  A  581



>gb|KCW66709.1| hypothetical protein EUGRSUZ_F00472 [Eucalyptus grandis]
Length=464

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 92/282 (33%), Positives = 145/282 (51%), Gaps = 27/282 (10%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N+RL+G  EG+  +  ++   +SGL  V   A I +I +   ++ + +      + +F +
Sbjct  204  NARLLG--EGDTAYSQIKNFFLSGLKNVDPDATITAIHQCTRTTPIER----ARYEVFMR  257

Query  764  AVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMN--KDGSFGHGVYLCPDHFPLG  594
             V+  ++  G  N  +AW G S K L+ IL HGF       K  S+G GV+  P   P  
Sbjct  258  QVDITRTARGTSNTVYAWHGTSAKGLSIILAHGFGVPFEVPKPESYGVGVHFSPVGLPQL  317

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
            C   + AD+NG +HV+ CRVILG  E V  GS Q HP++ +FD G DD   PK Y+VW +
Sbjct  318  CAMDSEADDNGEKHVVLCRVILGSAEKVDLGSNQSHPSNVDFDTGADDPNNPKHYVVWFS  377

Query  413  NINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQI  234
            ++NTH+LP  ++SF  S            N+V  +K       +   L+S++   LPP  
Sbjct  378  SVNTHVLPECVVSFKAS------------NNVKCVKN------SICELISKMKSALPPAK  419

Query  233  MQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            +Q +       R GK+ +   VK+ R + GD+ L+  ++  R
Sbjct  420  VQEVENLYSVFRAGKLVKDSFVKQFRSITGDDALLSAIREIR  461



>ref|XP_006853728.1| hypothetical protein AMTR_s00056p00165600 [Amborella trichopoda]
 gb|ERN15195.1| hypothetical protein AMTR_s00056p00165600 [Amborella trichopoda]
Length=732

 Score =   154 bits (388),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 173/319 (54%), Gaps = 45/319 (14%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMG--VGMQAAIESIEKNEFSSSVMKKAKLQSFSLFA  768
            ++L+ + +GN+ +  ++R  +SG     +GM  ++++I    ++S+V   A+LQ+F    
Sbjct  408  TKLVKLNDGNKAYVSIKRLFLSGFQKEMIGM-ISVDAIYGCSYASAV-GLARLQTFQRHI  465

Query  767  KAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGS--FGHGVYLCPDHFPLG  594
            +    K+ F + N+ +AW G S K + SI+ HGF   +   GS  +G G+YL P+ +P  
Sbjct  466  EMT--KNSFVSANVMYAWHGTSAKGVESIILHGFGRPVAGYGSDAYGIGIYLTPEGYPHL  523

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
             + SA  D+NG+ H++ CRVI+G  E V+ GS Q+HP + +FD GV+DL   ++ I+WST
Sbjct  524  SVLSAEPDDNGLHHLVLCRVIMGNMEQVQCGSAQFHPRNVDFDSGVEDLCNRRRSIIWST  583

Query  413  NINTHILPLYIISFTI---------STLNAHNLFGV-QRNSVSSLKKPNSPR--------  288
            ++NTHILP+Y++S  +         +  +     GV ++N  +S   P + R        
Sbjct  584  HMNTHILPVYVVSIKVPDPLKEVWRNEKSVQEACGVSEKNRPASRFTPQTARSDKPSHML  643

Query  287  -------------------ITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVK  165
                               ++FP+L S + K+L P  + ++     + + GK+ +  ++ 
Sbjct  644  TEANGQSPKTSPLLGGTSKMSFPTLFSVIGKYLSPSTVGTLEHLYNEFKAGKIGKDTLIG  703

Query  164  RLRRLAGDELLIKIVKAQR  108
            ++R +AGD++LI  + + R
Sbjct  704  KVRSIAGDKVLIAAINSIR  722



>ref|XP_008219150.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Prunus mume]
Length=461

 Score =   151 bits (382),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 150/278 (54%), Gaps = 26/278 (9%)
 Frame = -2

Query  926  VEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EK  750
            ++EG + + +  +  +SG+  V   AA+ SI +    +  + +A+   + +F K VE  K
Sbjct  204  LKEGEKPYAVGSQVFLSGMRRVDPAAAVTSIHQC-VRTGPLDRAR---YEVFQKQVEMTK  259

Query  749  SGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDG--SFGHGVYLCPDHFPLGCLNSAM  576
               G  N+  AW GAS  E+  IL HGF       G  S G G+YL     P      + 
Sbjct  260  VARGVANVVHAWYGASASEIRGILTHGFGGPSKVSGPQSRGVGLYLSHLSAPHLSAGRSE  319

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
             D+NG +H++ CRVILG  E V  GS+Q HP+S EFD GVDDL  PK Y+VWSTN+N H+
Sbjct  320  PDDNGEKHIILCRVILGNVEKVEAGSQQCHPSSAEFDTGVDDLRNPKWYVVWSTNMNRHV  379

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKP-NSPRI-TFPSLVSELAKFLPPQIMQSI  222
            LP  ++S+                  SS++ P  + R+ +  +LVS + K+L P  ++ +
Sbjct  380  LPDCVVSYR-----------------SSVRVPAQTGRLCSIDALVSRVQKYLTPSKVEEL  422

Query  221  TTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            ++ V D + GK+ + + VK+ R + GD+L   +++  R
Sbjct  423  SSLVCDLKVGKLAKSDFVKQFRSVTGDQLKPSVIRELR  460



>ref|XP_009399446.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Musa acuminata subsp. malaccensis]
Length=240

 Score =   146 bits (368),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/230 (37%), Positives = 129/230 (56%), Gaps = 10/230 (4%)
 Frame = -2

Query  791  LQSFSLFAKAVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKD--GSFGHGVYL  618
            L++F    KA ++K G  + N + A+  A K+++   ++ GFD S   D  G FG G+Y 
Sbjct  2    LEAFHDQLKATQQKRG-EHPNDKVAFYEAPKEKVIRTIRDGFDVSGAPDDGGYFGLGLYF  60

Query  617  CPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFP  438
             P+ F +  + SA ADE G+RHVL CR+ILG  E V  GSRQ  P+S  FD  VD+   P
Sbjct  61   TPEPFAINSVMSATADERGLRHVLLCRLILGAVEEVVHGSRQSQPSSHSFDSAVDNQNTP  120

Query  437  KKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSEL  258
             +YI+W ++  T +LPLY++S  +        F  +  S     +P SP  +   L+S L
Sbjct  121  TRYIIWYSDAQTRVLPLYVMSIKVD-------FRTRGLSKEPGSRPTSPWTSIKDLISML  173

Query  257  AKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            ++ LP   M  I     +  E K TR ++V+R+R +AGD++L+  +K+ R
Sbjct  174  SRILPRSTMCQIRRLHNELMERKTTRQQVVRRIRHIAGDKILLCAIKSIR  223



>ref|XP_010060144.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
[Eucalyptus grandis]
 gb|KCW66708.1| hypothetical protein EUGRSUZ_F00472 [Eucalyptus grandis]
Length=478

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 92/282 (33%), Positives = 145/282 (51%), Gaps = 27/282 (10%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            N+RL+G  EG+  +  ++   +SGL  V   A I +I +   ++ + +      + +F +
Sbjct  218  NARLLG--EGDTAYSQIKNFFLSGLKNVDPDATITAIHQCTRTTPIER----ARYEVFMR  271

Query  764  AVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMN--KDGSFGHGVYLCPDHFPLG  594
             V+  ++  G  N  +AW G S K L+ IL HGF       K  S+G GV+  P   P  
Sbjct  272  QVDITRTARGTSNTVYAWHGTSAKGLSIILAHGFGVPFEVPKPESYGVGVHFSPVGLPQL  331

Query  593  CLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWST  414
            C   + AD+NG +HV+ CRVILG  E V  GS Q HP++ +FD G DD   PK Y+VW +
Sbjct  332  CAMDSEADDNGEKHVVLCRVILGSAEKVDLGSNQSHPSNVDFDTGADDPNNPKHYVVWFS  391

Query  413  NINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQI  234
            ++NTH+LP  ++SF  S            N+V  +K       +   L+S++   LPP  
Sbjct  392  SVNTHVLPECVVSFKAS------------NNVKCVKN------SICELISKMKSALPPAK  433

Query  233  MQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            +Q +       R GK+ +   VK+ R + GD+ L+  ++  R
Sbjct  434  VQEVENLYSVFRAGKLVKDSFVKQFRSITGDDALLSAIREIR  475



>ref|XP_009413220.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009413221.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO1 
[Musa acuminata subsp. malaccensis]
Length=586

 Score =   152 bits (383),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/257 (32%), Positives = 140/257 (54%), Gaps = 36/257 (14%)
 Frame = -2

Query  782  FSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDH  606
            F+LF + VE  K   GN N+++AWL +SK  +  ++ HG      +   +G+G++L P +
Sbjct  303  FNLFQEQVEIAKKVRGNANVRYAWLASSKDAVEGMMLHGTLTRPEQKCLYGNGIHLAPAN  362

Query  605  FPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYI  426
                C + +  DENGV H++ CR+I+G  EL+ PGS Q  P+++ FD GVDDL  P  YI
Sbjct  363  CSKICASYSDVDENGVIHLMLCRIIMGNAELIYPGSNQCQPSNENFDTGVDDLQKPTHYI  422

Query  425  VWSTNINTHILPLYIISFTISTLNAHNLFGVQ-RNSVSSL--------------------  309
            +W  N+ THI   YI++F +++     L G + +++VS+L                    
Sbjct  423  IWDMNMYTHIYAEYIVTFKVTSKLKEWLVGKESKSNVSALTNSGSPHSLLQDKAFQPSLA  482

Query  308  --------------KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEM  171
                          + P SP + F  L + ++  +PP+ M  + T   + ++GK++R+++
Sbjct  483  FGNKAQAPVSRTMPRIPTSPWMPFSMLFAAISTKVPPEDMDLVHTQYDEFKKGKISRIDL  542

Query  170  VKRLRRLAGDELLIKIV  120
            VK+LR++ GD+LL+  +
Sbjct  543  VKKLRQIIGDKLLVSTI  559



>ref|XP_009800759.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1 isoform 
X2 [Nicotiana sylvestris]
Length=595

 Score =   152 bits (383),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 97/289 (34%), Positives = 155/289 (54%), Gaps = 51/289 (18%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            L G+   +  +  E +  SS+ M+  K     LF K VE  K   G  ++ +AWL +SK 
Sbjct  285  LKGIDSPSGAKIFELHRVSSTFMEVRK----ELFQKQVEITKKQRGGASLSYAWLPSSKG  340

Query  695  ELTSILQHG---FDPSMNKDGSFGHGVYLCPDHFPLGCLNSAMA----DENGVRHVLYCR  537
             +TSI+++G   +D S +K   +G GV+L    FP  C   +      DENGV+H++ CR
Sbjct  341  MITSIMKYGLANYDLSKSK-SRYGVGVHL----FPANCTEISAKYCDYDENGVQHMILCR  395

Query  536  VILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTL  357
            VI+G  ELV PGS+Q+HP+S++FD GVD+L  PK Y+VW+ N+NTHI P Y++SF +S  
Sbjct  396  VIMGNMELVYPGSKQFHPSSEDFDNGVDNLENPKCYVVWTMNMNTHIFPEYVVSFKLSPD  455

Query  356  NAHNLFG----VQRNSVSSL------------------------------KKPNSPRITF  279
                L G    +  ++VS+                               + P SP + F
Sbjct  456  AKGYLVGNESPIDVSAVSTCCNQVPADTLPTDLGTDGYQNSLGLASKKDARTPKSPWMPF  515

Query  278  PSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
            P L + +++ +P + M  +++  +  ++ K++R E V++LR + GD LL
Sbjct  516  PMLFAAISRKVPQEDMNLVSSNYELFKDKKISRDEFVRKLRLIVGDTLL  564



>ref|XP_003534287.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Glycine 
max]
Length=583

 Score =   152 bits (383),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/258 (34%), Positives = 137/258 (53%), Gaps = 37/258 (14%)
 Frame = -2

Query  797  AKLQS-FSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHG---FDPSMNKDGSFG  633
            A +Q+ + LF K  E  K   G  N+++AWL +SK EL++++ +G   +  S +K  ++G
Sbjct  302  ASMQARWELFQKQAEITKKNHGEANIRYAWLASSKGELSTMMNYGLSHYGLSGSK-CTYG  360

Query  632  HGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVD  453
             GV+L     P   +     DENGVRH+  CRVI+G  E++RPG+ Q+HP+S E+D GVD
Sbjct  361  IGVHLAAVTCPDASVRYCDVDENGVRHLALCRVIMGNMEILRPGTDQFHPSSCEYDNGVD  420

Query  452  DLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSL------------  309
             +  P+ Y+VW+ N+NTHI P +++SF +S+    +  G +  +VS +            
Sbjct  421  AIECPQYYVVWNMNMNTHIYPEFVVSFKVSSDAEGHFCGSEGKNVSGVNTACDGPHGLLN  480

Query  308  -------------------KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKM  186
                               K P SP + FP L+  +   +PP  M  I TY +  R   +
Sbjct  481  SESSTVDNGKAPSMVSSTPKVPKSPWMPFPVLLDAIRDQVPPTGMDVIKTYYEQFRSKHI  540

Query  185  TRLEMVKRLRRLAGDELL  132
            +R + VK LR + GD LL
Sbjct  541  SRDDFVKMLRLIVGDGLL  558



>gb|KHN38948.1| Inactive poly [ADP-ribose] polymerase RCD1 [Glycine soja]
Length=548

 Score =   150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/258 (34%), Positives = 136/258 (53%), Gaps = 37/258 (14%)
 Frame = -2

Query  797  AKLQS-FSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHG---FDPSMNKDGSFG  633
            A +Q+ + LF K  E  K   G  N+++AWL +SK EL++++ +G   +  S +K  ++G
Sbjct  267  ASMQARWELFQKQAEITKKNHGEANIRYAWLASSKGELSTMMNYGLSHYGLSGSK-CTYG  325

Query  632  HGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVD  453
             GV+L     P   +     DENGVRH+  CRVI+G  E++RPG+ Q+HP+S E+D GVD
Sbjct  326  IGVHLAAVTCPDASVRYCDVDENGVRHLALCRVIMGNMEILRPGTDQFHPSSCEYDNGVD  385

Query  452  DLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSL------------  309
             +  P+ Y+VW+ N+NTHI P +++SF +S+    +  G +  +VS +            
Sbjct  386  AIECPQYYVVWNMNMNTHIYPEFVVSFKVSSDAEGHFCGSEGKNVSGVNTACDGPHGLLN  445

Query  308  -------------------KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKM  186
                               K P SP + FP L+  +   +PP  M  I TY +  R   +
Sbjct  446  SESSTVDNGKAPSMVSSTPKVPKSPWMPFPVLLDAIRDQVPPTGMDVIKTYYEQFRSKHI  505

Query  185  TRLEMVKRLRRLAGDELL  132
             R + VK LR + GD LL
Sbjct  506  YRDDFVKMLRLIVGDGLL  523



>ref|XP_002301130.1| hypothetical protein POPTR_0002s11300g [Populus trichocarpa]
 gb|EEE80403.1| hypothetical protein POPTR_0002s11300g [Populus trichocarpa]
Length=464

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/229 (38%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = -2

Query  776  LFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFD-PSMNKDG-SFGHGVYLCPDH  606
            +F K +E  K+  G  N  +AW GA  KE+ SIL HGF  P     G ++G GVYL P  
Sbjct  247  VFLKQIEITKAARGVSNTVYAWYGAPAKEVESILAHGFGGPRKVSAGETYGVGVYLSPFG  306

Query  605  FPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYI  426
             P      A AD+NG +H++ CRVILG  E V  GS+Q++P+S +FD G DD   PK Y+
Sbjct  307  LPHMSAKFAEADDNGEKHIILCRVILGNVETVVAGSQQYYPSSIDFDTGTDDPKNPKWYV  366

Query  425  VWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFL  246
            VWS+ +N HI+P  ++SF  S     N+ G  R S  +       + +   L S+L  +L
Sbjct  367  VWSSVMNRHIIPECVVSFKSSI----NVPGQVRGSTHT-------KYSLEKLFSKLRSWL  415

Query  245  PPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
            PP+ +Q +      +R GK+T+   ++ LR +AGD +L+  ++  R  +
Sbjct  416  PPEKIQEVAKLYDVYRAGKLTKNIFIRHLRGVAGDYVLLSAIREIRSSE  464



>gb|EYU38430.1| hypothetical protein MIMGU_mgv1a003940mg [Erythranthe guttata]
 gb|EYU38431.1| hypothetical protein MIMGU_mgv1a003940mg [Erythranthe guttata]
Length=553

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 107/312 (34%), Positives = 162/312 (52%), Gaps = 25/312 (8%)
 Frame = -2

Query  932  IGVEEGNREHQIMERKLVSGLMG----VGMQA-------AIESIEKN-EFSSSVMKKAKL  789
            + V+E    +Q+ME  +V  +      +G  A       AI SI+ N E     M     
Sbjct  243  VEVDEKRGYNQLMEGNIVVAVNSMHGSLGSDAVKEMLLKAIRSIDVNVEEVHRCMSIVME  302

Query  788  QSFSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHG---FDPSMNKDGSFGHGVY  621
                LF K V+  K   G+ N+Q+AWL      +++IL++G   ++P   K    G G++
Sbjct  303  TRSELFEKQVDITKRYRGDANVQYAWLPCPIGTISTILKYGIGHYEPLTTK-PLHGMGIH  361

Query  620  LCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVF  441
            L P +     +N+   DENG RHV++CRVI+G  E+V  GS Q+HP+S+ FD GVD+L  
Sbjct  362  LIPANGTQISINNIDVDENGSRHVVFCRVIMGNMEVVPFGSNQYHPSSENFDSGVDNLES  421

Query  440  PKKYIVWSTNINTHILPLYIISFT-ISTLNAHNLFGVQRNSVSSL------KKPNSPRIT  282
            P++Y+VW+ N+NTHI P  I+SF   S +  H +    R  VS        + P SP + 
Sbjct  422  PEQYVVWNMNMNTHIYPECIVSFKPTSDVEGHVIGQGNRVDVSGFDPQGQKRIPMSPWMP  481

Query  281  FPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL-IKIVKAQRD  105
            FP L + ++  +PPQ M  + +  +  +  K+TR   VK+LR + GD LL   I   QR 
Sbjct  482  FPMLFASISNKVPPQSMDLVKSNYELFKNKKITRDVFVKKLRLIVGDALLKSAITSLQRK  541

Query  104  MQIYTSMGNKTG  69
            M   +S   +T 
Sbjct  542  MSNSSSSDVETA  553



>ref|XP_004512494.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004512495.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X2 [Cicer arietinum]
Length=536

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 89/276 (32%), Positives = 156/276 (57%), Gaps = 27/276 (10%)
 Frame = -2

Query  896  MERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-GNGNMQF  720
            +++  ++G+  +G+   I+ +E    SS +  +A+L+   LF K  E   G  G+ N+++
Sbjct  250  VQKMFLTGMTTLGI-TEIDIVEIYR-SSGMAIQARLE---LFQKQTEITKGIQGDANVRY  304

Query  719  AWLGASKKELTSILQHGFDP---SMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHV  549
            AWL  SK+EL++++++G      S +K   +G GV+L P   P  C   +  DENGV+H+
Sbjct  305  AWLPCSKEELSTMMEYGLGHGGLSASKQ-IYGVGVHLTPITCPYVCAPFSDVDENGVKHL  363

Query  548  LYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISF-  372
            + CRVI+G  EL+R GS Q+HP+  E+D GVDD+  P  Y+VW+ N+NTHI P +++SF 
Sbjct  364  VLCRVIMGNMELLRLGSDQFHPSGCEYDNGVDDIESPNYYVVWNMNMNTHIYPEFVVSFK  423

Query  371  ----------------TISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPP  240
                             +S  N+  +   + +SV + K P+SP + FP L + +   + P
Sbjct  424  APLDAEGNVCLNESKKNVSEHNSSTVNTGKADSVPARKGPSSPWLPFPILFAAIKNRVHP  483

Query  239  QIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
            ++M  +  +    +  +++R + V +LR + GD L+
Sbjct  484  RLMILLRAHYAQLKAKQISREDFVMKLRLIVGDNLI  519



>ref|XP_001782814.1| predicted protein [Physcomitrella patens]
 gb|EDQ52391.1| predicted protein [Physcomitrella patens]
Length=202

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 120/200 (60%), Gaps = 14/200 (7%)
 Frame = -2

Query  938  RLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAV  759
            RL+G+E G+++ + ++R  +SG+        +  I  +   ++V ++   +      + V
Sbjct  7    RLVGLEPGDKDFENVKRIFLSGIGNFASGTTVTGIHCDSSPAAVARREAFERQRELKEKV  66

Query  758  EEKSGFGNGNMQFAWLGASKKELTSILQHGF-DPSMNKDGS-FGHGVYLCPDHFPLG---  594
                  GN N+++ W G SKK +  I  HGF  P  +K+GS +G GVYL  ++       
Sbjct  67   R-----GNANVRYGWHGTSKKGVEGIFLHGFGQPKTSKNGSAYGVGVYLAVENQSFVSVL  121

Query  593  --CLNSAMAD--ENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYI  426
              C ++  AD  ENG +HV+ C+VI G +ELV+ GS Q+HP+S+ FD GVDD + PK+ I
Sbjct  122  YVCCSAIYADNDENGEQHVVLCQVIAGNSELVKHGSEQFHPSSESFDTGVDDTISPKRLI  181

Query  425  VWSTNINTHILPLYIISFTI  366
            VWST++NTHILPLY++SF +
Sbjct  182  VWSTHMNTHILPLYVVSFKL  201



>emb|CDP00981.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   147 bits (370),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 94/268 (35%), Positives = 142/268 (53%), Gaps = 11/268 (4%)
 Frame = -2

Query  926  VEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EK  750
            ++EG +E+ I++   +SGL+ V   A I  I +    + V+ KA+   + +F K +E  K
Sbjct  123  LKEGEKEYTIVKNLFLSGLLSVEPDATITRIHQCT-RTGVLDKAR---YEVFMKQMEIMK  178

Query  749  SGFGNGNMQFAWLGASKKELTSILQHGFD--PSMNKDGSFGHGVYLCPDHFPLGCLNSAM  576
               G+ NM FAW G S + + SIL HGF     +      G GVYL P   P      + 
Sbjct  179  KARGDANMVFAWHGTSAEGVDSILAHGFGMPDQVQTPRPHGVGVYLSPAKLPHISAMMSD  238

Query  575  ADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHI  396
             D+NG +HV+ CRV+LGK E +  GS Q  P+S +FD GVD L  PK Y+VW TN++THI
Sbjct  239  IDDNGEKHVILCRVLLGKCEKIEAGSNQKLPSSLDFDTGVDQLTDPKWYVVWPTNMSTHI  298

Query  395  LPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITT  216
            LP  ++S+  +    H    V       L  P  P      L ++L + LPP  +  + T
Sbjct  299  LPELVVSYKSAN---HVQDQVTGTPCVKLDSP-VPSPFVAKLFAKLGRSLPPLKVLQLQT  354

Query  215  YVKDHREGKMTRLEMVKRLRRLAGDELL  132
                 ++GK+ +   +++LR + GDE+L
Sbjct  355  LCGSLKDGKVGKDMFMEQLRSVVGDEML  382



>ref|XP_009625987.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1 [Nicotiana 
tomentosiformis]
 ref|XP_009625988.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1 [Nicotiana 
tomentosiformis]
Length=595

 Score =   149 bits (375),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 154/289 (53%), Gaps = 51/289 (18%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            L G+   +  +  E +  SS+ M+  +     LF K VE  K   G  ++  AWL +SK 
Sbjct  285  LKGINSPSGAKIFELHRVSSTFMEVRR----ELFQKQVEITKKQRGGASLSCAWLPSSKG  340

Query  695  ELTSILQHG---FDPSMNKDGSFGHGVYLCPDHFPLGCLNSAMA----DENGVRHVLYCR  537
             +TSI+++G   +D S +K   +G GV+L    FP  C   +      DENGV+H++ CR
Sbjct  341  MITSIMKYGLANYDLSKSK-SRYGVGVHL----FPANCTEISAKYCDYDENGVQHMILCR  395

Query  536  VILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTL  357
            VI+G  ELV PGS+Q+HP+S++FD GVD+L  PK Y+VW+ N+NTHI P Y++SF +S  
Sbjct  396  VIMGNMELVYPGSKQFHPSSEDFDNGVDNLENPKCYVVWTMNMNTHIFPEYVVSFKLSPD  455

Query  356  NAHNLFG----VQRNSVSSL------------------------------KKPNSPRITF  279
                L G    +  ++VS+                               + P SP + F
Sbjct  456  AEGYLVGNESPIDVSAVSTCCNQVPADTLPTDLGTDGYQNSLGLASKKAARMPKSPWMPF  515

Query  278  PSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
            P L + +++ +P + M  +++  +  ++ K++R E V++LR + GD LL
Sbjct  516  PMLFAAISRKVPQEDMNLVSSNYELFKDKKISRDEFVRKLRLIVGDTLL  564



>ref|XP_003516978.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Glycine 
max]
 gb|ACJ61470.1| radical-induced cell death protein [Glycine max]
Length=583

 Score =   148 bits (374),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 137/258 (53%), Gaps = 37/258 (14%)
 Frame = -2

Query  797  AKLQS-FSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHG---FDPSMNKDGSFG  633
            A +Q+ + LF K  E  K   G  N+++AWL +SK EL++++ +G   +  S +K  ++G
Sbjct  302  ASMQARWELFQKQAELTKKNHGEANIRYAWLASSKGELSTMMNYGLSHYGLSGSK-CTYG  360

Query  632  HGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVD  453
             GV+L     P   +     DENGVRH+  CRVI+G  E+++PG+ Q+HP+S E+D GVD
Sbjct  361  IGVHLAAVTCPDASVRYCDVDENGVRHLALCRVIMGNMEILQPGTGQFHPSSCEYDNGVD  420

Query  452  DLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSL------------  309
             +  P+ Y+VW+ N+NTHI P +++SF +S+    +  G +  +VS +            
Sbjct  421  SIECPRYYVVWNMNMNTHIYPEFVVSFKVSSDAEGHFCGSEGKNVSGVNSACQGPHGLLH  480

Query  308  -------------------KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKM  186
                               K P SP + FP L+  +   +PP+ M  I  Y +  R   +
Sbjct  481  SESSTVDNGKAPSMVASTPKVPKSPWMPFPLLLDAIRNQVPPKGMDVIKIYYEQFRSKHI  540

Query  185  TRLEMVKRLRRLAGDELL  132
            +R + VK LR + GD LL
Sbjct  541  SRDDFVKMLRLIVGDGLL  558



>ref|XP_009397806.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   144 bits (362),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 88/278 (32%), Positives = 149/278 (54%), Gaps = 17/278 (6%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I V++ + E  I++ +  + +        +  + +  +S+    +A+L++F+    A++
Sbjct  16   MIKVDKDSDEFVIIQHRFYTNMGSTVPHCPLVELHRILYSTPT-GRARLEAFNRQVDAMK  74

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKD--GSFGHGVYLCPDHFPLGCLNS  582
            +K G GN N +FA+  ASK+ +  I+  GFD S   +  G FG  +YL P+   +  + S
Sbjct  75   QKHG-GNPNERFAFYEASKRNVQRIINDGFDVSAAPEDGGYFGIALYLSPEPCAINSVMS  133

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A  DE G+RHVL CRVILG  E V  GS Q  P+S  FD  VD+   P +YI+W  ++ +
Sbjct  134  ATVDEKGLRHVLLCRVILGGAEEVVRGSGQSRPSSGNFDSAVDNHRSPTRYIIWYPDVQS  193

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSV---SSLKKPNSPRITFPSLVSELAKFLPPQIM  231
             +LPLY++S  +            RN V   + + +P SP ++   L+S L+  LP   M
Sbjct  194  RVLPLYVLSVEVDF----------RNRVLHQALVSRPTSPWMSIGDLLSALSARLPHSTM  243

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
              +     D  E K+TR +MV  +R + GD++L+  ++
Sbjct  244  CQLWRLHNDKMEKKITREQMVCSIREITGDQMLLDAMR  281



>ref|XP_011074308.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Sesamum indicum]
Length=481

 Score =   147 bits (372),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 153/281 (54%), Gaps = 17/281 (6%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKA  762
            +R +  EE  + + I++   +SGL  V   + + +I +    +  + KA+ +   +F+K 
Sbjct  214  ARTLATEE--KGYAIVKNLFLSGLEIVEPGSKVTAIHQC-VRTEPLDKARCE---VFSKQ  267

Query  761  VE-EKSGFGNGNMQFAWLGASKKELTSILQHGFD-PS-MNKDGSFGHGVYLCPDHFPLGC  591
            ++  K   G  NM FAW G S K++ SIL+HGF  PS +   G  G G++L P   P   
Sbjct  268  MDITKQARGESNMVFAWYGTSAKDVESILKHGFRVPSKVPHPGGPGIGIHLSPIRLPQHS  327

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
               +  DENG +HV+ CRVILGK E V  GS+Q +P+S E+D GVDDL  PK YIVW  N
Sbjct  328  ALLSEIDENGEKHVILCRVILGKCEKVEAGSQQMYPSSVEYDTGVDDLKNPKWYIVWHAN  387

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +NTHILP  ++S+    ++         N  S +     P I    L S+L   LP   +
Sbjct  388  MNTHILPECVVSYKPVNISG------SVNRFSCMNWVLHPFIA--KLFSKLRSSLPMSRL  439

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            Q + T  + ++EGK+ +   +K+LR + GD++L   ++  R
Sbjct  440  QELQTLWRSYKEGKLGKENFMKQLRSIVGDDVLRSTIQEIR  480



>gb|EYU36416.1| hypothetical protein MIMGU_mgv1a005594mg [Erythranthe guttata]
Length=478

 Score =   147 bits (372),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 107/289 (37%), Positives = 150/289 (52%), Gaps = 37/289 (13%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKA  762
            +R++G EE    + I++   +SGL      A + SI K    +  M KA+ +   +FAK 
Sbjct  215  ARILGSEETG--YSIVKNLFLSGLEIAEPGAVVTSIHKC-VRAGPMDKARSE---VFAKQ  268

Query  761  VE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHG--VYLCPDHFPLGC  591
            +E  K   G  NM FAW G S K + SIL HGF          GHG  V+L P   P+  
Sbjct  269  MEITKRARGESNMVFAWYGTSAKGVESILLHGFGIPNKTSHHEGHGIGVHLSPIRSPI--  326

Query  590  LNSAMA---DENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVW  420
             NSAM    DENG +HV+ CR+ILGK E +  GSRQ +P+S E+D GVDDL  P+ Y VW
Sbjct  327  -NSAMMSEIDENGEKHVILCRLILGKREKIEAGSRQLYPSSAEYDTGVDDLNNPQWYTVW  385

Query  419  STNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPS-----LVSELA  255
             TN+NTHILP  ++S+   ++                 KP +  I  PS     L+S+L 
Sbjct  386  HTNMNTHILPECVVSYRPGSV-----------------KPTTNCIPHPSMFIAKLLSKLK  428

Query  254  KFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
              LP    Q + T     +EGK+ +   +K+LR + GD+ L   ++  R
Sbjct  429  GSLPLPQFQELVTSWGSCKEGKLGKDIFMKKLRLVVGDDKLRSTIQEIR  477



>ref|XP_008800068.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Phoenix 
dactylifera]
 ref|XP_008800069.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Phoenix 
dactylifera]
 ref|XP_008800070.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Phoenix 
dactylifera]
Length=592

 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/261 (31%), Positives = 138/261 (53%), Gaps = 42/261 (16%)
 Frame = -2

Query  782  FSLFAKAVEEKSGF-GNGNMQFAWLGASKKELTSILQHGF----DPSMNKDGSFGHGVYL  618
            ++LF K VE    F GN N+++AWL +S+  +  ++  G      P       +G G +L
Sbjct  307  YNLFLKQVEITKNFRGNANLRYAWLASSRDAVEDMMLQGVMRIKKPVHGP--VYGIGTHL  364

Query  617  CPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFP  438
             P +    C + +  DENGV H++ CRVI+G  E++ PGS+Q  P+++ FD GVDDL  P
Sbjct  365  APVNCSNICASYSDVDENGVVHMMLCRVIMGNVEVIHPGSKQSQPSNENFDSGVDDLQKP  424

Query  437  KKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSL-----------------  309
            K Y++W  +++THI P YI++F +S+    +L G +  S +S                  
Sbjct  425  KHYVIWDMHVSTHIYPEYIVTFKMSSRAREHLVGKESVSNTSAVTNPSSSHSLFQDRNPQ  484

Query  308  ------------------KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMT  183
                              + P SP + F  L + ++  + PQ M S+ T+ ++ ++ K++
Sbjct  485  PPPALRDQSEAPIFGRAPRTPTSPWMPFSMLFAAISTKVSPQDMDSVNTHYEEFKKRKIS  544

Query  182  RLEMVKRLRRLAGDELLIKIV  120
            R+++VK+LR + GD+LLI  +
Sbjct  545  RIDLVKKLRHIIGDKLLISTI  565



>ref|XP_007214795.1| hypothetical protein PRUPE_ppa003072mg [Prunus persica]
 gb|EMJ15994.1| hypothetical protein PRUPE_ppa003072mg [Prunus persica]
Length=607

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 119/185 (64%), Gaps = 9/185 (5%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-GNGNMQFAWLGASKK  696
            L GV     +E ++  + SS++M+ A+L+   LF K VE    F G+ N+++AWL +SK 
Sbjct  285  LKGVSTFDGVEVLDIYQCSSNLMQ-ARLE---LFQKQVEITKAFRGDANVRYAWLASSKG  340

Query  695  ELTSILQHGFDP---SMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILG  525
            EL++++ +G      + NK   +G GV+L    F   C +    DENG RH+L+CRVI+G
Sbjct  341  ELSTLMMYGLGHCGLATNK-SIYGTGVHLTAASFSNTCASYCDVDENGARHMLFCRVIVG  399

Query  524  KTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHN  345
              EL+ PGS+Q+HP S++FD GVDDL  PK YIVW+ N+NTHI P +++SF +S+ +  +
Sbjct  400  NMELLPPGSKQFHPGSKDFDSGVDDLQDPKHYIVWNMNMNTHIYPEFVVSFKVSSKSEGH  459

Query  344  LFGVQ  330
            L G +
Sbjct  460  LVGTE  464



>ref|XP_009397805.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=302

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/278 (32%), Positives = 149/278 (54%), Gaps = 17/278 (6%)
 Frame = -2

Query  935  LIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE  756
            +I V++ + E  I++ +  + +        +  + +  +S+    +A+L++F+    A++
Sbjct  16   MIKVDKDSDEFVIIQHRFYTNMGSTVPHCPLVELHRILYSTPT-GRARLEAFNRQVDAMK  74

Query  755  EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKD--GSFGHGVYLCPDHFPLGCLNS  582
            +K G GN N +FA+  ASK+ +  I+  GFD S   +  G FG  +YL P+   +  + S
Sbjct  75   QKHG-GNPNERFAFYEASKRNVQRIINDGFDVSAAPEDGGYFGIALYLSPEPCAINSVMS  133

Query  581  AMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINT  402
            A  DE G+RHVL CRVILG  E V  GS Q  P+S  FD  VD+   P +YI+W  ++ +
Sbjct  134  ATVDEKGLRHVLLCRVILGGAEEVVRGSGQSRPSSGNFDSAVDNHRSPTRYIIWYPDVQS  193

Query  401  HILPLYIISFTISTLNAHNLFGVQRNSV---SSLKKPNSPRITFPSLVSELAKFLPPQIM  231
             +LPLY++S  +            RN V   + + +P SP ++   L+S L+  LP   M
Sbjct  194  RVLPLYVLSVEVDF----------RNRVLHQALVSRPTSPWMSIGDLLSALSARLPHSTM  243

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
              +     D  E K+TR +MV  +R + GD++L+  ++
Sbjct  244  CQLWRLHNDKMEKKITREQMVCSIREITGDQMLLDAMR  281



>gb|KHN04854.1| Inactive poly [ADP-ribose] polymerase RCD1 [Glycine soja]
Length=689

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 137/258 (53%), Gaps = 37/258 (14%)
 Frame = -2

Query  797  AKLQS-FSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHG---FDPSMNKDGSFG  633
            A +Q+ + LF K  E  K   G  N+++AWL +SK EL++++ +G   +  S +K  ++G
Sbjct  408  ASMQARWELFQKQAELTKKNHGEANIRYAWLASSKGELSTMMNYGLSHYGLSGSK-CTYG  466

Query  632  HGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVD  453
             GV+L     P   +     DENGVRH+  CRVI+G  E+++PG+ Q+HP+S E+D GVD
Sbjct  467  IGVHLAAVTCPDASVRYCDVDENGVRHLALCRVIMGNMEILQPGTGQFHPSSCEYDNGVD  526

Query  452  DLVFPKKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSL------------  309
             +  P+ Y+VW+ N+NTHI P +++SF +S+    +  G +  +VS +            
Sbjct  527  SIECPRYYVVWNMNMNTHIYPEFVVSFKVSSDAEGHFCGSEGKNVSGVNSACQGPHGLLH  586

Query  308  -------------------KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKM  186
                               K P SP + FP L+  +   +PP+ M  I  Y +  R   +
Sbjct  587  SESSTVDNGKAPSMVASTPKVPKSPWMPFPLLLDAIRNQVPPKGMDVIKIYYEQFRSKHI  646

Query  185  TRLEMVKRLRRLAGDELL  132
            +R + VK LR + GD LL
Sbjct  647  SRDDFVKMLRLIVGDGLL  664



>ref|XP_008347314.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Malus 
domestica]
Length=609

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 121/188 (64%), Gaps = 9/188 (5%)
 Frame = -2

Query  908  EHQIMERKLVSGLMGVGMQA--AIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-G  738
            E + ++R  V  +   GM +  ++E ++  + SS++M+ A+L+   LF K VE    F G
Sbjct  269  EGENLDRDTVRKIFLKGMSSFDSVEVLDIYQCSSTLMQ-ARLE---LFQKQVEITKTFRG  324

Query  737  NGNMQFAWLGASKKELTSILQHGFDPS--MNKDGSFGHGVYLCPDHFPLGCLNSAMADEN  564
            + N+++AWL +SK EL++I+ +G   S        +G GV+L    F   C +S   DEN
Sbjct  325  DANIRYAWLASSKGELSTIMMYGLGHSGLATNKSIYGTGVHLTXASFSNTCASSCDVDEN  384

Query  563  GVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLY  384
            G+RH+L+CRVI+G  EL+ PGS Q+HP+S++FD GVD L  PK YIVW+ N+NTHI P +
Sbjct  385  GIRHMLFCRVIMGNMELLHPGSTQFHPSSKDFDSGVDGLQDPKHYIVWNMNMNTHIYPEF  444

Query  383  IISFTIST  360
            ++SF I++
Sbjct  445  VVSFKITS  452



>gb|EEE58642.1| hypothetical protein OsJ_10018 [Oryza sativa Japonica Group]
Length=431

 Score =   145 bits (366),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/292 (30%), Positives = 155/292 (53%), Gaps = 29/292 (10%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMGVGMQ--AAIESIEKNEFSSSVMKKAKLQSFSLFA  768
             + + ++E ++ ++++E+  VS +  V      AI ++ K      V +  + ++F L  
Sbjct  153  GKAVRLDEADKFYKVVEKLFVSRMAPVAAARGVAITAVHK------VAQGPRARAFHLQG  206

Query  767  KAVEEKSGFGNG-NMQFAWLGASKKELTSILQHGFDPSMNKDGSF------GHGVYLCPD  609
            + +    G G+G N +FAW GA   ++ + ++HGF      +G F      G GV+L P 
Sbjct  207  QLLAAARGVGDGSNAKFAWYGAPAADVAAAVEHGFG---RTNGQFLGGRAHGDGVHLSPP  263

Query  608  HFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKY  429
             +P         DENG  H++ CRV++G+ E V   S Q+HP+S E+D  VD+L  P+ Y
Sbjct  264  QYPHASAMLTKPDENGEAHIVLCRVLMGRPEAVPASSPQFHPSSDEYDSAVDNLENPRWY  323

Query  428  IVWSTNINTHILPLYIISF---TISTLNAHNLFGVQRNSVSSLKKPN--SPRITFPSLVS  264
            +VWST++NT ILP Y++SF    +  +   +  G      S LKKP+  + R  FP L++
Sbjct  324  VVWSTDMNTRILPEYVVSFRWPNLPQMEGSSGLG------SKLKKPSPAATRDMFPMLLT  377

Query  263  ELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            E+ +F+P   +Q++       + G+M + + ++ LR   GD +L  + K  R
Sbjct  378  EIQRFVPSPKLQTLQRTYNCFKRGQMKKDQFIRFLRSHIGDNVLTTVAKKLR  429



>ref|XP_010245245.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X2 [Nelumbo nucifera]
Length=613

 Score =   147 bits (370),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 101/299 (34%), Positives = 146/299 (49%), Gaps = 56/299 (19%)
 Frame = -2

Query  872  LMGVG-MQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASK  699
            LMG+G M  A + +E    SSS+ +      F LF K +E  K   G  N++FAWL +S+
Sbjct  288  LMGMGSMIDAKDVLEVYHCSSSISQV----RFELFQKQLEITKKYRGEANVRFAWLASSR  343

Query  698  KELTSILQHGFDPSM--NKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILG  525
            + ++ I+ HG   +        +G GV+L   ++ L   N    DENGV+H+++CRVI+G
Sbjct  344  EAVSRIMVHGIGINGLPKHKPVYGIGVHLSSANYSLISANYCDVDENGVQHMMFCRVIMG  403

Query  524  KTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTI-------  366
              ELV PGS Q+HP+S+ FD GVDDL  P +Y VWS N NTHI P Y++ F +       
Sbjct  404  NMELVHPGSEQFHPSSENFDNGVDDLENPSQYTVWSMNANTHIYPEYVVCFRMPPSVKGH  463

Query  365  -----------------------------STLNA---HNLFG--VQRN-------SVSSL  309
                                         S LN+   HN FG  V+R+         S  
Sbjct  464  AVGNERQSKYDVSGETNSTCCQVQMQIGSSPLNSAVYHNSFGDSVKRSQDKAPVFDSSIS  523

Query  308  KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
            K P SP + FP L   ++  +P   M  +  +    R   + R + VK+LR + GD +L
Sbjct  524  KTPKSPWMPFPMLFDAISNKVPANDMLLVNKHYDLFRHKMINRDDFVKKLRLIVGDTVL  582



>emb|CDP18552.1| unnamed protein product [Coffea canephora]
Length=589

 Score =   145 bits (367),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 95/280 (34%), Positives = 144/280 (51%), Gaps = 52/280 (19%)
 Frame = -2

Query  827  NEFSSSVMKKAKLQSFSLFAKAVEE-KSGFGNGNMQFAWLGASKKELTSILQHGFDPSMN  651
            N+ SSS+++        LF K +E  K   GN N+Q+AWL  SK  + SI+ +G    + 
Sbjct  292  NKCSSSLLQT----RLDLFEKQLEIIKKVRGNANVQYAWLPCSKDAVFSIMTYGLGHGLP  347

Query  650  KDG-SFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQ  474
            +    +G GV+L   +     +++   DEN  R+V+ CRVILG  EL++PGS+Q HP+S+
Sbjct  348  EPRIKYGIGVHLSSVNCAYSSVSNCDVDENRERYVVLCRVILGSIELLQPGSQQCHPSSE  407

Query  473  EFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTIST--------------LNAHNLFG  336
            +FD GVD+L  P +YIVW+ N+NTHI P Y++SFT+ T               N  +L G
Sbjct  408  KFDTGVDNLESPSQYIVWNMNVNTHIYPEYVVSFTVPTDTEGGIILGAEVAEENRLDLSG  467

Query  335  ----------------VQRN----------------SVSSLKKPNSPRITFPSLVSELAK  252
                            VQR                  +SS K P SP + F  L   ++ 
Sbjct  468  VTSQEPQGKLQLGQAAVQRGRECLLSRSSQAEAATIGLSSSKAPKSPWMRFAVLFEAISD  527

Query  251  FLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
             + P  M S+ TY +  R+ K++R + + +LR + GD+LL
Sbjct  528  KITPTEMHSVHTYYEMFRQKKISRDDFIIQLRLIVGDQLL  567



>ref|NP_001049456.1| Os03g0230300 [Oryza sativa Japonica Group]
 gb|ABF94777.1| Poly polymerase catalytic domain containing protein, expressed 
[Oryza sativa Japonica Group]
 gb|ABF94778.1| Poly polymerase catalytic domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11370.1| Os03g0230300 [Oryza sativa Japonica Group]
 gb|EEC74809.1| hypothetical protein OsI_10624 [Oryza sativa Indica Group]
Length=463

 Score =   145 bits (365),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 89/292 (30%), Positives = 155/292 (53%), Gaps = 29/292 (10%)
 Frame = -2

Query  941  SRLIGVEEGNREHQIMERKLVSGLMGVGMQ--AAIESIEKNEFSSSVMKKAKLQSFSLFA  768
             + + ++E ++ ++++E+  VS +  V      AI ++ K      V +  + ++F L  
Sbjct  185  GKAVRLDEADKFYKVVEKLFVSRMAPVAAARGVAITAVHK------VAQGPRARAFHLQG  238

Query  767  KAVEEKSGFGNG-NMQFAWLGASKKELTSILQHGFDPSMNKDGSF------GHGVYLCPD  609
            + +    G G+G N +FAW GA   ++ + ++HGF      +G F      G GV+L P 
Sbjct  239  QLLAAARGVGDGSNAKFAWYGAPAADVAAAVEHGFG---RTNGQFLGGRAHGDGVHLSPP  295

Query  608  HFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKY  429
             +P         DENG  H++ CRV++G+ E V   S Q+HP+S E+D  VD+L  P+ Y
Sbjct  296  QYPHASAMLTKPDENGEAHIVLCRVLMGRPEAVPASSPQFHPSSDEYDSAVDNLENPRWY  355

Query  428  IVWSTNINTHILPLYIISF---TISTLNAHNLFGVQRNSVSSLKKPN--SPRITFPSLVS  264
            +VWST++NT ILP Y++SF    +  +   +  G      S LKKP+  + R  FP L++
Sbjct  356  VVWSTDMNTRILPEYVVSFRWPNLPQMEGSSGLG------SKLKKPSPAATRDMFPMLLT  409

Query  263  ELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            E+ +F+P   +Q++       + G+M + + ++ LR   GD +L  + K  R
Sbjct  410  EIQRFVPSPKLQTLQRTYNCFKRGQMKKDQFIRFLRSHIGDNVLTTVAKKLR  461



>gb|KHF97830.1| Inactive poly [ADP-ribose] polymerase RCD1 [Gossypium arboreum]
 gb|KHF97831.1| Inactive poly [ADP-ribose] polymerase RCD1 [Gossypium arboreum]
Length=613

 Score =   145 bits (367),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 82/250 (33%), Positives = 127/250 (51%), Gaps = 47/250 (19%)
 Frame = -2

Query  740  GNGNMQFAWLGASKKELTSILQHGF-DPSMNK-DGSFGHGVYLCPDHFPLGCLNSAMADE  567
            G+ N+Q AWL  S+ +L  I+ HG  D  +++    +G GV+L    F     N    DE
Sbjct  330  GDANVQHAWLACSQSDLPIIMMHGLGDCRLSRIPHKYGTGVHLATVEFTNTSANYCDVDE  389

Query  566  NGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPL  387
            NG+++++ CRVI+GK EL+RPGS Q +P++++FD GVDDL  PK YI+W+ NI+THI P 
Sbjct  390  NGIKYMILCRVIMGKMELLRPGSGQCYPSNEDFDSGVDDLQHPKYYIIWNMNISTHIYPE  449

Query  386  YIISFTISTLNAHNLFGVQRNSVSSL----------------------------------  309
            +++SF IS    H +     ++VS +                                  
Sbjct  450  FVVSFKISNAEGHLIGSETNHAVSGVTASTPGLQGRLPVLSSAGELGSINHQTSESGGSH  509

Query  308  -----------KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKR  162
                       K P SP + FP L + ++  +P   M  +T + +  R  K++R + VK+
Sbjct  510  ENDPSLGSNTSKTPKSPWMPFPMLFAAISNKIPRSDMDQVTNHYELFRAKKISRDDFVKK  569

Query  161  LRRLAGDELL  132
            LR + GD LL
Sbjct  570  LRLIVGDSLL  579



>ref|XP_009107993.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Brassica 
rapa]
 ref|XP_009107994.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Brassica 
rapa]
Length=563

 Score =   145 bits (367),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 96/310 (31%), Positives = 156/310 (50%), Gaps = 38/310 (12%)
 Frame = -2

Query  896  MERKLVSGLMGVGMQAA--IESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNM  726
            +++  V  +  +G  +   +  ++   FSS + + A+L    LF K VE  K   G+ N+
Sbjct  254  LDKDAVKKMFAIGTSSLGHVAVLDVGRFSSEIAE-ARL---GLFQKQVEITKKHRGDANV  309

Query  725  QFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVL  546
            ++AWL A ++ L+S++  G   +  +   +G G++L     P         DENGVR+++
Sbjct  310  RYAWLPAKREALSSVMMQGLGGAFIRKSIYGVGIHLTAADCPYFSARYCDIDENGVRYMV  369

Query  545  YCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTI  366
             CRVI+G  EL+R    Q+    +E+D GVDD+  PK YIVW+ N+NTH+ P Y++ F +
Sbjct  370  LCRVIMGNMELLRGDKAQFFSGGEEYDNGVDDVENPKNYIVWNMNMNTHVFPEYVVRFKL  429

Query  365  ST-LNA-------HNLFGV----------------------QRNSV-SSLKKPNSPRITF  279
            S  +NA       H+  GV                        NSV SS+ KP SP + F
Sbjct  430  SDPINAEGNFVAKHDNSGVTLEVGPKDLPQLDLTRPEGGPRSANSVRSSMTKPKSPWMPF  489

Query  278  PSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
            P+L + ++  +  +    I    +  RE +MTR E +++LR   GD+LL   + A  +  
Sbjct  490  PTLFAAISHKVAEKDKPFINADYQQLREKRMTRAEFIRKLRGFVGDDLLRSTLTALENQV  549

Query  98   IYTSMGNKTG  69
            I  SM +  G
Sbjct  550  IPGSMRDNEG  559



>ref|XP_011017031.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Populus euphratica]
 ref|XP_011017032.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Populus euphratica]
 ref|XP_011017033.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Populus euphratica]
 ref|XP_011017034.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Populus euphratica]
 ref|XP_011017035.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Populus euphratica]
 ref|XP_011017037.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Populus euphratica]
 ref|XP_011017038.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Populus euphratica]
 ref|XP_011017039.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Populus euphratica]
 ref|XP_011017040.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Populus euphratica]
 ref|XP_011017041.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Populus euphratica]
Length=464

 Score =   145 bits (365),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 128/229 (56%), Gaps = 14/229 (6%)
 Frame = -2

Query  776  LFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFD-PSMNKDG-SFGHGVYLCPDH  606
            +F K +E  K+  G  N  +AW GA  KE+ SIL HGF  P     G ++G GVYL P  
Sbjct  247  VFLKQIEITKAARGVSNTVYAWYGAPAKEVESILAHGFGGPRKVSAGETYGVGVYLSPFG  306

Query  605  FPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYI  426
             P      A AD+NG +H++ CRVILG  E V  GS+Q++P++ +FD G DD   PK Y+
Sbjct  307  LPHMSAKFAEADDNGEKHIILCRVILGNVETVVAGSQQYYPSTIDFDTGTDDPKNPKWYV  366

Query  425  VWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFL  246
            VWS+ +N HI+P  ++SF  S     N+ G  R S  +       + +   L S+L  +L
Sbjct  367  VWSSVMNRHIIPECVVSFKSSI----NVPGQVRGSTHT-------KYSLEKLFSKLRSWL  415

Query  245  PPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
            PP+ ++ +T     +R G +++   ++ LR +AGD +L+  ++  R  +
Sbjct  416  PPEKIKEVTKLYDVYRAGNLSKNIFIRHLRGVAGDYVLLSAIREIRSSE  464



>ref|XP_008803591.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO1 
[Phoenix dactylifera]
Length=591

 Score =   145 bits (366),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 136/261 (52%), Gaps = 42/261 (16%)
 Frame = -2

Query  782  FSLFAKAVEEKSGF-GNGNMQFAWLGASKKELTSILQHGF----DPSMNKDGSFGHGVYL  618
            F+LF K VE    F GN N+++AWL +S+  +  ++  G      P       +G G +L
Sbjct  306  FNLFQKQVEITKNFRGNANVRYAWLSSSRDAVEDMILRGIMRIKKPVHGP--VYGIGTHL  363

Query  617  CPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFP  438
             P +    C + +  DEN V H++ CRVI+G  E++ PGS+Q+ P+++ FD GVDDL  P
Sbjct  364  APANCSNICASYSDVDENDVVHMMLCRVIMGNVEVIHPGSKQYQPSNENFDSGVDDLQKP  423

Query  437  KKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSL-----------------  309
            K Y++W  ++NTHI P YI++F + +     L G +  S +S                  
Sbjct  424  KHYVIWDMHVNTHIYPEYIVAFKVPSRARECLVGKESISNASAVTNLSPPESLLQDRNPQ  483

Query  308  ------------------KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMT  183
                              + P SP + F  L + ++  + PQ M  + T+ ++ ++ K++
Sbjct  484  PPPALGNQSQAPMFGRAPRTPTSPWMPFSMLFAAISTKVSPQDMDLVNTHYEEFKKRKIS  543

Query  182  RLEMVKRLRRLAGDELLIKIV  120
            R++++K+LR++ GD+LLI  +
Sbjct  544  RIDLIKKLRQIIGDKLLISTI  564



>ref|XP_007158258.1| hypothetical protein PHAVU_002G137500g [Phaseolus vulgaris]
 ref|XP_007158259.1| hypothetical protein PHAVU_002G137500g [Phaseolus vulgaris]
 gb|ESW30252.1| hypothetical protein PHAVU_002G137500g [Phaseolus vulgaris]
 gb|ESW30253.1| hypothetical protein PHAVU_002G137500g [Phaseolus vulgaris]
Length=575

 Score =   145 bits (365),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 139/269 (52%), Gaps = 27/269 (10%)
 Frame = -2

Query  782  FSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPS--MNKDGSFGHGVYLCP  612
            + LF K  E  K   G  N+++AWL  SK+EL++++++G           ++G GV+L  
Sbjct  308  WELFQKQAEITKKIHGEANIRYAWLAFSKRELSTMMEYGLGHCGLSGSKCTYGIGVHLAA  367

Query  611  DHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKK  432
               P   +     DENGVRH+  CRVI+G  E++ PG+ Q+ P+S E+D GVDD+  P+ 
Sbjct  368  ASCPDASVRYCDVDENGVRHLTLCRVIMGNMEILYPGTGQFQPSSCEYDSGVDDIQCPRY  427

Query  431  YIVWSTNINTHILPLYIISFTIST------------LNAHNLFGVQRNS-----------  321
            Y+VW+ N+NTHI P +++SF + +              +H   G+  +S           
Sbjct  428  YVVWNMNMNTHIYPEFVVSFKVPSDAEGHFCGHEVNTPSHGPLGLSESSTIDNGKAPSIV  487

Query  320  VSSLKKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGD  141
             S+ K P SP + FP L + +   +  + M  I T+ +  R  +++R + VK LR + GD
Sbjct  488  ASTPKVPKSPWMPFPVLFAAIRNQVQSKDMNLIKTHYEQFRSKQISRDDFVKMLRLIVGD  547

Query  140  ELLIKIVKAQRDMQIYTSMGNKTGVRRNC  54
             LL   +      +I +S G    +++ C
Sbjct  548  ALLRDTI-TNLQYKIPSSGGLDDSIKKEC  575



>ref|XP_010276820.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1 [Nelumbo 
nucifera]
 ref|XP_010276821.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1 [Nelumbo 
nucifera]
Length=604

 Score =   145 bits (366),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/267 (33%), Positives = 130/267 (49%), Gaps = 52/267 (19%)
 Frame = -2

Query  782  FSLFAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFD----PSMNKDGSFGHGVYL  618
            F LF K VE  K    + N+++AWLG S++ ++ IL HG      P  N   S+G GV+L
Sbjct  311  FELFLKQVEITKRYRSDTNVRYAWLGCSREVVSKILVHGIGINGLPKPNP--SYGVGVHL  368

Query  617  CPDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFP  438
             P +      N    DENG+RH++ CRVI+G  EL+ PGS Q++P+S+ FD G+DD   P
Sbjct  369  TPSNCSHISANYCDVDENGIRHMVLCRVIMGNMELIHPGSEQFYPSSENFDSGIDDFQNP  428

Query  437  KKYIVWSTNINTHILPLYIISFTISTLNAHNLFGVQR--------NSVSSL---------  309
              Y+VW+ N+NTHI P  +ISF +      + FG +         NS   +         
Sbjct  429  SYYVVWNMNVNTHIYPECVISFRVPPSAKGHAFGNESKFDVSGITNSTCQVQPQLDSSPI  488

Query  308  ----------------------------KKPNSPRITFPSLVSELAKFLPPQIMQSITTY  213
                                        K P SP + FP L   ++  +PP+ M  +  +
Sbjct  489  DSVGPCNMLPDLVNQSHGKASALGPCVAKTPRSPWMPFPLLFEAISSKVPPKDMALVNKH  548

Query  212  VKDHREGKMTRLEMVKRLRRLAGDELL  132
                R+ K++R + VK+LR + GD LL
Sbjct  549  YDQFRQKKISRDDFVKKLRLIVGDTLL  575



>ref|XP_010678766.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO2 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=324

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 149/287 (52%), Gaps = 32/287 (11%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQ--AAIESIEKNEFSSSVMKKAKLQSFSLF  771
            +  LI + E +    ++    +S + G G +    IE+I K  +S S    A+ + F++F
Sbjct  50   DDYLIRLNENDAIFDVIGHVFMSNMGGFGKKNNTIIEAIHKMNWSYSRTMLARFKCFNIF  109

Query  770  AKAV---EEKSGFGNG---NMQFAWLGASKKELTSILQHGFDPSM--NKDGSFGHGVYLC  615
              A+   ++ S F NG    M++ W    K  +  I+  GF      N+DG     V L 
Sbjct  110  RAALLEDDDNSSFNNGVTSCMKYGWYCDDKDGIQRIVSLGFGHLQLGNRDG-----VRLS  164

Query  614  PDHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPK  435
            P +     + +   DENG++HV+ CRV++   E           +S+E +  VDD V P 
Sbjct  165  PANSLAQSVQNCGIDENGLKHVILCRVLVENGE-----------SSKELNYKVDDDVSPS  213

Query  434  KYIVWSTNINTHILPLYIISF-TISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSEL  258
            +Y+VWST +NTHILP Y++SF T   L+     G  +      K   SP + F +L+S +
Sbjct  214  EYVVWSTKMNTHILPEYVVSFRTFPYLD-----GFSKGGYLGKKPAASPWLPFSTLISTI  268

Query  257  AKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVK  117
            ++FLPP  +  I  + KD ++GK+TR  M++RL R  G ELLIKI+K
Sbjct  269  SEFLPPPTINLINEHYKDFKKGKITRRNMIERLTRYVGKELLIKIIK  315



>ref|XP_010245242.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010245243.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010245244.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like isoform 
X1 [Nelumbo nucifera]
Length=710

 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 108/327 (33%), Positives = 156/327 (48%), Gaps = 58/327 (18%)
 Frame = -2

Query  872  LMGVG-MQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVEEKSGF-GNGNMQFAWLGASK  699
            LMG+G M  A + +E    SSS+ +      F LF K +E    + G  N++FAWL +S+
Sbjct  288  LMGMGSMIDAKDVLEVYHCSSSISQV----RFELFQKQLEITKKYRGEANVRFAWLASSR  343

Query  698  KELTSILQHGFDPSM--NKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILG  525
            + ++ I+ HG   +        +G GV+L   ++ L   N    DENGV+H+++CRVI+G
Sbjct  344  EAVSRIMVHGIGINGLPKHKPVYGIGVHLSSANYSLISANYCDVDENGVQHMMFCRVIMG  403

Query  524  KTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTI-------  366
              ELV PGS Q+HP+S+ FD GVDDL  P +Y VWS N NTHI P Y++ F +       
Sbjct  404  NMELVHPGSEQFHPSSENFDNGVDDLENPSQYTVWSMNANTHIYPEYVVCFRMPPSVKGH  463

Query  365  -----------------------------STLNA---HNLFG--VQRN-------SVSSL  309
                                         S LN+   HN FG  V+R+         S  
Sbjct  464  AVGNERQSKYDVSGETNSTCCQVQMQIGSSPLNSAVYHNSFGDSVKRSQDKAPVFDSSIS  523

Query  308  KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL-  132
            K P SP + FP L   ++  +P   M  +  +    R   + R + VK+LR + GD +L 
Sbjct  524  KTPKSPWMPFPMLFDAISNKVPANDMLLVNKHYDLFRHKMINRDDFVKKLRLIVGDTVLR  583

Query  131  IKIVKAQRDMQIYTSM-GNKTGVRRNC  54
              I   Q  +Q    + G   GVR  C
Sbjct  584  STITSLQCKLQSECGVSGFFVGVRITC  610



>ref|XP_009335476.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Pyrus x bretschneideri]
Length=458

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 150/279 (54%), Gaps = 25/279 (9%)
 Frame = -2

Query  953  EQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSL  774
            E  N RL+G  E  R + +     ++G+  V + A + ++ +       ++KA+L+   +
Sbjct  186  EWPNVRLLGGVE--RVYTVCSNLFLAGMRKVDLSAVVTAVHQC-VRDGPLEKARLE---V  239

Query  773  FAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPL  597
            F + +E  K   G+ N+ +AW G S  ++  IL HGF       G   HGV L   H  +
Sbjct  240  FQEQIEITKVARGSANVVYAWCGVSGSDVRGILTHGFGAPSKVSGPQSHGVGLHLSHLSV  299

Query  596  GCLNSAMA--DENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIV  423
              L+S  +  D+NG ++ + CRVILG  E +  GS+Q +P+S EFD G DD + PK Y++
Sbjct  300  PFLSSGQSERDDNGEKYAILCRVILGSVEKIEAGSKQCYPSSVEFDNGADDPMNPKWYVI  359

Query  422  WSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPS--LVSELAKF  249
            WSTN+N H+LP  ++S+  + + A     V+R               +P   L+S++  +
Sbjct  360  WSTNMNRHVLPECVVSYKSNYVPAQLGGSVRR--------------AYPVDMLISKIQSY  405

Query  248  LPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELL  132
            LPP  +Q +++ V + + GK+ R + VK+ R + G++L+
Sbjct  406  LPPSKVQELSSLVCELKGGKLARDDFVKQCRSVTGEQLM  444



>gb|KDP41553.1| hypothetical protein JCGZ_15960 [Jatropha curcas]
Length=479

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/284 (31%), Positives = 147/284 (52%), Gaps = 18/284 (6%)
 Frame = -2

Query  944  NSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAK  765
            NSRL+   E  + + ++    +SG+  V   A I +I +       ++KA+ + F    +
Sbjct  212  NSRLLRYSE--KPYSLVRDSFLSGIRKVDPSARITAIHQWTREGH-LEKARYEVFQ--NQ  266

Query  764  AVEEKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDG--SFGHGVYLCPDHFPLGC  591
                K+  G  NM +AW GAS K + SIL HGF       G   +G G YL P   P   
Sbjct  267  MAITKAARGVSNMIYAWHGASAKAVESILAHGFGVPSKVSGPDCYGIGAYLSPVGLPHIS  326

Query  590  LNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTN  411
               +  D+NG +H++ CR+ILG  E V  GS+Q +P++  FD GVD+L   K YIVWS+N
Sbjct  327  ARLSELDDNGEKHIILCRLILGNVEKVEAGSQQSYPSNVNFDTGVDNLHHTKWYIVWSSN  386

Query  410  INTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPSLVSELAKFLPPQIM  231
            +N+HI+P +++S+  S            +    +K     + +   L+ ++   LPP  +
Sbjct  387  MNSHIIPEFVVSYKSSN-----------HVPGQMKGSTCMKYSLEKLILKMRSLLPPPKI  435

Query  230  QSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQRDMQ  99
            + + T    +REG++ R   +K+LR +AGD++L   ++   D +
Sbjct  436  REVVTLYDTYREGRLGRDMFIKQLRLIAGDQVLSSSIREICDQE  479



>ref|XP_010919988.1| PREDICTED: inactive poly [ADP-ribose] polymerase RCD1-like [Elaeis 
guineensis]
Length=592

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 135/259 (52%), Gaps = 38/259 (15%)
 Frame = -2

Query  782  FSLFAKAVEEKSGF-GNGNMQFAWLGASKKELTSILQHGFDPSMN--KDGSFGHGVYLCP  612
            F+LF K VE    F GN N+++AWL +S+  +  ++  G            +G G +L P
Sbjct  307  FNLFQKQVEITKNFRGNANVRYAWLASSRDCVEDMMLQGVAKIKKPVHGPVYGIGTHLAP  366

Query  611  DHFPLGCLNSAMADENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKK  432
             +    C + +  DENGV H++ CRVI+G  E++ PGS+Q+ P+++ FD GVD+L  PK 
Sbjct  367  ANCSNICASYSDVDENGVVHMILCRVIMGNVEVIHPGSKQFQPSNENFDSGVDNLQKPKH  426

Query  431  YIVWSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSL-------------------  309
            Y++W  ++NTHI P YI++F + +     L G +  S +S                    
Sbjct  427  YVIWDMHVNTHIYPEYIVTFKMPSRARERLVGKESVSNTSAVTNPSSSHSLLQDRNPQPP  486

Query  308  ----------------KKPNSPRITFPSLVSELAKFLPPQIMQSITTYVKDHREGKMTRL  177
                            K P SP + F  L + ++  + PQ M  + T+ ++ ++  ++R+
Sbjct  487  PALADQSQVPVFGRAPKTPTSPWMPFSMLFAAISTKVSPQDMDLVNTHYEEFKKRNISRI  546

Query  176  EMVKRLRRLAGDELLIKIV  120
            ++VK+LR++ GD+LL+  +
Sbjct  547  DLVKKLRQIIGDKLLVSTI  565



>ref|XP_009357224.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO3 
[Pyrus x bretschneideri]
Length=455

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 149/287 (52%), Gaps = 28/287 (10%)
 Frame = -2

Query  953  EQRNSRLIGVEEGNREHQIMERKLVSGLMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSL  774
            E  N RL+G  E  R + +     ++G+  V + AA+ +I +       + KA+L+   +
Sbjct  186  EWPNVRLVG--EPERVYTVCSNLFLAGMKKVDLAAAVTAIHQC-VRDGPLDKARLE---V  239

Query  773  FAKAVE-EKSGFGNGNMQFAWLGASKKELTSILQHGFDPSMNKDGSFGHGVYLCPDHFPL  597
            F K +E   +  G  N+ +AW G S  ++  IL HGF       G   HG+ L   H  +
Sbjct  240  FQKQIEITTAARGAANVIYAWCGVSGNDVKGILTHGFGAPSKVSGPQSHGIGLHLSHLSV  299

Query  596  GCLNSAMA--DENGVRHVLYCRVILGKTELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIV  423
              L++  +  D+NG ++ + CRVILG  E +  GS+Q +P+  EFD G DD   PK Y++
Sbjct  300  PFLSAGQSERDDNGEKYAILCRVILGNVEKIEAGSKQCYPSGVEFDNGADDPKNPKWYVI  359

Query  422  WSTNINTHILPLYIISFTISTLNAHNLFGVQRNSVSSLKKPNSPRITFPS--LVSELAKF  249
            WSTN+N H+LP  ++S+  + + A ++                 R  +P   L+S++   
Sbjct  360  WSTNMNRHVLPECVVSYKSNYVPAQSV-----------------RRAYPVDMLISKIKSH  402

Query  248  LPPQIMQSITTYVKDHREGKMTRLEMVKRLRRLAGDELLIKIVKAQR  108
            LPP  +Q +++ V + + GK+ R + VK+ R + G++L+   +K  R
Sbjct  403  LPPSKVQELSSLVCELKGGKLARDDFVKQCRSVTGEQLMASALKDLR  449



>gb|KEH27736.1| inactive poly [ADP-ribose] polymerase RCD1 [Medicago truncatula]
Length=482

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 114/198 (58%), Gaps = 16/198 (8%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            L G     + + +E   FSS++M    L    LF K  E  K+  G+ N+Q+AWL +SK 
Sbjct  275  LKGTSSFGSADIVEIYPFSSTMM----LSRLELFEKQAEITKNCRGDANIQYAWLASSKG  330

Query  695  ELTSILQHGFDPS--MNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
            EL+++++ G           + G GV+L    FP    +    DENGVRH+++CRVI+G 
Sbjct  331  ELSTMMKCGLGHCGISTSKCTHGFGVHLAAATFPFASASHCDIDENGVRHLVFCRVIMGN  390

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNA---  351
             EL+RPG+RQ+ P+S ++D GVDD+  P+ YIVW+ N NTHI P Y++SF +S+      
Sbjct  391  MELLRPGTRQFRPSSSDYDSGVDDIHNPRYYIVWNMNTNTHICPEYVVSFKVSSATEGLL  450

Query  350  ------HNLFGVQRNSVS  315
                  +N+FGV   S S
Sbjct  451  LGSKTKNNIFGVNSASRS  468



>gb|KEH27735.1| inactive poly [ADP-ribose] polymerase RCD1 [Medicago truncatula]
Length=488

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 114/198 (58%), Gaps = 16/198 (8%)
 Frame = -2

Query  872  LMGVGMQAAIESIEKNEFSSSVMKKAKLQSFSLFAKAVE-EKSGFGNGNMQFAWLGASKK  696
            L G     + + +E   FSS++M    L    LF K  E  K+  G+ N+Q+AWL +SK 
Sbjct  275  LKGTSSFGSADIVEIYPFSSTMM----LSRLELFEKQAEITKNCRGDANIQYAWLASSKG  330

Query  695  ELTSILQHGFDPS--MNKDGSFGHGVYLCPDHFPLGCLNSAMADENGVRHVLYCRVILGK  522
            EL+++++ G           + G GV+L    FP    +    DENGVRH+++CRVI+G 
Sbjct  331  ELSTMMKCGLGHCGISTSKCTHGFGVHLAAATFPFASASHCDIDENGVRHLVFCRVIMGN  390

Query  521  TELVRPGSRQWHPTSQEFDCGVDDLVFPKKYIVWSTNINTHILPLYIISFTISTLNA---  351
             EL+RPG+RQ+ P+S ++D GVDD+  P+ YIVW+ N NTHI P Y++SF +S+      
Sbjct  391  MELLRPGTRQFRPSSSDYDSGVDDIHNPRYYIVWNMNTNTHICPEYVVSFKVSSATEGLL  450

Query  350  ------HNLFGVQRNSVS  315
                  +N+FGV   S S
Sbjct  451  LGSKTKNNIFGVNSASRS  468



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3285328168100