BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10233_g1_i1 len=674 path=[1:0-673]

Length=674
                                                                      Score     E

ref|XP_009760376.1|  PREDICTED: cyclin-U4-1-like                        203   8e-62   
ref|XP_009613666.1|  PREDICTED: cyclin-U4-1-like                        197   2e-59   
ref|XP_006366726.1|  PREDICTED: cyclin-U4-1-like                        187   2e-55   
gb|EYU20163.1|  hypothetical protein MIMGU_mgv1a024090mg                186   3e-55   
ref|XP_004235192.1|  PREDICTED: cyclin-U4-1                             186   3e-55   
gb|KDP22483.1|  hypothetical protein JCGZ_26314                         186   3e-55   
ref|XP_010246095.1|  PREDICTED: cyclin-U4-1-like                        186   4e-55   
ref|XP_002511026.1|  cyclin-dependent protein kinase, putative          186   4e-55   Ricinus communis
gb|KHN22156.1|  Cyclin-U4-1                                             186   8e-55   
ref|XP_006397655.1|  hypothetical protein EUTSA_v10001641mg             185   9e-55   
ref|XP_004307245.1|  PREDICTED: cyclin-U4-1-like                        184   2e-54   
ref|XP_008232383.1|  PREDICTED: cyclin-U4-1-like                        184   3e-54   
gb|KDP28881.1|  hypothetical protein JCGZ_14652                         184   3e-54   
ref|XP_007038242.1|  Cyclin p4,1                                        184   3e-54   
gb|KHG11686.1|  Cyclin-U4-1 -like protein                               184   5e-54   
ref|XP_006375171.1|  cyclin family protein                              183   5e-54   
ref|XP_011032483.1|  PREDICTED: cyclin-U4-1                             183   6e-54   
ref|XP_006295023.1|  hypothetical protein CARUB_v10024094mg             182   8e-54   
ref|XP_007218436.1|  hypothetical protein PRUPE_ppa011642mg             182   1e-53   
ref|XP_010258734.1|  PREDICTED: cyclin-U4-1-like                        182   1e-53   
gb|EYU40342.1|  hypothetical protein MIMGU_mgv1a013920mg                182   1e-53   
ref|XP_011085729.1|  PREDICTED: cyclin-U4-1                             182   1e-53   
ref|XP_007218421.1|  hypothetical protein PRUPE_ppa011572mg             182   2e-53   
emb|CDP09417.1|  unnamed protein product                                182   2e-53   
ref|XP_011076450.1|  PREDICTED: cyclin-U4-1-like                        182   2e-53   
gb|KHN40524.1|  Cyclin-U4-1                                             182   3e-53   
ref|XP_007139676.1|  hypothetical protein PHAVU_008G049600g             181   3e-53   
ref|XP_003552477.1|  PREDICTED: cyclin-U4-1-like                        181   4e-53   
ref|XP_006490025.1|  PREDICTED: cyclin-U4-1-like                        182   4e-53   
ref|XP_004492903.1|  PREDICTED: cyclin-U4-1-like                        181   4e-53   
ref|XP_011040341.1|  PREDICTED: cyclin-U4-1-like isoform X1             181   5e-53   
ref|XP_003624270.1|  Cyclin-dependent protein kinase regulator Pho80    181   5e-53   
ref|XP_010692026.1|  PREDICTED: cyclin-U4-1                             181   7e-53   
ref|XP_006388184.1|  hypothetical protein POPTR_0296s00210g             180   7e-53   
emb|CDX83419.1|  BnaA03g20870D                                          180   8e-53   
ref|XP_011003554.1|  PREDICTED: cyclin-U4-1-like                        181   8e-53   
emb|CDY48257.1|  BnaC04g05160D                                          180   1e-52   
ref|XP_010506407.1|  PREDICTED: cyclin-U4-1-like                        179   1e-52   
ref|XP_010508257.1|  PREDICTED: cyclin-U4-1                             179   1e-52   
emb|CDY30482.1|  BnaA04g25830D                                          179   1e-52   
ref|XP_006374594.1|  hypothetical protein POPTR_0015s12380g             179   2e-52   
ref|XP_009142278.1|  PREDICTED: cyclin-U4-1                             179   2e-52   
ref|XP_010056382.1|  PREDICTED: cyclin-U4-1                             179   2e-52   
ref|XP_010518078.1|  PREDICTED: cyclin-U4-1-like                        179   2e-52   
gb|AFK41945.1|  unknown                                                 179   2e-52   
ref|XP_007205921.1|  hypothetical protein PRUPE_ppa011614mg             179   2e-52   
ref|XP_002526473.1|  cyclin-dependent protein kinase, putative          179   3e-52   Ricinus communis
ref|XP_006376963.1|  hypothetical protein POPTR_0012s11610g             179   3e-52   
ref|XP_009143062.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U4-1        179   3e-52   
ref|XP_008343752.1|  PREDICTED: cyclin-U4-1-like                        178   5e-52   
ref|NP_182002.1|  cyclin p4;1                                           178   6e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009370411.1|  PREDICTED: cyclin-U4-1                             178   6e-52   
ref|XP_006421507.1|  hypothetical protein CICLE_v10005725mg             179   7e-52   
ref|XP_007134401.1|  hypothetical protein PHAVU_010G044800g             177   7e-52   
ref|XP_009133684.1|  PREDICTED: cyclin-U4-1-like                        177   7e-52   
ref|XP_009363720.1|  PREDICTED: cyclin-U4-1-like                        178   8e-52   
ref|XP_011084761.1|  PREDICTED: cyclin-U4-1-like isoform X1             177   8e-52   
emb|CDX74684.1|  BnaA05g04300D                                          178   1e-51   
emb|CDX95612.1|  BnaC03g24930D                                          177   1e-51   
ref|XP_009800863.1|  PREDICTED: cyclin-U4-1                             176   3e-51   
ref|XP_008343655.1|  PREDICTED: cyclin-U4-1-like                        176   3e-51   
ref|XP_008362758.1|  PREDICTED: cyclin-U4-1-like                        176   6e-51   
ref|XP_010109140.1|  hypothetical protein L484_017079                   175   6e-51   
ref|XP_007052360.1|  Cyclin p4,1                                        175   7e-51   
ref|XP_008438223.1|  PREDICTED: cyclin-U4-1                             175   8e-51   
gb|ACU24636.1|  unknown                                                 174   9e-51   Glycine max [soybeans]
gb|KHG18521.1|  Cyclin-U4-1 -like protein                               175   1e-50   
gb|KHG19596.1|  Cyclin-U4-1 -like protein                               175   1e-50   
ref|XP_002881978.1|  CYCP4_1                                            174   1e-50   
ref|XP_010089785.1|  hypothetical protein L484_008035                   174   2e-50   
ref|XP_003636176.1|  Cyclin-U4-1                                        174   2e-50   
ref|XP_004133942.1|  PREDICTED: cyclin-U4-1-like                        174   2e-50   
ref|XP_004145018.1|  PREDICTED: cyclin-U4-1-like                        174   4e-50   
ref|XP_008245770.1|  PREDICTED: cyclin-U4-1-like                        173   4e-50   
ref|XP_004160682.1|  PREDICTED: cyclin-U4-1-like                        174   4e-50   
ref|XP_006445448.1|  hypothetical protein CICLE_v10022279mg             173   5e-50   
ref|XP_004307773.1|  PREDICTED: cyclin-U4-1-like                        173   5e-50   
ref|XP_009592904.1|  PREDICTED: cyclin-U4-1                             173   5e-50   
ref|XP_008375750.1|  PREDICTED: cyclin-U4-1                             173   6e-50   
gb|KHN31107.1|  Cyclin-U4-1                                             173   8e-50   
ref|NP_001235331.1|  uncharacterized protein LOC100305689               173   8e-50   
gb|KHN12243.1|  Cyclin-U4-1                                             172   9e-50   
ref|XP_006347995.1|  PREDICTED: cyclin-U4-1-like                        172   1e-49   
ref|XP_004229728.1|  PREDICTED: cyclin-U4-1                             172   1e-49   
ref|XP_003529016.1|  PREDICTED: cyclin-U4-1-like                        172   1e-49   
gb|KFK37277.1|  hypothetical protein AALP_AA4G236200                    172   1e-49   
ref|XP_002862353.1|  CYCP4_2                                            172   1e-49   
ref|XP_009375368.1|  PREDICTED: cyclin-U4-1                             172   2e-49   
ref|XP_004515319.1|  PREDICTED: cyclin-U4-1-like                        171   2e-49   
ref|XP_009362721.1|  PREDICTED: cyclin-U4-1-like                        171   2e-49   
ref|NP_200973.1|  CYCLIN P4;2                                           172   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002271136.1|  PREDICTED: cyclin-U4-1                             171   2e-49   Vitis vinifera
ref|XP_010524444.1|  PREDICTED: cyclin-U4-1                             171   3e-49   
ref|XP_008460076.1|  PREDICTED: cyclin-U4-1-like                        174   5e-49   
ref|XP_006394483.1|  hypothetical protein EUTSA_v10005388mg             170   1e-48   
emb|CDP05394.1|  unnamed protein product                                169   1e-48   
ref|XP_002278426.1|  PREDICTED: cyclin-U4-1                             168   3e-48   Vitis vinifera
emb|CDY65234.1|  BnaC09g47870D                                          169   3e-48   
ref|XP_009122338.1|  PREDICTED: cyclin-U4-2                             168   8e-48   
emb|CDX70040.1|  BnaA10g23890D                                          167   1e-47   
ref|XP_006838523.1|  hypothetical protein AMTR_s00002p00190080          167   3e-47   
ref|XP_006279771.1|  hypothetical protein CARUB_v10027784mg             166   3e-47   
ref|XP_010491362.1|  PREDICTED: cyclin-U4-2-like                        166   5e-47   
ref|XP_010523281.1|  PREDICTED: cyclin-U4-2-like                        166   5e-47   
ref|XP_006288646.1|  hypothetical protein CARUB_v10001951mg             166   5e-47   
ref|XP_010457595.1|  PREDICTED: cyclin-U4-3                             166   7e-47   
ref|NP_196362.1|  cyclin p4;3                                           165   8e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KHG14991.1|  Cyclin-U4-1 -like protein                               165   1e-46   
emb|CDY08862.1|  BnaA06g23620D                                          164   2e-46   
ref|XP_010452710.1|  PREDICTED: cyclin-U4-2-like                        164   2e-46   
ref|XP_009136505.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U4-3        164   3e-46   
ref|XP_010423207.1|  PREDICTED: cyclin-U4-2-like                        164   3e-46   
ref|XP_002873308.1|  CYCP4_3                                            164   4e-46   
ref|XP_009389264.1|  PREDICTED: cyclin-P4-1                             162   5e-46   
ref|XP_003572092.2|  PREDICTED: cyclin-P4-1-like                        162   1e-45   
ref|NP_001065406.1|  Os10g0563900                                       162   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662071.1|  PREDICTED: cyclin-P4-1-like                        162   2e-45   
ref|XP_010546128.1|  PREDICTED: cyclin-U4-3-like                        160   4e-45   
ref|XP_004983624.1|  PREDICTED: cyclin-P4-1-like                        161   4e-45   
ref|XP_010483846.1|  PREDICTED: cyclin-U4-3-like                        160   5e-45   
ref|XP_008794908.1|  PREDICTED: cyclin-P4-1                             159   1e-44   
ref|XP_002467475.1|  hypothetical protein SORBIDRAFT_01g028810          160   1e-44   Sorghum bicolor [broomcorn]
ref|XP_008453846.1|  PREDICTED: cyclin-U4-1-like                        159   2e-44   
ref|XP_010443988.1|  PREDICTED: cyclin-U4-3-like                        159   3e-44   
ref|XP_010919767.1|  PREDICTED: cyclin-P4-1                             157   1e-43   
ref|XP_004167894.1|  PREDICTED: cyclin-U4-1-like                        156   2e-43   
ref|XP_004146934.1|  PREDICTED: cyclin-U4-1-like                        156   2e-43   
ref|XP_009400236.1|  PREDICTED: cyclin-P4-1-like                        155   3e-43   
gb|EMS61422.1|  hypothetical protein TRIUR3_30801                       157   6e-43   
tpg|DAA46330.1|  TPA: hypothetical protein ZEAMMB73_464167              155   9e-43   
ref|XP_009389583.1|  PREDICTED: cyclin-P4-1-like                        154   1e-42   
gb|EMT31645.1|  hypothetical protein F775_30140                         154   3e-42   
gb|KHG29431.1|  Cyclin-U4-1 -like protein                               151   7e-42   
ref|XP_010934119.1|  PREDICTED: cyclin-P4-1-like                        148   2e-40   
ref|XP_008786194.1|  PREDICTED: cyclin-P4-1                             148   2e-40   
ref|XP_002966846.1|  hypothetical protein SELMODRAFT_68732              145   1e-39   
ref|XP_006648892.1|  PREDICTED: cyclin-P4-1-like                        145   2e-39   
ref|XP_002994358.1|  hypothetical protein SELMODRAFT_48686              144   2e-39   
ref|XP_002985239.1|  hypothetical protein SELMODRAFT_48560              142   2e-38   
ref|XP_010544563.1|  PREDICTED: cyclin-U4-1-like                        142   3e-38   
dbj|BAK01932.1|  predicted protein                                      142   4e-38   
dbj|BAJ89972.1|  predicted protein                                      142   6e-38   
ref|XP_010934125.1|  PREDICTED: cyclin-P4-1                             141   9e-38   
gb|EMT32586.1|  hypothetical protein F775_21459                         140   4e-37   
ref|XP_008669070.1|  PREDICTED: cyclin-P4-1-like                        137   4e-36   
ref|XP_011040342.1|  PREDICTED: cyclin-U4-1-like isoform X2             134   6e-36   
gb|EMT12283.1|  hypothetical protein F775_15957                         136   1e-35   
ref|XP_004953300.1|  PREDICTED: cyclin-P4-1-like                        136   1e-35   
ref|XP_009387832.1|  PREDICTED: cyclin-P3-1-like                        136   1e-35   
ref|NP_001047597.1|  Os02g0652000                                       134   8e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452825.1|  hypothetical protein SORBIDRAFT_04g033250          134   1e-34   Sorghum bicolor [broomcorn]
gb|ACG36976.1|  PREG-like protein                                       133   3e-34   Zea mays [maize]
ref|NP_001149845.1|  LOC100283473                                       133   3e-34   Zea mays [maize]
emb|CDP03631.1|  unnamed protein product                                132   3e-34   
ref|XP_001784037.1|  predicted protein                                  131   4e-34   
ref|XP_003569998.1|  PREDICTED: cyclin-P4-1-like                        132   5e-34   
ref|XP_001784038.1|  predicted protein                                  130   5e-34   
emb|CAC39033.1|  PREG-like protein                                      131   7e-34   Oryza sativa [red rice]
ref|XP_001763676.1|  predicted protein                                  130   7e-34   
ref|XP_011079855.1|  PREDICTED: cyclin-P3-1-like                        131   8e-34   
ref|XP_007050616.1|  Cyclin p1,1 isoform 1                              131   1e-33   
ref|XP_003570865.1|  PREDICTED: cyclin-P4-1-like                        132   1e-33   
ref|XP_006851092.1|  hypothetical protein AMTR_s00025p00245040          130   2e-33   
ref|XP_004493668.1|  PREDICTED: cyclin-P3-1-like                        130   2e-33   
gb|AFK40409.1|  unknown                                                 130   3e-33   
ref|XP_002448263.1|  hypothetical protein SORBIDRAFT_06g024180          130   3e-33   Sorghum bicolor [broomcorn]
gb|EMS63928.1|  hypothetical protein TRIUR3_31342                       132   3e-33   
gb|ACJ84821.1|  unknown                                                 130   4e-33   Medicago truncatula
gb|KEH23760.1|  cyclin p4                                               130   4e-33   
ref|XP_010255964.1|  PREDICTED: cyclin-P3-1-like isoform X2             129   5e-33   
gb|ABK22429.1|  unknown                                                 130   5e-33   Picea sitchensis
ref|XP_007162425.1|  hypothetical protein PHAVU_001G151100g             129   5e-33   
ref|XP_002441059.1|  hypothetical protein SORBIDRAFT_09g019600          130   6e-33   Sorghum bicolor [broomcorn]
ref|XP_010255963.1|  PREDICTED: cyclin-P3-1-like isoform X1             130   6e-33   
ref|XP_001753286.1|  predicted protein                                  127   6e-33   
ref|XP_002274682.1|  PREDICTED: cyclin-P3-1 isoform X1                  129   6e-33   Vitis vinifera
ref|XP_010652114.1|  PREDICTED: cyclin-P3-1 isoform X2                  129   8e-33   
ref|XP_010942426.1|  PREDICTED: cyclin-P3-1-like                        129   8e-33   
gb|KHF97746.1|  Cyclin-P3-1                                             130   8e-33   
gb|KHG00595.1|  Cyclin-P3-1                                             129   9e-33   
dbj|BAJ86315.1|  predicted protein                                      128   2e-32   
ref|XP_006576896.1|  PREDICTED: cyclin-P3-1-like isoform X1             128   2e-32   
ref|XP_009627788.1|  PREDICTED: cyclin-P3-1                             128   2e-32   
ref|XP_002976722.1|  hypothetical protein SELMODRAFT_416667             129   2e-32   
gb|EPS72561.1|  hypothetical protein M569_02197                         126   2e-32   
ref|XP_004962162.1|  PREDICTED: cyclin-P3-1-like                        128   2e-32   
ref|XP_003580261.1|  PREDICTED: cyclin-P4-1-like                        127   2e-32   
gb|AFK44566.1|  unknown                                                 127   3e-32   
gb|AFK44207.1|  unknown                                                 127   3e-32   
gb|AFK40008.1|  unknown                                                 127   3e-32   
ref|XP_008235285.1|  PREDICTED: cyclin-P3-1                             127   3e-32   
ref|XP_001760666.1|  predicted protein                                  125   4e-32   
ref|XP_009804077.1|  PREDICTED: cyclin-P3-1                             127   4e-32   
ref|XP_002973135.1|  hypothetical protein SELMODRAFT_413599             128   4e-32   
ref|XP_002520742.1|  cyclin-dependent protein kinase, putative          127   5e-32   Ricinus communis
gb|AAC32127.1|  PREG-like protein                                       128   5e-32   Picea mariana [black spruce]
ref|XP_004290653.1|  PREDICTED: cyclin-P3-1-like                        126   5e-32   
ref|XP_006444072.1|  hypothetical protein CICLE_v10021982mg             126   6e-32   
ref|XP_011082555.1|  PREDICTED: cyclin-P3-1                             126   7e-32   
ref|XP_008812796.1|  PREDICTED: cyclin-P3-1-like                        126   8e-32   
ref|XP_006444071.1|  hypothetical protein CICLE_v10021982mg             127   8e-32   
gb|EYU46584.1|  hypothetical protein MIMGU_mgv1a013898mg                126   9e-32   
ref|XP_010684268.1|  PREDICTED: cyclin-P3-1-like                        126   1e-31   
ref|XP_007200546.1|  hypothetical protein PRUPE_ppa011715mg             125   1e-31   
ref|NP_001053459.1|  Os04g0544200                                       125   1e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003554251.1|  PREDICTED: cyclin-P3-1-like                        126   2e-31   
ref|XP_004956426.1|  PREDICTED: cyclin-P4-1-like                        125   2e-31   
ref|XP_004247165.1|  PREDICTED: cyclin-P3-1                             125   2e-31   
ref|XP_008246475.1|  PREDICTED: cyclin-P3-1                             125   2e-31   
ref|XP_010277841.1|  PREDICTED: cyclin-P3-1-like                        125   2e-31   
ref|XP_006349677.1|  PREDICTED: cyclin-P3-1-like isoform X1             125   2e-31   
ref|XP_006349678.1|  PREDICTED: cyclin-P3-1-like isoform X2             125   2e-31   
ref|XP_008368850.1|  PREDICTED: cyclin-P3-1-like                        124   3e-31   
gb|KCW58844.1|  hypothetical protein EUGRSUZ_H01477                     124   3e-31   
ref|XP_003568501.1|  PREDICTED: cyclin-P3-1                             125   4e-31   
ref|XP_004230189.1|  PREDICTED: cyclin-P3-1 isoform X1                  124   5e-31   
ref|XP_002512374.1|  cyclin-dependent protein kinase, putative          124   5e-31   Ricinus communis
ref|XP_010070213.1|  PREDICTED: cyclin-P3-1 isoform X2                  124   5e-31   
gb|ACU23185.1|  unknown                                                 125   6e-31   Glycine max [soybeans]
ref|XP_009355462.1|  PREDICTED: cyclin-P3-1-like                        124   6e-31   
gb|AFW72776.1|  hypothetical protein ZEAMMB73_097402                    123   6e-31   
ref|XP_010070212.1|  PREDICTED: cyclin-P3-1 isoform X1                  124   7e-31   
ref|XP_002306774.1|  cyclin family protein                              124   7e-31   Populus trichocarpa [western balsam poplar]
gb|KDO56332.1|  hypothetical protein CISIN_1g045984mg                   121   8e-31   
ref|XP_010552777.1|  PREDICTED: cyclin-U3-1                             124   9e-31   
gb|EAZ24027.1|  hypothetical protein OsJ_07758                          123   1e-30   Oryza sativa Japonica Group [Japonica rice]
gb|ABK92673.1|  unknown                                                 122   1e-30   Populus trichocarpa [western balsam poplar]
dbj|BAD08008.1|  PREG-like protein                                      124   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010938791.1|  PREDICTED: cyclin-P3-1-like isoform X2             123   1e-30   
ref|XP_011026170.1|  PREDICTED: cyclin-P3-1                             123   2e-30   
ref|XP_010468884.1|  PREDICTED: cyclin-U3-1                             123   2e-30   
ref|XP_006402307.1|  hypothetical protein EUTSA_v10006204mg             123   2e-30   
ref|XP_010938790.1|  PREDICTED: cyclin-P3-1-like isoform X1             123   2e-30   
ref|XP_011032712.1|  PREDICTED: cyclin-P3-1-like isoform X2             122   2e-30   
ref|XP_004952051.1|  PREDICTED: cyclin-P4-1-like                        123   2e-30   
ref|XP_011032710.1|  PREDICTED: cyclin-P3-1-like isoform X1             122   3e-30   
ref|XP_007147054.1|  hypothetical protein PHAVU_006G092300g             120   4e-30   
gb|ACG23927.1|  nuc-1 negative regulatory protein preg                  122   4e-30   Zea mays [maize]
ref|XP_006368127.1|  PREDICTED: cyclin-P3-1-like                        120   4e-30   
ref|XP_008386497.1|  PREDICTED: cyclin-P3-1-like                        121   5e-30   
ref|XP_006386267.1|  hypothetical protein POPTR_0002s05370g             121   5e-30   
gb|KHG04231.1|  Cyclin-U2-2 -like protein                               121   6e-30   
gb|EMT04744.1|  hypothetical protein F775_06753                         122   6e-30   
gb|KDP23522.1|  hypothetical protein JCGZ_23355                         121   6e-30   
sp|Q75HV0.1|CCP31_ORYSJ  RecName: Full=Cyclin-P3-1; Short=CycP3;1       122   7e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EEC79180.1|  hypothetical protein OsI_19875                          121   7e-30   Oryza sativa Indica Group [Indian rice]
gb|EEE63644.1|  hypothetical protein OsJ_18461                          121   7e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010091558.1|  hypothetical protein L484_000801                   120   7e-30   
emb|CBI36766.3|  unnamed protein product                                120   8e-30   
ref|XP_010258918.1|  PREDICTED: cyclin-U2-1                             121   8e-30   
ref|XP_006386269.1|  hypothetical protein POPTR_0002s05370g             121   9e-30   
ref|XP_002302113.2|  hypothetical protein POPTR_0002s05370g             121   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009760207.1|  PREDICTED: cyclin-P3-1-like isoform X5             121   1e-29   
ref|XP_002280845.2|  PREDICTED: cyclin-P3-1                             121   1e-29   Vitis vinifera
ref|XP_003553729.1|  PREDICTED: cyclin-P3-1-like                        119   1e-29   
ref|XP_006654367.1|  PREDICTED: cyclin-P3-1-like                        121   1e-29   
gb|AFW69940.1|  nuc-1 negative regulatory protein preg                  121   1e-29   
ref|XP_006361848.1|  PREDICTED: cyclin-P3-1-like                        120   1e-29   
ref|XP_009600659.1|  PREDICTED: cyclin-P3-1-like                        120   2e-29   
ref|XP_007208184.1|  hypothetical protein PRUPE_ppa020960mg             119   2e-29   
ref|XP_006291814.1|  hypothetical protein CARUB_v10017991mg             120   2e-29   
ref|XP_009760204.1|  PREDICTED: cyclin-P3-1-like isoform X3             120   2e-29   
ref|XP_002310464.1|  cyclin family protein                              120   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_009760205.1|  PREDICTED: cyclin-P3-1-like isoform X4             120   2e-29   
gb|KDP21459.1|  hypothetical protein JCGZ_21930                         120   2e-29   
ref|XP_006433309.1|  hypothetical protein CICLE_v10002472mg             119   2e-29   
ref|XP_004304998.1|  PREDICTED: cyclin-P3-1-like                        120   3e-29   
ref|XP_010258919.1|  PREDICTED: cyclin-U2-1-like                        120   3e-29   
gb|EMS49132.1|  hypothetical protein TRIUR3_24170                       123   3e-29   
ref|XP_009760203.1|  PREDICTED: cyclin-P3-1-like isoform X2             120   4e-29   
ref|XP_011003213.1|  PREDICTED: cyclin-U1-1                             119   4e-29   
ref|XP_007030853.1|  Cyclin family protein, putative isoform 2          119   4e-29   
ref|XP_009760202.1|  PREDICTED: cyclin-P3-1-like isoform X1             120   4e-29   
ref|XP_010413196.1|  PREDICTED: cyclin-U3-1-like                        119   4e-29   
ref|XP_010544609.1|  PREDICTED: cyclin-U2-1-like                        119   4e-29   
gb|KDP28804.1|  hypothetical protein JCGZ_14575                         119   5e-29   
gb|KHG29326.1|  Cyclin-U2-1 -like protein                               119   6e-29   
dbj|BAJ87584.1|  predicted protein                                      120   6e-29   
ref|XP_010546693.1|  PREDICTED: cyclin-P3-1                             119   6e-29   
dbj|BAJ91153.1|  predicted protein                                      120   7e-29   
ref|XP_010512385.1|  PREDICTED: cyclin-U2-2                             119   7e-29   
ref|XP_004514236.1|  PREDICTED: cyclin-U2-2-like                        118   8e-29   
ref|XP_004289157.1|  PREDICTED: cyclin-U1-1-like                        118   1e-28   
ref|XP_004148894.1|  PREDICTED: cyclin-P3-1-like                        118   1e-28   
ref|XP_008451358.1|  PREDICTED: cyclin-P3-1                             118   1e-28   
ref|XP_010532486.1|  PREDICTED: cyclin-U1-1                             117   1e-28   
gb|ACJ84839.1|  unknown                                                 118   1e-28   
ref|XP_002511648.1|  Nuc-1 negative regulatory protein preg, puta...    118   1e-28   
ref|XP_002878497.1|  hypothetical protein ARALYDRAFT_486815             117   1e-28   
ref|XP_002275585.1|  PREDICTED: cyclin-U2-1                             118   2e-28   
ref|XP_010089246.1|  hypothetical protein L484_021775                   118   2e-28   
ref|XP_010464054.1|  PREDICTED: cyclin-P3-1-like                        117   2e-28   
ref|XP_002515728.1|  Nuc-1 negative regulatory protein preg, puta...    117   2e-28   
ref|XP_004158916.1|  PREDICTED: cyclin-P3-1-like isoform 1              117   3e-28   
ref|XP_010469167.1|  PREDICTED: cyclin-U2-2-like                        117   3e-28   
ref|XP_010692155.1|  PREDICTED: cyclin-U2-1                             117   3e-28   
ref|XP_010413544.1|  PREDICTED: cyclin-U2-2-like                        117   3e-28   
ref|XP_009344074.1|  PREDICTED: cyclin-U2-1-like isoform X1             117   3e-28   
ref|XP_010056430.1|  PREDICTED: cyclin-U2-1-like                        117   3e-28   
ref|XP_002186459.1|  predicted protein                                  115   3e-28   
ref|XP_004151930.1|  PREDICTED: cyclin-U1-1-like                        117   4e-28   
ref|XP_010485974.1|  PREDICTED: cyclin-P3-1-like isoform X2             116   4e-28   
ref|XP_008455834.1|  PREDICTED: cyclin-U1-1                             117   4e-28   
ref|XP_007052178.1|  Cyclin p3,2                                        116   5e-28   
ref|XP_006408089.1|  hypothetical protein EUTSA_v10021509mg             116   5e-28   
ref|XP_006851148.1|  hypothetical protein AMTR_s00043p00103760          116   5e-28   
ref|XP_006445331.1|  hypothetical protein CICLE_v10024289mg             116   5e-28   
ref|XP_002301262.1|  hypothetical protein POPTR_0002s14440g             116   5e-28   
ref|XP_006291787.1|  hypothetical protein CARUB_v10017957mg             116   6e-28   
ref|XP_004306960.1|  PREDICTED: cyclin-U2-1-like                        116   7e-28   
ref|NP_191871.1|  cyclin p1;1                                           115   8e-28   
gb|AAM64958.1|  unknown                                                 115   8e-28   
ref|XP_011017452.1|  PREDICTED: cyclin-U2-1-like                        115   9e-28   
ref|XP_009116978.1|  PREDICTED: cyclin-U3-1                             115   1e-27   
emb|CDY05158.1|  BnaC05g46450D                                          117   1e-27   
ref|XP_009604946.1|  PREDICTED: cyclin-U2-2-like                        115   1e-27   
ref|XP_010512719.1|  PREDICTED: cyclin-U3-1-like                        115   1e-27   
gb|KFK35259.1|  hypothetical protein AALP_AA5G262100                    115   1e-27   
ref|XP_005831237.1|  hypothetical protein GUITHDRAFT_43885              112   1e-27   
emb|CBN76823.1|  conserved unknown protein                              115   1e-27   
ref|XP_008459728.1|  PREDICTED: cyclin-U2-1                             117   1e-27   
ref|XP_010524404.1|  PREDICTED: cyclin-U2-2                             115   2e-27   
ref|XP_004172662.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U1-1-...    115   2e-27   
gb|EMS47431.1|  hypothetical protein TRIUR3_19932                       113   2e-27   
ref|XP_011023596.1|  PREDICTED: cyclin-P3-1-like                        114   2e-27   
ref|XP_010035608.1|  PREDICTED: cyclin-U1-1-like                        115   2e-27   
ref|XP_009342256.1|  PREDICTED: cyclin-U1-1-like                        115   2e-27   
ref|XP_007221195.1|  hypothetical protein PRUPE_ppa024897mg             115   2e-27   
ref|XP_006375761.1|  hypothetical protein POPTR_0013s02390g             114   2e-27   
ref|XP_004140492.1|  PREDICTED: cyclin-U2-1-like                        115   2e-27   
ref|XP_008232567.1|  PREDICTED: cyclin-U2-1                             115   2e-27   
emb|CDY18769.1|  BnaAnng02340D                                          114   2e-27   
ref|XP_008375805.1|  PREDICTED: cyclin-U2-1-like isoform X1             114   2e-27   
ref|XP_002884502.1|  hypothetical protein ARALYDRAFT_477821             114   2e-27   
ref|XP_006298431.1|  hypothetical protein CARUB_v10014501mg             115   3e-27   
ref|XP_010264310.1|  PREDICTED: cyclin-U2-2-like isoform X1             114   3e-27   
ref|XP_010264309.1|  PREDICTED: cyclin-U2-1-like                        114   3e-27   
ref|XP_006838178.1|  hypothetical protein AMTR_s00106p00124350          114   3e-27   
ref|XP_010425982.1|  PREDICTED: cyclin-P3-1                             112   3e-27   
ref|XP_009398116.1|  PREDICTED: cyclin-P2-1-like                        114   4e-27   
ref|XP_006347912.1|  PREDICTED: cyclin-U2-2-like                        114   4e-27   
ref|XP_007215945.1|  hypothetical protein PRUPE_ppa011252mg             114   4e-27   
ref|XP_008230100.1|  PREDICTED: cyclin-U1-1                             114   4e-27   
ref|XP_004139180.1|  PREDICTED: cyclin-P3-1-like                        114   4e-27   
ref|XP_002876566.1|  CYCP3_2                                            114   5e-27   
gb|EYU43110.1|  hypothetical protein MIMGU_mgv1a013764mg                113   5e-27   
ref|XP_004156423.1|  PREDICTED: cyclin-P3-1-like                        113   5e-27   
ref|XP_009782728.1|  PREDICTED: cyclin-U2-2-like                        114   5e-27   
ref|XP_009116735.1|  PREDICTED: cyclin-U2-2                             114   6e-27   
emb|CDY41156.1|  BnaA09g38590D                                          114   6e-27   
ref|XP_002289712.1|  predicted protein                                  119   7e-27   
ref|XP_002320709.1|  hypothetical protein POPTR_0014s06180g             113   8e-27   
ref|XP_007030852.1|  Cyclin family protein, putative isoform 1          114   1e-26   
emb|CDP09478.1|  unnamed protein product                                113   1e-26   
ref|XP_006402570.1|  hypothetical protein EUTSA_v10006220mg             113   1e-26   
ref|XP_010518122.1|  PREDICTED: cyclin-U2-1-like                        112   1e-26   
ref|XP_008454704.1|  PREDICTED: cyclin-P3-1                             112   1e-26   
ref|XP_010506446.1|  PREDICTED: cyclin-U2-1                             112   1e-26   
emb|CDY18791.1|  BnaAnng02560D                                          112   1e-26   
ref|XP_010508213.1|  PREDICTED: cyclin-U2-1-like                        112   1e-26   
ref|XP_004037104.1|  hypothetical protein IMG5_061170                   112   1e-26   
ref|XP_011033883.1|  PREDICTED: cyclin-U2-2-like                        112   2e-26   
emb|CDY27777.1|  BnaA05g31860D                                          112   2e-26   
emb|CDP15519.1|  unnamed protein product                                112   2e-26   
emb|CDX76682.1|  BnaC08g32680D                                          112   3e-26   
ref|XP_010043088.1|  PREDICTED: cyclin-P3-1-like isoform X2             112   3e-26   
ref|XP_004229782.1|  PREDICTED: cyclin-U2-1-like                        112   3e-26   
ref|XP_004164976.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U2-1-...    111   3e-26   
ref|XP_011084762.1|  PREDICTED: cyclin-U4-1-like isoform X2             110   3e-26   
gb|KHN05788.1|  Cyclin-U2-1                                             111   4e-26   
ref|XP_009104271.1|  PREDICTED: cyclin-U2-2-like                        111   4e-26   
gb|KFK37958.1|  hypothetical protein AALP_AA3G051800                    111   4e-26   
ref|XP_010043087.1|  PREDICTED: cyclin-P3-1-like isoform X1             111   4e-26   
ref|NP_191614.1|  cyclin p3;2                                           111   4e-26   
gb|EJK44168.1|  hypothetical protein THAOC_37318                        114   5e-26   
ref|XP_009147251.1|  PREDICTED: cyclin-P3-1-like                        110   5e-26   
emb|CDX67834.1|  BnaA07g18740D                                          111   6e-26   
ref|XP_011090176.1|  PREDICTED: cyclin-U2-1-like                        110   6e-26   
ref|XP_010674759.1|  PREDICTED: cyclin-P3-1 isoform X1                  110   7e-26   
ref|XP_006382603.1|  hypothetical protein POPTR_0005s03660g             110   7e-26   
ref|XP_010674760.1|  PREDICTED: cyclin-P3-1 isoform X2                  110   8e-26   
emb|CDX71800.1|  BnaC08g30740D                                          110   8e-26   
ref|XP_007140811.1|  hypothetical protein PHAVU_008G144200g             110   1e-25   
ref|XP_010919573.1|  PREDICTED: cyclin-U2-2-like                        110   1e-25   
ref|XP_009124077.1|  PREDICTED: cyclin-P3-1-like isoform X2             110   1e-25   
gb|KFK37301.1|  hypothetical protein AALP_AA4G239500                    110   1e-25   
gb|KDP25867.1|  hypothetical protein JCGZ_22897                         110   1e-25   
ref|XP_009143100.1|  PREDICTED: cyclin-U2-1                             110   1e-25   
emb|CDY18953.1|  BnaC04g03970D                                          110   1e-25   
ref|XP_009124076.1|  PREDICTED: cyclin-P3-1-like isoform X1             109   1e-25   
ref|XP_006397689.1|  hypothetical protein EUTSA_v10001623mg             110   1e-25   
ref|XP_010485972.1|  PREDICTED: cyclin-P3-1-like isoform X1             110   1e-25   
ref|NP_182034.1|  cyclin p3;1                                           110   1e-25   
ref|XP_009039561.1|  hypothetical protein AURANDRAFT_54525              108   2e-25   
ref|XP_008802822.1|  PREDICTED: cyclin-U2-2-like                        109   2e-25   
ref|XP_002880155.1|  CYCP3_1                                            109   2e-25   
ref|XP_006294970.1|  hypothetical protein CARUB_v10024026mg             109   3e-25   
gb|KFK27916.1|  hypothetical protein AALP_AA8G446900                    108   3e-25   
ref|XP_005536025.1|  similar to PREG1-like negative regulator           111   3e-25   
emb|CDX98427.1|  BnaC06g17880D                                          109   3e-25   
ref|XP_010312651.1|  PREDICTED: cyclin-P3-1 isoform X2                  107   5e-25   
ref|XP_009133697.1|  PREDICTED: cyclin-U2-1-like                        108   5e-25   
ref|XP_010264311.1|  PREDICTED: cyclin-U2-2-like isoform X2             108   6e-25   
emb|CDX95626.1|  BnaC03g25070D                                          108   6e-25   
gb|EAS03399.2|  amine-terminal domain cyclin                            107   6e-25   
ref|XP_004027597.1|  hypothetical protein IMG5_180520                   106   1e-24   
gb|EYU31943.1|  hypothetical protein MIMGU_mgv1a013240mg                107   2e-24   
ref|XP_001023644.1|  Cyclin, N-terminal domain containing protein       108   2e-24   
ref|NP_001030642.1|  cyclin family protein                              106   2e-24   
ref|XP_011081410.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-U2-1-...    105   4e-24   
ref|XP_009344075.1|  PREDICTED: cyclin-U2-1-like isoform X2             105   7e-24   
ref|XP_004976447.1|  PREDICTED: cyclin-P2-1-like                        105   8e-24   
emb|CBK25549.2|  unnamed protein product                                103   9e-24   
gb|EEC72391.1|  hypothetical protein OsI_05672                          104   3e-23   
gb|AAF27039.1|AC009177_29  hypothetical protein                         107   5e-23   
ref|XP_007043344.1|  Cyclin p2,1 isoform 1                              103   5e-23   
ref|XP_008375806.1|  PREDICTED: cyclin-U2-1-like isoform X2             103   6e-23   
gb|KFG29715.1|  cyclin2 related protein                                 107   6e-23   
ref|XP_008887683.1|  cyclin2 related protein                            107   7e-23   
gb|ESS33416.1|  cyclin2 related protein                                 107   7e-23   
ref|XP_002368826.1|  cyclin, N-terminal domain-containing protein       107   7e-23   
gb|EPR57281.1|  cyclin2 related protein                                 107   7e-23   
ref|XP_004037383.1|  n-terminal domain protein                          101   7e-23   
ref|XP_003880818.1|  hypothetical protein NCLIV_038600                  107   8e-23   
emb|CCA25579.1|  conserved hypothetical protein                         102   1e-22   
dbj|GAM26318.1|  hypothetical protein SAMD00019534_094930               103   1e-22   
ref|XP_002280596.1|  PREDICTED: cyclin-U1-1                             102   1e-22   
gb|KHN36553.1|  Cyclin-U1-1                                             101   1e-22   
emb|CDH50596.1|  pho85p cyclin of the pho80p pcl7p                      102   2e-22   
ref|NP_001235448.1|  uncharacterized protein LOC100527137               101   2e-22   
ref|XP_642587.1|  hypothetical protein DDB_G0277481                     102   3e-22   
ref|NP_001053503.1|  Os04g0552300                                       100   3e-22   
ref|XP_003286504.1|  hypothetical protein DICPUDRAFT_97404              102   3e-22   
ref|XP_006447491.1|  hypothetical protein CICLE_v10016515mg             100   4e-22   
ref|XP_003540320.1|  PREDICTED: cyclin-U1-1-like                        100   4e-22   
gb|KDO57284.1|  hypothetical protein CISIN_1g0277331mg                98.2    5e-22   
ref|XP_007149955.1|  hypothetical protein PHAVU_005G113500g             100   5e-22   
gb|ABX10779.1|  putative cyclin-dependent protein kinase              99.8    5e-22   
ref|XP_010240959.1|  PREDICTED: cyclin-U1-1                             100   5e-22   
gb|EFW47511.2|  cyclin                                                  104   5e-22   
ref|XP_004346122.1|  cyclin                                             104   5e-22   
dbj|BAJ86100.1|  predicted protein                                      100   6e-22   
ref|XP_003294804.1|  hypothetical protein DICPUDRAFT_100068             102   6e-22   
ref|XP_003519057.1|  PREDICTED: cyclin-U4-1-like                      96.7    7e-22   
ref|XP_003881360.1|  hypothetical protein NCLIV_043920                  104   8e-22   
gb|KFH13723.1|  cyclin2 related protein                                 100   9e-22   
emb|CCI49379.1|  unnamed protein product                                100   1e-21   
ref|XP_005825621.1|  hypothetical protein GUITHDRAFT_154642             100   1e-21   
ref|XP_001423583.1|  hypothetical protein                             97.8    1e-21   
emb|CDY02124.1|  BnaA03g40430D                                        96.7    1e-21   
ref|XP_004243454.1|  PREDICTED: cyclin-U1-1                           99.8    1e-21   
dbj|GAM22223.1|  hypothetical protein SAMD00019534_053980             99.0    1e-21   
gb|EFA80127.1|  Non-receptor tyrosine kinase                            100   1e-21   
emb|CDH49619.1|  pho85p cyclin of the pho80p pcl7p                    99.8    2e-21   
ref|XP_637698.1|  hypothetical protein DDB_G0286485                     100   2e-21   
gb|EPB85030.1|  hypothetical protein HMPREF1544_08234                 98.6    2e-21   
dbj|GAM20803.1|  hypothetical protein SAMD00019534_039780             99.8    2e-21   
ref|XP_009829187.1|  hypothetical protein H257_05876                  99.0    3e-21   
ref|XP_009601525.1|  PREDICTED: cyclin-U1-1                           98.6    3e-21   
gb|KHG13275.1|  Cyclin-U1-1 -like protein                             98.2    3e-21   
ref|XP_004035721.1|  n-terminal domain protein                        97.4    3e-21   
ref|XP_009782196.1|  PREDICTED: cyclin-U1-1                           98.6    3e-21   
emb|CDS11602.1|  hypothetical protein LRAMOSA03865                    99.4    3e-21   
ref|XP_002885474.1|  CYCP2_1                                          97.8    3e-21   
ref|XP_001434955.1|  hypothetical protein                             96.7    4e-21   
ref|XP_005855406.1|  hypothetical protein NGA_2092720                   101   4e-21   
gb|EWM24594.1|  cyclin-dependent protein                                101   4e-21   
ref|XP_003597030.1|  Cyclin-U1-1                                      98.2    5e-21   
ref|XP_003295130.1|  hypothetical protein DICPUDRAFT_93345            99.4    5e-21   
ref|XP_001434000.1|  hypothetical protein                             96.3    5e-21   
ref|NP_188825.1|  cyclin p2;1                                         97.4    5e-21   
ref|XP_008875754.1|  hypothetical protein H310_11003                  98.2    6e-21   
emb|CDM81206.1|  unnamed protein product                              97.4    7e-21   
gb|EPS61803.1|  hypothetical protein M569_12990                       95.5    9e-21   
emb|CBK23866.2|  unnamed protein product                              96.3    1e-20   
gb|KFK39504.1|  hypothetical protein AALP_AA3G252300                  96.3    1e-20   
ref|XP_009353246.1|  PREDICTED: cyclin-U1-1                           97.1    1e-20   
ref|XP_008884808.1|  cyclin, N-terminal domain-containing protein       101   1e-20   
ref|XP_003517014.1|  PREDICTED: cyclin-U2-1-like                      96.7    1e-20   
gb|KFH07073.1|  cyclin, N-terminal domain-containing protein            101   1e-20   
gb|KFG59259.1|  cyclin, N-terminal domain-containing protein            101   1e-20   
gb|KFG33290.1|  cyclin, N-terminal domain-containing protein            101   1e-20   
gb|KFG28464.1|  cyclin, N-terminal domain-containing protein            101   1e-20   
gb|EPR57429.1|  cyclin, N-terminal domain-containing protein            101   1e-20   
ref|XP_002370326.1|  cyclin, N-terminal domain-containing protein       101   1e-20   
ref|XP_006599134.1|  PREDICTED: cyclin-U4-1-like isoform X1           95.5    2e-20   
ref|XP_001443436.1|  hypothetical protein                             94.7    2e-20   
ref|XP_011079017.1|  PREDICTED: cyclin-U1-1                           95.9    2e-20   
ref|XP_002649130.1|  cyclin-related 2 family protein                  97.4    2e-20   
ref|XP_008815154.1|  hypothetical protein C922_01326                  96.3    2e-20   
ref|XP_001433127.1|  hypothetical protein                             94.4    2e-20   
ref|XP_001449679.1|  hypothetical protein                             94.4    3e-20   
emb|CDI87736.1|  cyclin, N-terminal domain-containing protein, pu...  97.1    3e-20   
gb|KDO30023.1|  hypothetical protein SPRG_05213                       95.9    4e-20   
ref|XP_008610721.1|  hypothetical protein SDRG_06701                  95.9    4e-20   
emb|CDI80154.1|  cyclin, N-terminal domain-containing protein, pu...  96.7    4e-20   
emb|CDJ46065.1|  cyclin, N-terminal domain-containing protein, pu...  97.1    4e-20   
ref|XP_008379611.1|  PREDICTED: cyclin-U1-1                           95.5    4e-20   
ref|XP_003580288.1|  PREDICTED: cyclin-P2-1-like                      95.5    4e-20   
gb|EPB86347.1|  hypothetical protein HMPREF1544_06886                 96.7    4e-20   



>ref|XP_009760376.1| PREDICTED: cyclin-U4-1-like [Nicotiana sylvestris]
Length=205

 Score =   203 bits (517),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAYIYL RFS+RQPLL INSFNVHRLLI SVLVS KFMDD+FYN
Sbjct  57   LERIFKYANCSPSCFVVAYIYLDRFSQRQPLLPINSFNVHRLLITSVLVSAKFMDDIFYN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI TKEMN+LEVDFLFGIGF LNVTP+TFHTYCS+   ++  + P  P    
Sbjct  117  NAYYAKVGGISTKEMNLLEVDFLFGIGFQLNVTPTTFHTYCSYLQTEMLLESPPMPMPSS  176

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQHH  224
             L    + +H  CCI ED+      HQQH 
Sbjct  177  SLKIGRNVNHQYCCINEDEST----HQQHE  202



>ref|XP_009613666.1| PREDICTED: cyclin-U4-1-like [Nicotiana tomentosiformis]
Length=209

 Score =   197 bits (502),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 117/156 (75%), Gaps = 12/156 (8%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAYIYL RFS+RQPLL INSFNVHRLLI SVLVS KFMDD+FYN
Sbjct  57   LERIFKYANCSPSCFVVAYIYLDRFSQRQPLLPINSFNVHRLLITSVLVSAKFMDDIFYN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN+LEVDFLFGIGF LNVTP+TFHTYCS+   ++  + P  P  + 
Sbjct  117  NAYYAKVGGISTNEMNLLEVDFLFGIGFQLNVTPTTFHTYCSYLQTEMLLESPPMPMPMP  176

Query  313  ------QLGEVVSNHHHQCCIEEDDECIDHHHQQHH  224
                  ++G  V  +H  CCI ED+      HQQH 
Sbjct  177  MPSSSLKIGRNV--NHQYCCINEDEST----HQQHE  206



>ref|XP_006366726.1| PREDICTED: cyclin-U4-1-like [Solanum tuberosum]
Length=203

 Score =   187 bits (475),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 106/145 (73%), Gaps = 10/145 (7%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAYIYL RFS+ QPLL INSFNVHRLLI SVLVS KFMDD+FYN
Sbjct  57   LERIFKYANCSPSCFIVAYIYLDRFSQMQPLLPINSFNVHRLLITSVLVSAKFMDDIFYN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            N YY KVGGI T+EMN+LEVDFLFGIGF LNVTP+TFHTYCS+          H    + 
Sbjct  117  NGYYGKVGGISTREMNLLEVDFLFGIGFQLNVTPTTFHTYCSYL---------HTEMLML  167

Query  313  QLGEVVSNHHHQCCIEEDDECIDHH  239
            ++   +   + QC +  DDE   H 
Sbjct  168  EIPMPLKIVNQQCWV-NDDESSTHE  191



>gb|EYU20163.1| hypothetical protein MIMGU_mgv1a024090mg [Erythranthe guttata]
Length=205

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 110/149 (74%), Gaps = 2/149 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAYIYL RF+++QPLL INSFNVHRLLIASVLVS KFMDD+FYN
Sbjct  56   LERIFKYANCSPSCFVVAYIYLDRFAQKQPLLPINSFNVHRLLIASVLVSAKFMDDIFYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAK+GGI T EMN+LE+DFLFG+GF LNV+ STFH YCS+   ++  + P  P  + 
Sbjct  116  NAYYAKIGGITTAEMNLLEMDFLFGLGFQLNVSISTFHHYCSYLQREMLLEFP--PLIIS  173

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
                +  +H    C+ E+       HQQ 
Sbjct  174  PNIGITDDHKLLFCVNEEGSTTSTTHQQQ  202



>ref|XP_004235192.1| PREDICTED: cyclin-U4-1 [Solanum lycopersicum]
Length=196

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 105/145 (72%), Gaps = 9/145 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAYIYL RFS+ QPLL INSFNVHRLLI SVLVS KFMDD+FYN
Sbjct  54   LERIFKYANCSPSCFIVAYIYLDRFSQMQPLLPINSFNVHRLLITSVLVSAKFMDDIFYN  113

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            N YY KVGGI T+EMN+LEVDFLFGIGF LNVTP+TFHTYCS+          H    + 
Sbjct  114  NGYYGKVGGISTREMNLLEVDFLFGIGFQLNVTPTTFHTYCSYL---------HTEMLML  164

Query  313  QLGEVVSNHHHQCCIEEDDECIDHH  239
            ++   +   + Q C   DDE   H 
Sbjct  165  EIPMPLKIVNQQYCYVNDDESSTHE  189



>gb|KDP22483.1| hypothetical protein JCGZ_26314 [Jatropha curcas]
Length=202

 Score =   186 bits (473),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQP L INSFNVHRLLI SVLVS KFMDD++YN
Sbjct  56   LERIFKYANCSPSCFVVAYVYLDRFAQRQPSLPINSFNVHRLLITSVLVSAKFMDDIYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI T EMN+LEVDFLFG+GF LNV P+TFHTYCS+   ++  Q P
Sbjct  116  NAYYAKVGGISTAEMNVLEVDFLFGLGFQLNVAPTTFHTYCSYLQREMLMQSP  168



>ref|XP_010246095.1| PREDICTED: cyclin-U4-1-like [Nelumbo nucifera]
Length=203

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 111/149 (74%), Gaps = 4/149 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQP L INS N+HRLLI SV+V+ KFMDD++YN
Sbjct  56   LERIFKYANCSPSCFVVAYVYLDRFAQRQPSLPINSLNIHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+ F+LNVTP+T++TYCS+   ++  + P     ++
Sbjct  116  NAYYAKVGGINTTEMNYLEVDFLFGLSFHLNVTPNTYYTYCSYLQREVYIESPL--SLVE  173

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
                +V +    CC  EDD   +HH QQ 
Sbjct  174  TPLNLVRSSKLHCCFNEDDS--NHHQQQQ  200



>ref|XP_002511026.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF51628.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=203

 Score =   186 bits (472),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 105/140 (75%), Gaps = 1/140 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFV+AY+YL RF++RQP   INSFNVHRLLI SVLVS KFMDD++YN
Sbjct  57   LERIFKYANCSPSCFVIAYVYLDRFAQRQPSFPINSFNVHRLLITSVLVSAKFMDDIYYN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMNILEVDFLFG+GF LNVTP+TFHTYCS+   ++  Q   +     
Sbjct  117  NAYYAKVGGISTSEMNILEVDFLFGLGFQLNVTPNTFHTYCSYLQREMLVQSSQHQLVEP  176

Query  313  QLGEVVSNHHHQCCIEEDDE  254
             L    +   H CC  ED+ 
Sbjct  177  PLNMARALKIH-CCFSEDES  195



>gb|KHN22156.1| Cyclin-U4-1 [Glycine soja]
Length=206

 Score =   186 bits (471),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 111/150 (74%), Gaps = 4/150 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++RQP L INSFNVHRLLI SV+V+ KFMDDL+YN
Sbjct  57   LERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDLYYN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP-HYPGFL  317
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP TF  YC+H  +++   +P ++    
Sbjct  117  NAYYAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEMLLMQPLNFADSF  176

Query  316  QQLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
              LG+ ++  H   C  E DE   H  QQ 
Sbjct  177  LSLGKSLNKAH--LCYNE-DESSSHQKQQQ  203



>ref|XP_006397655.1| hypothetical protein EUTSA_v10001641mg [Eutrema salsugineum]
 gb|ESQ39108.1| hypothetical protein EUTSA_v10001641mg [Eutrema salsugineum]
Length=199

 Score =   185 bits (470),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 106/148 (72%), Gaps = 9/148 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+VS KF+DDL+YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI TKEMN+LE+DFLFG+GF+LNVTP+TFH Y S+   ++          LQ
Sbjct  118  NAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLQKEMT--------LLQ  169

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             L  VV           DDE   H  QQ
Sbjct  170  PLSLVVVAPPRSVITFNDDEA-SHQKQQ  196



>ref|XP_004307245.1| PREDICTED: cyclin-U4-1-like [Fragaria vesca subsp. vesca]
Length=204

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 109/151 (72%), Gaps = 8/151 (5%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SC +VAY+YL RF+++QP L INSFNVHRLLI SV+V+ KFMDDL+YN
Sbjct  56   LERIFKYANCSPSCLIVAYVYLDRFTQKQPSLPINSFNVHRLLITSVMVAAKFMDDLYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+ FNLNVTP+TF TYCS+   ++   +P     + 
Sbjct  116  NAYYAKVGGISTAEMNFLEVDFLFGLSFNLNVTPTTFTTYCSYLQREMLMLQPPLQSSID  175

Query  313  ---QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
                LG+ +  H    C +EDD    H  QQ
Sbjct  176  SSLSLGKSLKLH---LCFDEDDP--SHKQQQ  201



>ref|XP_008232383.1| PREDICTED: cyclin-U4-1-like [Prunus mume]
Length=202

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 106/148 (72%), Gaps = 3/148 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SC +VAY+YL RFS+RQP L INS+NVHRLLIASV+V+ KFMDD++YN
Sbjct  55   LERIFKYANCSPSCLIVAYVYLDRFSQRQPTLPINSYNVHRLLIASVMVAAKFMDDMYYN  114

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+ FNLNVTPSTF TYCS+   ++   +P       
Sbjct  115  NAYYAKVGGISTIEMNFLEVDFLFGLSFNLNVTPSTFTTYCSYLQREMLLLQPPLDSADS  174

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             L    S   H C    D+E   H  QQ
Sbjct  175  SLSLGKSLKLHLCF---DEEEASHQPQQ  199



>gb|KDP28881.1| hypothetical protein JCGZ_14652 [Jatropha curcas]
Length=206

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 113/153 (74%), Gaps = 10/153 (7%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++RQP L INSFNVHRLLI SVLV+ KFMDD++YN
Sbjct  56   LERIFKYANCSPSCFIVAYVYLDRFAQRQPSLPINSFNVHRLLITSVLVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQ-RPHYPGFL  317
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP+TFHTYCS+   ++  Q +P  P  +
Sbjct  116  NAYYAKVGGISTIEMNYLEVDFLFGLGFHLNVTPNTFHTYCSYLQREMMLQPQPQPPLSI  175

Query  316  QQ----LGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             +    +G  +  H    C  ED+    H  QQ
Sbjct  176  AESSLNVGRSLKLH---LCFNEDE--TSHQKQQ  203



>ref|XP_007038242.1| Cyclin p4,1 [Theobroma cacao]
 gb|EOY22743.1| Cyclin p4,1 [Theobroma cacao]
Length=207

 Score =   184 bits (467),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 107/152 (70%), Gaps = 12/152 (8%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF + QP L INSFNVHRLLI SVLVS KFMDD++YN
Sbjct  61   LERIFKYANCSPSCFVVAYVYLDRFVQMQPSLPINSFNVHRLLITSVLVSAKFMDDIYYN  120

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T E+N+LE+DFLFG+GF LNVTPS FHTYCS    ++  Q P     LQ
Sbjct  121  NAYYAKVGGISTVELNLLELDFLFGLGFQLNVTPSDFHTYCSFLQREMWMQSP-----LQ  175

Query  313  QLGEVVSNHHHQ----CCIEEDDECIDHHHQQ  230
             L E   N        CC  ED+     H QQ
Sbjct  176  HLAEPSLNIGRPLKIHCCFNEDEST---HQQQ  204



>gb|KHG11686.1| Cyclin-U4-1 -like protein [Gossypium arboreum]
Length=214

 Score =   184 bits (466),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 114/155 (74%), Gaps = 16/155 (10%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF + QP L INS+NVHRLL+ SVLVS KFMDD++YN
Sbjct  65   LERIFKYANCSPSCFVVAYVYLDRFVQMQPSLPINSYNVHRLLLTSVLVSAKFMDDMYYN  124

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN+LEVDFLFG+GF+LNV P+TFHTYC+ F+ +    +  YP  LQ
Sbjct  125  NAYYAKVGGISTVEMNLLEVDFLFGLGFHLNVAPTTFHTYCT-FLQREMCMQIQYP--LQ  181

Query  313  QL--------GEVVSNHHHQCCIEEDDECIDHHHQ  233
            QL        G  +  H   CC +ED+    HHHQ
Sbjct  182  QLLPQPSFNIGRPLKIH---CCFKEDES--SHHHQ  211



>ref|XP_006375171.1| cyclin family protein [Populus trichocarpa]
 gb|ERP52968.1| cyclin family protein [Populus trichocarpa]
Length=202

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 108/149 (72%), Gaps = 6/149 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQP L INS NVHRLLI SVLVS KFMDD++YN
Sbjct  56   LERIFKYANCSPSCFVVAYVYLDRFAQRQPSLPINSLNVHRLLITSVLVSAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP-HYPGFL  317
            NAYYA+VGGI T EMN LEVDFLFG+GFNLNVTP+TFHTYCS+   ++  Q   +     
Sbjct  116  NAYYARVGGISTIEMNYLEVDFLFGLGFNLNVTPNTFHTYCSYLQREMMQQPSLNLAESS  175

Query  316  QQLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
              LG  +  H    C  ED+    H  QQ
Sbjct  176  LNLGRSLKVH---LCFNEDE--TSHQQQQ  199



>ref|XP_011032483.1| PREDICTED: cyclin-U4-1 [Populus euphratica]
Length=202

 Score =   183 bits (465),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQP L INS NVHRLLI SVLVS KFMDD++YN
Sbjct  56   LERIFKYANCSPSCFVVAYVYLDRFAQRQPSLPINSLNVHRLLITSVLVSAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQ  341
            NAYYA+VGGI T EMN LEVDFLFG+GFNLNVTP+TFHTYCS+   ++  Q
Sbjct  116  NAYYARVGGISTIEMNYLEVDFLFGLGFNLNVTPNTFHTYCSYLQREMMQQ  166



>ref|XP_006295023.1| hypothetical protein CARUB_v10024094mg [Capsella rubella]
 gb|EOA27921.1| hypothetical protein CARUB_v10024094mg [Capsella rubella]
Length=199

 Score =   182 bits (463),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 104/148 (70%), Gaps = 9/148 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+V+ KF+DDL+YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVAAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI TKEMN LE+DFLFG+GF LNVTP+TFH Y S+   ++          LQ
Sbjct  118  NAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFHAYFSYLQKEM--------TLLQ  169

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             L  VV           DDE   H  QQ
Sbjct  170  PLSLVVVPSSRSVITFNDDEA-SHQKQQ  196



>ref|XP_007218436.1| hypothetical protein PRUPE_ppa011642mg [Prunus persica]
 gb|EMJ19635.1| hypothetical protein PRUPE_ppa011642mg [Prunus persica]
Length=202

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 105/148 (71%), Gaps = 3/148 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SC +VAY+YL RFS+RQP L INS+NVHRLLI SV+V+ KFMDD++YN
Sbjct  55   LERIFKYANCSPSCLIVAYVYLDRFSQRQPTLPINSYNVHRLLITSVMVAAKFMDDMYYN  114

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+ FNLNVTPSTF TYCS+   ++   +P       
Sbjct  115  NAYYAKVGGISTIEMNFLEVDFLFGLSFNLNVTPSTFTTYCSYLQREMLLLQPPLDSADS  174

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             L    S   H C    D+E   H  QQ
Sbjct  175  SLSLGKSLKLHLCF---DEEEASHQPQQ  199



>ref|XP_010258734.1| PREDICTED: cyclin-U4-1-like [Nelumbo nucifera]
Length=189

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 106/148 (72%), Gaps = 17/148 (11%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAYIYL RF+++QP L INSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LERIFKYANCSPSCFVVAYIYLDRFAQKQPSLPINSFNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+ F+LNVTPSTFHTYCS+       QR  Y     
Sbjct  116  NAYYAKVGGIITTEMNYLEVDFLFGLSFHLNVTPSTFHTYCSYI------QREMY-----  164

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
                + S     CC  EDD    H  QQ
Sbjct  165  ----IESPLKLHCCFNEDDPT--HQQQQ  186



>gb|EYU40342.1| hypothetical protein MIMGU_mgv1a013920mg [Erythranthe guttata]
Length=206

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 110/155 (71%), Gaps = 15/155 (10%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SC++VAY+YL RF++ QP L INSFNVHRLLI SV+VS KFMDD++YN
Sbjct  57   LERIFKYANCSPSCYIVAYVYLDRFTQTQPSLPINSFNVHRLLITSVMVSAKFMDDMYYN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHY-----  329
            NAYYAKVGGI T EMN LE+DFLFG+GF+LNVTPSTF TYCS+   ++    PH+     
Sbjct  117  NAYYAKVGGISTTEMNFLELDFLFGMGFHLNVTPSTFQTYCSYLQREMMIH-PHFSVSEE  175

Query  328  PGFLQQLGEVVSNHHHQCCIEEDDECIDHHHQQHH  224
            P FL       S+     C  EDD      HQQ H
Sbjct  176  PSFL------YSSKLLHLCFNEDDSS---SHQQTH  201



>ref|XP_011085729.1| PREDICTED: cyclin-U4-1 [Sesamum indicum]
Length=209

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SC++VAY+YL RF++RQP L INSFNVHRLLI SV+VS KFMDD++YN
Sbjct  56   LERIFKYANCSPSCYIVAYVYLDRFTQRQPALPINSFNVHRLLITSVMVSAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQ  341
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP+TFHTYCS+   ++  Q
Sbjct  116  NAYYAKVGGISTTEMNFLEVDFLFGLGFHLNVTPTTFHTYCSYLQREMMLQ  166



>ref|XP_007218421.1| hypothetical protein PRUPE_ppa011572mg [Prunus persica]
 ref|XP_008234040.1| PREDICTED: cyclin-U4-1-like [Prunus mume]
 gb|EMJ19620.1| hypothetical protein PRUPE_ppa011572mg [Prunus persica]
Length=205

 Score =   182 bits (462),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKYA+CS SCFVVAY+YL RF++ QPLL I+SFNVHRLLIASVLVS KFMDD++YN
Sbjct  60   LQRIFKYADCSPSCFVVAYVYLDRFTQTQPLLPIDSFNVHRLLIASVLVSAKFMDDIYYN  119

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYA+VGGI T EMN+LEVDFLFG+GF LNVTP+TF+TYCS+   ++  Q P
Sbjct  120  NAYYARVGGISTAEMNLLEVDFLFGLGFQLNVTPATFYTYCSYLQREMLLQSP  172



>emb|CDP09417.1| unnamed protein product [Coffea canephora]
Length=206

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 105/140 (75%), Gaps = 2/140 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RI KYANCS SCF+V+YIYL RF++RQP L INSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LDRILKYANCSPSCFIVSYIYLDRFTQRQPALPINSFNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP+TFHTYCS+   ++  Q P       
Sbjct  116  NAYYAKVGGISTAEMNFLEVDFLFGLGFHLNVTPTTFHTYCSYLQREMLMQPPTINSAES  175

Query  313  QLGEVVSNHHHQCCIEEDDE  254
             L    S+  H C    DDE
Sbjct  176  SLCMGKSSKLHLCF--NDDE  193



>ref|XP_011076450.1| PREDICTED: cyclin-U4-1-like [Sesamum indicum]
Length=203

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RFS+RQPLL INSFNVHRLLIASVLVS KFMDD+FYN
Sbjct  56   LERIFKYANCSPSCFIVAYVYLDRFSQRQPLLPINSFNVHRLLIASVLVSAKFMDDIFYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN+LEVDFLFG+GF LNV+ +TFH Y S+   ++  + P       
Sbjct  116  NAYYAKVGGISTAEMNLLEVDFLFGLGFELNVSTATFHRYNSYLQREMLLEFPPLAAAPS  175

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             LG   +     C    ++E   H  QQ
Sbjct  176  PLGLGRTEKLRFCV---NNEGSTHQQQQ  200



>gb|KHN40524.1| Cyclin-U4-1 [Glycine soja]
Length=205

 Score =   182 bits (461),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 110/150 (73%), Gaps = 5/150 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++RQP L IN FNVHRLLI SV+V+ KFMDDL+YN
Sbjct  57   LERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINFFNVHRLLITSVMVAAKFMDDLYYN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP-HYPGFL  317
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP TF  YC+H  +++   +P ++    
Sbjct  117  NAYYAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEMLLMQPLNFADSS  176

Query  316  QQLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
              LG+ +  H    C  E DE   H +QQ 
Sbjct  177  LSLGKSLKAH---LCYNE-DESSSHQNQQQ  202



>ref|XP_007139676.1| hypothetical protein PHAVU_008G049600g [Phaseolus vulgaris]
 gb|ESW11670.1| hypothetical protein PHAVU_008G049600g [Phaseolus vulgaris]
Length=204

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 108/150 (72%), Gaps = 5/150 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++RQP L INSFNVHRLLI SV+V+ KFMDDL+YN
Sbjct  56   LERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDLYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP-HYPGFL  317
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP TF  YC+H   ++   +P  +    
Sbjct  116  NAYYAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQREMLLIQPLTFVDSS  175

Query  316  QQLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
              LG+ +  H    C  E DE   H  QQ 
Sbjct  176  LSLGKSLKAH---LCFNE-DESSSHQKQQQ  201



>ref|XP_003552477.1| PREDICTED: cyclin-U4-1-like [Glycine max]
Length=205

 Score =   181 bits (460),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 109/150 (73%), Gaps = 5/150 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++RQP L IN FNVHRLLI SV+V+ KFMDDL+YN
Sbjct  57   LERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINFFNVHRLLITSVMVAAKFMDDLYYN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP-HYPGFL  317
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP TF  YC+H  +++   +P ++    
Sbjct  117  NAYYAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEMLLMQPLNFADSS  176

Query  316  QQLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
              LG+ +  H    C  E DE   H  QQ 
Sbjct  177  LSLGKSLKAH---LCYNE-DESSSHQKQQQ  202



>ref|XP_006490025.1| PREDICTED: cyclin-U4-1-like [Citrus sinensis]
Length=220

 Score =   182 bits (461),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+++QP L INSFNVHRLLI SVLVS KFMDD++YN
Sbjct  75   LERIFKYANCSPSCFVVAYVYLDRFAQKQPSLPINSFNVHRLLITSVLVSAKFMDDIYYN  134

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YAKVGGI T EMN+LEVDFLF +GF LNVTP+ F+TYCS+   ++  Q P       
Sbjct  135  NAFYAKVGGISTTEMNLLEVDFLFDLGFQLNVTPAAFYTYCSYLQREMFLQSPLQLEEPL  194

Query  313  QLGEVVSNHHHQCCIEEDD  257
             +G  +  +H  CC  ED+
Sbjct  195  NVGRQLKQYH--CCFSEDE  211



>ref|XP_004492903.1| PREDICTED: cyclin-U4-1-like [Cicer arietinum]
Length=203

 Score =   181 bits (459),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 109/150 (73%), Gaps = 6/150 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++RQP L INS NVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSLNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP-HYPGFL  317
            NAYYAKVGGI T EMN LE+DFLFG+GF+LNVTP+TF  YC H  +++   +P ++    
Sbjct  116  NAYYAKVGGITTIEMNFLELDFLFGLGFHLNVTPNTFQVYCVHLQSEMMMMQPLNFTDSS  175

Query  316  QQLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
              LG+ +  H    C  ED+    H  QQ 
Sbjct  176  LSLGKSLKTH---LCFNEDES--SHKKQQQ  200



>ref|XP_011040341.1| PREDICTED: cyclin-U4-1-like isoform X1 [Populus euphratica]
Length=194

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 105/140 (75%), Gaps = 9/140 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RFS+RQ    +NSFNVHRLLI SVLVSVKFMDD++YN
Sbjct  56   LERIFKYANCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITSVLVSVKFMDDIYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YAKVGGI T+EMN+LEVDFLFG+GF LNVTP+TFH YCS+   ++  Q P       
Sbjct  116  NAFYAKVGGISTREMNLLEVDFLFGLGFQLNVTPATFHFYCSYLQREMSIQSP------L  169

Query  313  QLGEVVSNHHHQCCIEEDDE  254
             +   +  H   CC  ED+ 
Sbjct  170  NIARPLKIH---CCFNEDES  186



>ref|XP_003624270.1| Cyclin-dependent protein kinase regulator Pho80 [Medicago truncatula]
 gb|AES80488.1| cyclin p4 [Medicago truncatula]
Length=203

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 111/150 (74%), Gaps = 6/150 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++RQP L INSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP-HYPGFL  317
            NAYYAKVGGI T EMN LE+DFLFG+GF+LNVTP+TF  YC H  +++   +P ++    
Sbjct  116  NAYYAKVGGITTIEMNFLELDFLFGLGFHLNVTPNTFQAYCVHLQSEMMMIQPLNFTDSS  175

Query  316  QQLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
              LG+ ++ H    C  ED+    H  QQ 
Sbjct  176  LGLGKSLNTH---VCFNEDES--SHQKQQQ  200



>ref|XP_010692026.1| PREDICTED: cyclin-U4-1 [Beta vulgaris subsp. vulgaris]
Length=217

 Score =   181 bits (459),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQPLL INS+NVHRLLI SV++S KFMDD++YN
Sbjct  60   LERIFKYANCSPSCFVVAYVYLDRFTQRQPLLPINSYNVHRLLITSVMISAKFMDDMYYN  119

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAK+GGI   EMN LEVDFLFG+GF+LNVTP+TFHTYCS+   ++   +P
Sbjct  120  NAYYAKIGGITITEMNFLEVDFLFGLGFHLNVTPNTFHTYCSYLQREMLLLQP  172



>ref|XP_006388184.1| hypothetical protein POPTR_0296s00210g [Populus trichocarpa]
 gb|ERP47098.1| hypothetical protein POPTR_0296s00210g [Populus trichocarpa]
Length=201

 Score =   180 bits (457),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 104/140 (74%), Gaps = 2/140 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKY+NCS SCFVVAY+YL RFS+RQ    +NSFNVHRLLI SVLVSVKFMDD++YN
Sbjct  56   LERIFKYSNCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITSVLVSVKFMDDIYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YAKVGGI T+EMN+LEVDFLFG+GF LNVTP+TFH YCS+   ++  Q P     + 
Sbjct  116  NAFYAKVGGISTREMNLLEVDFLFGLGFQLNVTPTTFHLYCSYLQREMSIQSPL--QIVD  173

Query  313  QLGEVVSNHHHQCCIEEDDE  254
                +       CC  ED+ 
Sbjct  174  TPLNIARPLKIHCCFNEDES  193



>emb|CDX83419.1| BnaA03g20870D [Brassica napus]
Length=200

 Score =   180 bits (457),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 107/150 (71%), Gaps = 10/150 (7%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERI+KYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+ + KF+DDL+YN
Sbjct  58   LERIYKYANCSSSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMTAAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI TKEMN+LE+DFLFG+GF+LNVTP+TFH Y S+   ++          LQ
Sbjct  118  NAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLQKEM--------TLLQ  169

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQHH  224
             L  VV     +  I  +DE   H  QQ  
Sbjct  170  PLSLVVV--PPRSVITFNDEEASHQKQQQQ  197



>ref|XP_011003554.1| PREDICTED: cyclin-U4-1-like [Populus euphratica]
Length=225

 Score =   181 bits (459),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 103/139 (74%), Gaps = 2/139 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RFS+RQ    +NSFNVHRLLI SVLVSVKFMDD++YN
Sbjct  80   LERIFKYANCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITSVLVSVKFMDDIYYN  139

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YAKVGGI T EMN+LEVDFLFG+GF LNVTP+ FH YCS+   ++  Q P  P    
Sbjct  140  NAFYAKVGGISTAEMNLLEVDFLFGLGFQLNVTPTMFHAYCSYLQREMLIQSP-LPIVDP  198

Query  313  QLGEVVSNHHHQCCIEEDD  257
             L        H CC  ED+
Sbjct  199  PLNMARLQKTH-CCFNEDE  216



>emb|CDY48257.1| BnaC04g05160D [Brassica napus]
Length=199

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 107/149 (72%), Gaps = 10/149 (7%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+VS KF+DD +YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSAKFLDDRYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI TKEMN+LE+DFLFG+GF+LNVTP+TFH Y S+   ++          LQ
Sbjct  118  NAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLKKEM--------TLLQ  169

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
             L  V+     +  +  +DE   H  QQ 
Sbjct  170  PLSLVLV--PPRSVLTFNDEEASHQQQQQ  196



>ref|XP_010506407.1| PREDICTED: cyclin-U4-1-like [Camelina sativa]
Length=200

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 104/148 (70%), Gaps = 8/148 (5%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+V+ KF+DDL+YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVAAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI TKEMN LE+DFLFG+GF LNVTP+TFH Y ++   ++          LQ
Sbjct  118  NAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFHAYFTYLQKEM--------TLLQ  169

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             L  VV           +D+   H  QQ
Sbjct  170  PLSLVVVPSSRSVITFINDDEASHQKQQ  197



>ref|XP_010508257.1| PREDICTED: cyclin-U4-1 [Camelina sativa]
 ref|XP_010508258.1| PREDICTED: cyclin-U4-1 [Camelina sativa]
Length=200

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 104/148 (70%), Gaps = 8/148 (5%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+V+ KF+DDL+YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVAAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI TKEMN LE+DFLFG+GF LNVTP+TFH Y ++   ++          LQ
Sbjct  118  NAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFHAYFTYLQKEM--------TLLQ  169

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             L  VV           +D+   H  QQ
Sbjct  170  PLSLVVVPSSRSVITFINDDEASHQKQQ  197



>emb|CDY30482.1| BnaA04g25830D [Brassica napus]
 emb|CDY23452.1| BnaC04g49800D [Brassica napus]
Length=201

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQP L INSFNVHRLLI SV+VS KF+DDL+YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVSAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI TKEMN+LE+DFLFG+GF+LNV P+TFH Y S+   ++   +P
Sbjct  118  NAYYAKVGGISTKEMNLLELDFLFGLGFDLNVKPNTFHAYFSYLQKEMTLVQP  170



>ref|XP_006374594.1| hypothetical protein POPTR_0015s12380g [Populus trichocarpa]
 gb|ERP52391.1| hypothetical protein POPTR_0015s12380g [Populus trichocarpa]
Length=201

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 103/140 (74%), Gaps = 2/140 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKY+NCS SCFVVAY+YL RFS+RQ    +NSFNVHRLLI SVLVSVKFMDD++YN
Sbjct  56   LERIFKYSNCSPSCFVVAYVYLDRFSQRQSCFPLNSFNVHRLLITSVLVSVKFMDDIYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YAKVGGI T+EMN+LEVDFLFG+GF LNVTP+TFH YCS+    +  Q P     + 
Sbjct  116  NAFYAKVGGISTREMNLLEVDFLFGLGFQLNVTPATFHLYCSYLQRDMSIQSPL--QIVD  173

Query  313  QLGEVVSNHHHQCCIEEDDE  254
                +       CC  ED+ 
Sbjct  174  TPLNIARPLKIHCCFNEDES  193



>ref|XP_009142278.1| PREDICTED: cyclin-U4-1 [Brassica rapa]
Length=201

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQP L INSFNVHRLLI SV+VS KF+DDL+YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVSAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI TKEMN+LE+DFLFG+GF+LNV P+TFH Y S+   ++   +P
Sbjct  118  NAYYAKVGGISTKEMNLLELDFLFGLGFDLNVKPNTFHAYFSYLQKEMTLVQP  170



>ref|XP_010056382.1| PREDICTED: cyclin-U4-1 [Eucalyptus grandis]
 gb|KCW73091.1| hypothetical protein EUGRSUZ_E01538 [Eucalyptus grandis]
Length=202

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 108/149 (72%), Gaps = 8/149 (5%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQP L +NS NVHRLLI SV+V+ KF+DD++YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLERFAQRQPTLPLNSLNVHRLLITSVMVAAKFLDDIYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQR-PHYPGFL  317
            NAYYAKVGGI T EMN LEVDFLFG+GFNLNVTPS F TYCS+   ++  Q+ P     L
Sbjct  118  NAYYAKVGGISTMEMNFLEVDFLFGLGFNLNVTPSAFQTYCSYLQREMMLQQCP-----L  172

Query  316  QQLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
              + +  S   H  C  ED+    H  Q+
Sbjct  173  GAVEDGRSQKLHLICFNEDEA--SHQKQE  199



>ref|XP_010518078.1| PREDICTED: cyclin-U4-1-like [Camelina sativa]
Length=200

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 104/148 (70%), Gaps = 8/148 (5%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+V+ KF+DDL+YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVAAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI TKEMN LE+DFLFG+GF LNVTP+TFH Y ++   ++          LQ
Sbjct  118  NAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFHAYFTYLQKEM--------TLLQ  169

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             L  VV           +D+   H  QQ
Sbjct  170  PLSLVVVPPSRSVITFINDDEASHQKQQ  197



>gb|AFK41945.1| unknown [Lotus japonicus]
Length=207

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 105/140 (75%), Gaps = 4/140 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF+++QP L INSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  58   LERIFKYANCSPSCFIVAYVYLDRFTQKQPSLPINSFNVHRLLITSVMVAAKFMDDMYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPH-YPGFL  317
            NAYYA+VGGI T EMN LE+DFLFG+GFNLNVTP TF  YCSH   ++   +P  +    
Sbjct  118  NAYYARVGGITTIEMNFLELDFLFGLGFNLNVTPGTFQGYCSHLQREMMLVQPLIFTDSS  177

Query  316  QQLGEVVSNHHHQCCIEEDD  257
              LG+ V  H    C  ED+
Sbjct  178  LSLGKSVKAH---LCFNEDE  194



>ref|XP_007205921.1| hypothetical protein PRUPE_ppa011614mg [Prunus persica]
 gb|EMJ07120.1| hypothetical protein PRUPE_ppa011614mg [Prunus persica]
Length=203

 Score =   179 bits (454),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYA+CS SC +VAY+YL RFS+RQP L INS+NVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LERIFKYADCSPSCLIVAYVYLDRFSQRQPDLPINSYNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+ FNLNVTPSTF TYCS+   ++   +P       
Sbjct  116  NAYYAKVGGISTIEMNFLEVDFLFGLNFNLNVTPSTFTTYCSYLQREMLLVQPPLDSADS  175

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             L  ++ +   Q C +E +    H  QQ
Sbjct  176  SLS-LIKSLKLQLCFDEGE--TSHQQQQ  200



>ref|XP_002526473.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF35864.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=203

 Score =   179 bits (454),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++RQP L +NSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LERIFKYANCSPSCFIVAYVYLDRFAQRQPSLPLNSFNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP+TFHTY S+   ++  Q P
Sbjct  116  NAYYAKVGGISTIEMNYLEVDFLFGLGFHLNVTPNTFHTYSSYLQREMMLQPP  168



>ref|XP_006376963.1| hypothetical protein POPTR_0012s11610g [Populus trichocarpa]
 gb|ERP54760.1| hypothetical protein POPTR_0012s11610g [Populus trichocarpa]
Length=225

 Score =   179 bits (455),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 103/139 (74%), Gaps = 2/139 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQ    INSFNVHRLLI SVL+SVKFMDD++YN
Sbjct  80   LERIFKYANCSPSCFVVAYVYLDRFAQRQSCFPINSFNVHRLLITSVLISVKFMDDIYYN  139

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YAKVGGI T EMN+LEVDFLFG+GF LNVTP+ FH YCS+   ++  Q P  P    
Sbjct  140  NAFYAKVGGISTAEMNLLEVDFLFGLGFQLNVTPTMFHAYCSYLQREMLIQSP-LPIVDL  198

Query  313  QLGEVVSNHHHQCCIEEDD  257
             L        H CC  ED+
Sbjct  199  PLNMARLQKTH-CCFNEDE  216



>ref|XP_009143062.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-U4-1 [Brassica rapa]
Length=199

 Score =   179 bits (453),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+VS KF+DD +YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSAKFLDDRYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI TKEMN+LE+DFLFG+GF+LNVTP+TFH Y S+   ++   +P
Sbjct  118  NAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLKKEMTLLQP  170



>ref|XP_008343752.1| PREDICTED: cyclin-U4-1-like [Malus domestica]
Length=207

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 101/138 (73%), Gaps = 0/138 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SC +VAY+YL RFS+RQP L INSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LERIFKYANCSPSCLIVAYVYLDRFSQRQPSLPINSFNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+ FNLNVTPSTF  YCS+   ++   +P       
Sbjct  116  NAYYAKVGGISTIEMNFLEVDFLFGLSFNLNVTPSTFTIYCSYLQREMLLLQPPLESADS  175

Query  313  QLGEVVSNHHHQCCIEED  260
             L    S   H C  E++
Sbjct  176  SLTLGKSPKLHLCXDEDE  193



>ref|NP_182002.1| cyclin p4;1  [Arabidopsis thaliana]
 sp|O80513.1|CCU41_ARATH RecName: Full=Cyclin-U4-1; Short=CycU4;1; AltName: Full=Cyclin-P4.1; 
Short=CycP4;1 [Arabidopsis thaliana]
 gb|AAC27476.1| putative PREG1-like negative regulator [Arabidopsis thaliana]
 gb|AAY17415.1| At2g44740 [Arabidopsis thaliana]
 gb|AAY57312.1| At2g44740 [Arabidopsis thaliana]
 dbj|BAF01242.1| putative PREG1-like negative regulator [Arabidopsis thaliana]
 gb|AEC10461.1| cyclin-U4-1 [Arabidopsis thaliana]
Length=202

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 101/141 (72%), Gaps = 8/141 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+V+ KF+DDL+YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVAAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI TKEMN LE+DFLFG+GF LNVTP+TF+ Y S+   ++          LQ
Sbjct  118  NAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFNAYFSYLQKEMT--------LLQ  169

Query  313  QLGEVVSNHHHQCCIEEDDEC  251
             L  VV           DDE 
Sbjct  170  PLSLVVVPSSRSLITFNDDEA  190



>ref|XP_009370411.1| PREDICTED: cyclin-U4-1 [Pyrus x bretschneideri]
Length=207

 Score =   178 bits (451),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 110/148 (74%), Gaps = 5/148 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKYA+CS SCF+VAY+YL RF++ QPLL I+SFNVHRLLI SVLVS KFMDD++YN
Sbjct  62   LQRIFKYADCSPSCFIVAYVYLDRFTQMQPLLPIDSFNVHRLLITSVLVSAKFMDDIYYN  121

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YA+VGGI T+EMN+LEVDFLFG+GF +NVTP+T++TYCS+   ++  Q P    F  
Sbjct  122  NAFYARVGGISTQEMNLLEVDFLFGLGFQMNVTPATYYTYCSYLQREMLLQSPL--QFAD  179

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
               ++       C  +ED+     H +Q
Sbjct  180  SPVDLARRLKLHCSFDEDEST---HQKQ  204



>ref|XP_006421507.1| hypothetical protein CICLE_v10005725mg [Citrus clementina]
 gb|ESR34747.1| hypothetical protein CICLE_v10005725mg [Citrus clementina]
Length=246

 Score =   179 bits (454),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 105/139 (76%), Gaps = 2/139 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+++Q  L INSFNVHRLLI SVLVS KFMDD++YN
Sbjct  101  LERIFKYANCSPSCFVVAYVYLDRFAQKQTSLPINSFNVHRLLITSVLVSAKFMDDIYYN  160

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YAKVGG+ T EMN+LEVDFLF +GF LNVTP+ F+TYCS+   ++  Q P       
Sbjct  161  NAFYAKVGGVSTTEMNLLEVDFLFALGFQLNVTPAAFYTYCSYLQREMFLQSPLQLEEPL  220

Query  313  QLGEVVSNHHHQCCIEEDD  257
             +G  +  +H  CC  EDD
Sbjct  221  NVGRQLKQYH--CCFSEDD  237



>ref|XP_007134401.1| hypothetical protein PHAVU_010G044800g [Phaseolus vulgaris]
 gb|ESW06395.1| hypothetical protein PHAVU_010G044800g [Phaseolus vulgaris]
Length=200

 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 103/149 (69%), Gaps = 10/149 (7%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++RQP L INSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  59   LERIFKYANCSPSCFIVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDMYYN  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI   EMN LE+DFLFG+GF LNV+P TF +YC H   ++ +   H      
Sbjct  119  NAYYAKVGGISKIEMNFLELDFLFGLGFQLNVSPGTFQSYCVHLQREMLSFAEH------  172

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
                +    HH  C  ED+    H  QQ 
Sbjct  173  --SSITLKAHHHLCFTEDES--SHQKQQQ  197



>ref|XP_009133684.1| PREDICTED: cyclin-U4-1-like [Brassica rapa]
Length=199

 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 108/149 (72%), Gaps = 10/149 (7%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERI+KYA+CS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+++ KF+DDL+YN
Sbjct  58   LERIYKYADCSSSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMIAAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI TKEMN+LE+DFLFG+GF+LNVTP+TFH Y S+   ++          LQ
Sbjct  118  NAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLRKEM--------TLLQ  169

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
             L  VV     +  I  +D+   H  QQ 
Sbjct  170  PLSLVVV--PPRSVITFNDDEASHQKQQQ  196



>ref|XP_009363720.1| PREDICTED: cyclin-U4-1-like [Pyrus x bretschneideri]
Length=207

 Score =   178 bits (451),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 110/148 (74%), Gaps = 5/148 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKYA+CS SCF+VAY+YL RF++ QPLL I+SFNVHRLLI SVLVS KFMDD++YN
Sbjct  62   LQRIFKYADCSPSCFIVAYVYLDRFTQMQPLLPIDSFNVHRLLITSVLVSAKFMDDIYYN  121

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YA+VGGI T+EMN+LEVDFLFG+GF +NVTP+T++TYCS+   ++  Q P    F  
Sbjct  122  NAFYARVGGISTQEMNLLEVDFLFGLGFQMNVTPATYYTYCSYLQREMLLQSPL--QFAD  179

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
               ++       C  +ED+     H +Q
Sbjct  180  SPVDLARRLKLHCSFDEDEST---HQKQ  204



>ref|XP_011084761.1| PREDICTED: cyclin-U4-1-like isoform X1 [Sesamum indicum]
Length=199

 Score =   177 bits (450),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 108/149 (72%), Gaps = 6/149 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERI+KYANCS SC VVAYIY+ RF ++QPLL I+SF VHRLLIASVLVS KFMDD+FYN
Sbjct  53   MERIYKYANCSPSCLVVAYIYIDRFVQKQPLLPISSFTVHRLLIASVLVSAKFMDDMFYN  112

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN+LE+DFLFG+GF L+V+PSTF TYCS    ++  Q P  P  L 
Sbjct  113  NAYYAKVGGISTAEMNLLEMDFLFGLGFQLSVSPSTFQTYCSFLQREMLLQSP--PLNLP  170

Query  313  QLGEVVSNHHHQC-CIEEDDECIDHHHQQ  230
                +++       CI+ED      H QQ
Sbjct  171  PSALILAVPETPLFCIKEDGST---HQQQ  196



>emb|CDX74684.1| BnaA05g04300D [Brassica napus]
Length=226

 Score =   178 bits (451),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+VS KF+DD +YN
Sbjct  58   LERIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSAKFLDDRYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI TKEMN+LE+DFLFG+GF+LNVTP+TFH Y S+   ++   +P
Sbjct  118  NAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSYLKKEMTLLQP  170



>emb|CDX95612.1| BnaC03g24930D [Brassica napus]
Length=198

 Score =   177 bits (448),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 105/148 (71%), Gaps = 10/148 (7%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERI+KYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+ + KF+DDL+YN
Sbjct  58   LERIYKYANCSSSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMTAAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI TKEMN+LE+DFLFG+GF+LNVTP+TFH Y S    ++          LQ
Sbjct  118  NAYYAKVGGISTKEMNLLELDFLFGLGFDLNVTPNTFHAYFSLLQKEM--------TLLQ  169

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             L  VV         ++D+    H  QQ
Sbjct  170  PLSLVVVPPRTVITFKDDEAS--HQKQQ  195



>ref|XP_009800863.1| PREDICTED: cyclin-U4-1 [Nicotiana sylvestris]
Length=208

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 103/139 (74%), Gaps = 3/139 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++ QP L INSFN+HRLLI SV+++ KFMDD++YN
Sbjct  59   LERIFKYANCSPSCFVVAYVYLDRFTQCQPSLPINSFNIHRLLITSVMIAAKFMDDMYYN  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+GF LNVTP+TF TYCS+   ++   +P     L 
Sbjct  119  NAYYAKVGGISTTEMNFLEVDFLFGLGFRLNVTPTTFQTYCSYLQKEMLLLQPPLNSSL-  177

Query  313  QLGEVVSNHHHQCCIEEDD  257
             +G   S      C  EDD
Sbjct  178  CMGR--SPKLQYICFNEDD  194



>ref|XP_008343655.1| PREDICTED: cyclin-U4-1-like [Malus domestica]
Length=206

 Score =   176 bits (447),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 103/139 (74%), Gaps = 1/139 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SC +VAY+YL RFS+RQP L INSFNVHRLLI SVLV+ KFMDD++YN
Sbjct  56   LERIFKYANCSPSCLIVAYVYLDRFSQRQPSLPINSFNVHRLLITSVLVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+ F+LNVTP+TF T+CS+   ++   +P       
Sbjct  116  NAYYAKVGGISTIEMNFLEVDFLFGLSFDLNVTPTTFTTHCSYLQREMLLLQPPLDSADS  175

Query  313  QLGEVVSNHHHQCCIEEDD  257
             L    S   H  C +ED+
Sbjct  176  SLSLGKSLKLH-LCFDEDE  193



>ref|XP_008362758.1| PREDICTED: cyclin-U4-1-like [Malus domestica]
Length=207

 Score =   176 bits (445),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 109/148 (74%), Gaps = 5/148 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIF YA+CS SCF+VAY+YL RF++ QPLL I+SFNVHRLLI SVLVS KFMDD++YN
Sbjct  62   LQRIFNYADCSPSCFIVAYVYLDRFTQMQPLLPIDSFNVHRLLITSVLVSAKFMDDIYYN  121

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YA+VGGI T+EMN+LEVDFLFG+GF +NVTP+T++TYCS+   ++  Q P    F  
Sbjct  122  NAFYARVGGISTQEMNLLEVDFLFGLGFQMNVTPATYYTYCSYLQREMLLQSPL--QFAD  179

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
               ++       C  +ED+     H +Q
Sbjct  180  SPVDLARRLKLHCSFDEDEST---HQKQ  204



>ref|XP_010109140.1| hypothetical protein L484_017079 [Morus notabilis]
 gb|EXC21069.1| hypothetical protein L484_017079 [Morus notabilis]
Length=205

 Score =   175 bits (444),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKYANCS SCFVVAY+YL RF++ QPLL INSFNVHRLL+ SV+VS KF+DDL+YN
Sbjct  60   LQRIFKYANCSPSCFVVAYVYLDRFTQCQPLLPINSFNVHRLLVTSVMVSAKFVDDLYYN  119

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI T EMN+LE+DFLFG+ F LNVTP+TFH+YCS+   ++    P
Sbjct  120  NAYYAKVGGISTAEMNLLELDFLFGLSFQLNVTPTTFHSYCSYLQREMLLHSP  172



>ref|XP_007052360.1| Cyclin p4,1 [Theobroma cacao]
 gb|EOX96517.1| Cyclin p4,1 [Theobroma cacao]
Length=203

 Score =   175 bits (444),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 108/152 (71%), Gaps = 10/152 (7%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RI+KYANCS SCF+VAY+YL RF++RQ  L INSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LDRIYKYANCSPSCFIVAYVYLDRFAQRQTSLPINSFNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP+TFHTY S+   ++  Q P  P    
Sbjct  116  NAYYAKVGGISTTEMNFLEVDFLFGLGFHLNVTPNTFHTYYSYLQREMMLQPP--PSIAD  173

Query  313  ---QLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
                LG  +  H    C  E++    H  QQ 
Sbjct  174  SSLSLGRSLKAH---LCFNEEESS--HQKQQQ  200



>ref|XP_008438223.1| PREDICTED: cyclin-U4-1 [Cucumis melo]
Length=211

 Score =   175 bits (444),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 106/152 (70%), Gaps = 6/152 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKYANCS  CFV+AY+YL RF +RQP L INSFNVHRLLI SVLVS KFMDD +YN
Sbjct  58   LDRIFKYANCSPCCFVIAYVYLDRFVQRQPSLPINSFNVHRLLITSVLVSAKFMDDTYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP+TFH+Y S+   Q+   +P       
Sbjct  118  NAYYAKVGGISTTEMNFLEVDFLFGLGFHLNVTPTTFHSYYSYLQRQMLLLQPPLMSTAS  177

Query  313  QLGEVVSNHHHQC----CIEEDDECIDHHHQQ  230
               E++ +         C +ED+    H  QQ
Sbjct  178  TKSELLLSSSRALKSHFCFDEDEA--SHKKQQ  207



>gb|ACU24636.1| unknown [Glycine max]
Length=188

 Score =   174 bits (442),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 1/131 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++RQP   INSFNVHRL I SV+V+ KFMDDL+YN
Sbjct  57   LERIFKYANCSPSCFIVAYVYLDRFTQRQPSSPINSFNVHRLPITSVMVAAKFMDDLYYN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP-HYPGFL  317
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP TF  YC+H  +++   +P ++    
Sbjct  117  NAYYAKVGGITTIEMNFLEVDFLFGLGFHLNVTPGTFQAYCAHLQSEMLLMQPLNFADSF  176

Query  316  QQLGEVVSNHH  284
              LG+ ++  H
Sbjct  177  LSLGKSLNKAH  187



>gb|KHG18521.1| Cyclin-U4-1 -like protein [Gossypium arboreum]
Length=203

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 103/139 (74%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RI+KYANCS  CF+VAY+YL RF++RQP L INSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LDRIYKYANCSPCCFIVAYVYLDRFAQRQPSLPINSFNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+GF LNVTP+TF+TY S+   +   Q+        
Sbjct  116  NAYYAKVGGISTTEMNFLEVDFLFGLGFQLNVTPNTFNTYYSYLKRETMLQQCPPSMVES  175

Query  313  QLGEVVSNHHHQCCIEEDD  257
             L    S +HH C  EED 
Sbjct  176  SLSLGRSLNHHLCFNEEDS  194



>gb|KHG19596.1| Cyclin-U4-1 -like protein [Gossypium arboreum]
Length=206

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RI+KYANCS SCF+VAY+YL RF++RQP L INSFNVHRLLI+SV+V+ KFMDD++YN
Sbjct  56   LDRIYKYANCSPSCFIVAYVYLDRFAQRQPSLPINSFNVHRLLISSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP+TFHTY ++   ++   +P
Sbjct  116  NAYYAKVGGISTTEMNFLEVDFLFGLGFHLNVTPNTFHTYYTYLQRKMMMLQP  168



>ref|XP_002881978.1| CYCP4_1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58237.1| CYCP4_1 [Arabidopsis lyrata subsp. lyrata]
Length=201

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+V+ KF+DDL+YN
Sbjct  58   LQRIFKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVAAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI TKEMN LE+DFLFG+GF LNVTP+TF+ Y S+   ++   +P
Sbjct  118  NAYYAKVGGISTKEMNFLELDFLFGLGFELNVTPNTFNAYFSYLQKEMTLLQP  170



>ref|XP_010089785.1| hypothetical protein L484_008035 [Morus notabilis]
 gb|EXB38377.1| hypothetical protein L484_008035 [Morus notabilis]
Length=210

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SC+VVAY+YL RF++RQP L INS NVHRLLI SV+V+ KFMDD++YN
Sbjct  58   LERIFKYANCSPSCYVVAYVYLDRFAQRQPSLPINSLNVHRLLITSVMVAAKFMDDMYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI T+EMN LEVDFLFG+GF+LNV+P+TF TYC +   ++   +P
Sbjct  118  NAYYAKVGGINTREMNFLEVDFLFGLGFHLNVSPTTFQTYCCYLQREMLLMQP  170



>ref|XP_003636176.1| Cyclin-U4-1 [Medicago truncatula]
 gb|ACJ84314.1| unknown [Medicago truncatula]
 gb|AFK49541.1| unknown [Medicago truncatula]
 gb|KEH17921.1| cyclin p4 [Medicago truncatula]
Length=200

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 103/149 (69%), Gaps = 4/149 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++ QP L INSFNVHRLLI SV+V+ KFMDD+ YN
Sbjct  53   LERIFKYANCSSSCFIVAYVYLDRFTQTQPSLPINSFNVHRLLITSVMVAAKFMDDVCYN  112

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI   EMN LE+DFLFG+GFNLNVTP TF  YC H   ++   +P    F  
Sbjct  113  NAYYAKVGGITKTEMNFLELDFLFGLGFNLNVTPVTFQAYCVHLQREMLQMQPLV--FED  170

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
                +  +     C+ ED+    H +QQ 
Sbjct  171  STLSLAKSLKAHLCLNEDES--SHQNQQQ  197



>ref|XP_004133942.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
 ref|XP_004167601.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
 gb|KGN56640.1| Cyclin-dependent protein kinase [Cucumis sativus]
Length=211

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 105/152 (69%), Gaps = 6/152 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKYANCS  CFV+AY+YL RF +RQP L INSFNVHRLLI SVLVS KFMDD +YN
Sbjct  58   LDRIFKYANCSPCCFVIAYVYLDRFVQRQPSLPINSFNVHRLLITSVLVSAKFMDDTYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+GF+LNVTP+TFH+Y S+   Q+   +P       
Sbjct  118  NAYYAKVGGISTTEMNFLEVDFLFGLGFHLNVTPTTFHSYYSYLQRQMLLLQPPLTSSAS  177

Query  313  QLGEVVSNHHHQC----CIEEDDECIDHHHQQ  230
               +++           C +ED+    H  QQ
Sbjct  178  TKSDLLLTSSRALKSHFCFDEDEA--SHKKQQ  207



>ref|XP_004145018.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
 ref|XP_004153078.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
Length=225

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS+SCF+VAY+YL RF+++QPLL INS+NVHRLLI SVLV+ KFMDDL YN
Sbjct  61   LERIFKYANCSNSCFIVAYVYLDRFAQKQPLLPINSYNVHRLLITSVLVAAKFMDDLCYN  120

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NA+YA+VGGI T+E+N LEVDFLFG+GF LNVTP+TFHTY S
Sbjct  121  NAFYARVGGISTREINFLEVDFLFGLGFELNVTPTTFHTYSS  162



>ref|XP_008245770.1| PREDICTED: cyclin-U4-1-like [Prunus mume]
Length=203

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 103/149 (69%), Gaps = 4/149 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYA+CS SC +VA++YL RFS+RQP L INS+NVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LERIFKYADCSPSCLIVAHVYLDRFSQRQPDLPINSYNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+ FNLNV PSTF TYCS+   +I   +P       
Sbjct  116  NAYYAKVGGISTIEMNFLEVDFLFGLNFNLNVNPSTFTTYCSYLQREILLLQPPLDSADS  175

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
             L    S   H C     DE    H QQ 
Sbjct  176  SLSLGKSLKLHLCF----DEGETSHQQQQ  200



>ref|XP_004160682.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
 gb|KGN46271.1| hypothetical protein Csa_6G078670 [Cucumis sativus]
Length=226

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS+SCF+VAY+YL RF+++QPLL INS+NVHRLLI SVLV+ KFMDDL YN
Sbjct  61   LERIFKYANCSNSCFIVAYVYLDRFAQKQPLLPINSYNVHRLLITSVLVAAKFMDDLCYN  120

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NA+YA+VGGI T+E+N LEVDFLFG+GF LNVTP+TFHTY S
Sbjct  121  NAFYARVGGISTREINFLEVDFLFGLGFELNVTPTTFHTYSS  162



>ref|XP_006445448.1| hypothetical protein CICLE_v10022279mg [Citrus clementina]
 ref|XP_006464405.1| PREDICTED: cyclin-U4-1-like [Citrus sinensis]
 gb|ESR58688.1| hypothetical protein CICLE_v10022279mg [Citrus clementina]
 gb|KDO85467.1| hypothetical protein CISIN_1g028611mg [Citrus sinensis]
Length=206

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF +RQP L INSFNVHRLLI SV+V+ KF+DD++YN
Sbjct  56   LERIFKYANCSPSCFIVAYVYLDRFVQRQPSLPINSFNVHRLLITSVMVAAKFLDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LE+DFLFG+ F+LNVTP+ FHTYC++   ++   +P       
Sbjct  116  NAYYAKVGGISTIEMNFLELDFLFGLSFHLNVTPNAFHTYCTYLQREMLLLQPPLNVAES  175

Query  313  QLGEVVSNHHHQCCIEED  260
             L    S   H C  E++
Sbjct  176  SLSIARSAKLHSCFNEDE  193



>ref|XP_004307773.1| PREDICTED: cyclin-U4-1-like [Fragaria vesca subsp. vesca]
Length=204

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYA+CS SCFVVAY+YL RF++RQ  L INSFNVHRLLI SV+VS KFMDD+ YN
Sbjct  57   LERIFKYADCSPSCFVVAYVYLDRFTQRQKALPINSFNVHRLLITSVMVSAKFMDDISYN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAY+A+VGGI TKEMN+LE+DFLFG+GF LNVTP  F TYCS+   ++  Q P
Sbjct  117  NAYFARVGGISTKEMNLLEMDFLFGLGFELNVTPENFITYCSYLQREMLLQSP  169



>ref|XP_009592904.1| PREDICTED: cyclin-U4-1 [Nicotiana tomentosiformis]
Length=207

 Score =   173 bits (439),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 100/146 (68%), Gaps = 0/146 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS  CFVVAY+YL RF++ QP L INSFN+HRLLI SV+++ KFMDD++YN
Sbjct  59   LERIFKYANCSPCCFVVAYVYLDRFTQCQPSLPINSFNIHRLLITSVMIAAKFMDDMYYN  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+GF LNVTP+TF TYCS+   ++   +P       
Sbjct  119  NAYYAKVGGISTTEMNFLEVDFLFGLGFRLNVTPTTFQTYCSYLQKEMLLLQPPLNLQNS  178

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHH  236
             L    S      C  EDD       
Sbjct  179  SLYMGRSPKLQYICFNEDDSSSQQQQ  204



>ref|XP_008375750.1| PREDICTED: cyclin-U4-1 [Malus domestica]
Length=207

 Score =   173 bits (438),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKYA+CS SCFVVAY+YL RF++ QPLL I+SF+VHRLLI SVLVS KFMDD +YN
Sbjct  62   LQRIFKYADCSPSCFVVAYVYLDRFTQMQPLLPIDSFSVHRLLITSVLVSAKFMDDNYYN  121

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYA+VGGI T+EMN+LEVDFLFG+GF +NVTP T++TYC++   ++  Q P
Sbjct  122  NAYYARVGGISTQEMNLLEVDFLFGLGFQMNVTPVTYYTYCTYLQREMLLQYP  174



>gb|KHN31107.1| Cyclin-U4-1 [Glycine soja]
Length=209

 Score =   173 bits (438),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 4/140 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQP L INSFNVHRLLI SV+V+ KFMDD+FYN
Sbjct  59   LERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDMFYN  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP-HYPGFL  317
            NA+YAKVGGI   EMN LE+DFLFG+GF+LNVTP TF  YC H   ++   +P ++    
Sbjct  119  NAHYAKVGGITKVEMNFLELDFLFGLGFHLNVTPGTFQAYCVHLQREMLLIQPLNFSDST  178

Query  316  QQLGEVVSNHHHQCCIEEDD  257
              LG+ +  H    C  ED+
Sbjct  179  LNLGQSLKAH---LCFNEDE  195



>ref|NP_001235331.1| uncharacterized protein LOC100305689 [Glycine max]
 gb|ACU13506.1| unknown [Glycine max]
Length=209

 Score =   173 bits (438),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 104/140 (74%), Gaps = 4/140 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQP L INSFNVHRLLI SV+V+ KFMDD+FYN
Sbjct  59   LERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINSFNVHRLLITSVMVAAKFMDDMFYN  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP-HYPGFL  317
            NA+YAKVGGI   EMN LE+DFLFG+GF+LNVTP TF  YC H   ++   +P ++    
Sbjct  119  NAHYAKVGGITKVEMNFLELDFLFGLGFHLNVTPGTFQAYCVHLQREMLLIQPLNFSDST  178

Query  316  QQLGEVVSNHHHQCCIEEDD  257
              LG+ +  H    C  ED+
Sbjct  179  LNLGQSLKAH---LCFNEDE  195



>gb|KHN12243.1| Cyclin-U4-1 [Glycine soja]
Length=202

 Score =   172 bits (436),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 108/151 (72%), Gaps = 7/151 (5%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQP L IN+FNVHRLLI SV+V+ KFMDD++YN
Sbjct  54   LERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINTFNVHRLLITSVMVAAKFMDDMYYN  113

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ-IQAQRP-HYPGF  320
            NAYYAKVGGI   EMN LE+DFLFG+GF+LNVTP TF  YC +   + +  Q+P ++   
Sbjct  114  NAYYAKVGGITKIEMNFLELDFLFGLGFHLNVTPGTFQAYCVNLQREMLLIQQPLNFADS  173

Query  319  LQQLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
               LG+ +  H    C  ED+    H  QQ 
Sbjct  174  TLNLGKSLKAH---LCFNEDES--SHQKQQQ  199



>ref|XP_006347995.1| PREDICTED: cyclin-U4-1-like [Solanum tuberosum]
Length=208

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS  CFVVAY+YL RF++ QP L INSFN+HRLLI SV+++ KFMDD++YN
Sbjct  58   LERIFKYANCSPCCFVVAYVYLDRFTQCQPSLPINSFNIHRLLITSVMIAAKFMDDMYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI   EMN LEVDFLFG+GF+LNVTP+TF TYC++   ++  Q P
Sbjct  118  NAYYAKVGGISITEMNFLEVDFLFGLGFHLNVTPTTFQTYCAYLQKEMLMQSP  170



>ref|XP_004229728.1| PREDICTED: cyclin-U4-1 [Solanum lycopersicum]
Length=206

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS  CFVVAY+YL RF++ QP L INSFN+HRLLI SV+++ KFMDD++YN
Sbjct  58   LERIFKYANCSPCCFVVAYVYLDRFTQCQPSLPINSFNIHRLLITSVMIAAKFMDDMYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI   EMN LEVDFLFG+GF+LNVTP+TF TYC++   ++  Q P
Sbjct  118  NAYYAKVGGISITEMNFLEVDFLFGLGFHLNVTPTTFQTYCAYLQKEMLMQSP  170



>ref|XP_003529016.1| PREDICTED: cyclin-U4-1-like [Glycine max]
Length=202

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 108/151 (72%), Gaps = 7/151 (5%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF++RQP L IN+FNVHRLLI SV+V+ KFMDD++YN
Sbjct  54   LERIFKYANCSPSCFVVAYVYLDRFTQRQPSLPINTFNVHRLLITSVMVAAKFMDDMYYN  113

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ-IQAQRP-HYPGF  320
            NAYYAKVGGI   EMN LE+DFLFG+GF+LNVTP TF  YC +   + +  Q+P ++   
Sbjct  114  NAYYAKVGGITKIEMNFLELDFLFGLGFHLNVTPGTFQAYCVNLQREMLLIQQPLNFADS  173

Query  319  LQQLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
               LG+ +  H    C  ED+    H  QQ 
Sbjct  174  TLNLGKSLKAH---LCFNEDES--SHQKQQQ  199



>gb|KFK37277.1| hypothetical protein AALP_AA4G236200 [Arabis alpina]
Length=201

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERI+KYANCS SCFVVAY+YL RF+ RQP L INSFNVHRLLI SV+VS KF+DDL+YN
Sbjct  58   LERIYKYANCSPSCFVVAYVYLDRFTHRQPSLPINSFNVHRLLITSVMVSAKFLDDLYYN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF  362
            NAYYAKVGGI TKEMN+LE+DFLFG+GF+LNV P+TF  Y ++ 
Sbjct  118  NAYYAKVGGISTKEMNLLELDFLFGLGFDLNVKPNTFQAYFTYL  161



>ref|XP_002862353.1| CYCP4_2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38611.1| CYCP4_2 [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 108/159 (68%), Gaps = 6/159 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF YANCS+SC++VAYIYL RF ++QP L INSFNVHRL+I SVLVS KFMDDL YN
Sbjct  66   LERIFNYANCSYSCYIVAYIYLDRFVKKQPFLPINSFNVHRLIITSVLVSAKFMDDLSYN  125

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            N YYAKVGGI  +EMN+LE+DFLFGIGF LNVT STF+ YC     ++         FL+
Sbjct  126  NGYYAKVGGISREEMNMLELDFLFGIGFQLNVTVSTFNNYCCFLQREMGMLTKMKSLFLE  185

Query  313  QLGEVVSNHHHQCCIE--EDDECIDHHHQQHHYPMLAAA  203
                  S+   +  +   EDD    HH+++     LAAA
Sbjct  186  PSLSFKSSSKTKLLMNPHEDDSLSTHHNKKQ----LAAA  220



>ref|XP_009375368.1| PREDICTED: cyclin-U4-1 [Pyrus x bretschneideri]
Length=206

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 102/139 (73%), Gaps = 1/139 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYA+CS SC +VAY+YL RFS+R P L INSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LERIFKYADCSPSCLIVAYVYLDRFSQRHPSLPINSFNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGGI T EMN LEVDFLFG+ F+LNVTPSTF T+CS+   ++   +P       
Sbjct  116  NAYYAKVGGISTIEMNFLEVDFLFGLSFDLNVTPSTFTTHCSYLQREMLLLQPPLDSADS  175

Query  313  QLGEVVSNHHHQCCIEEDD  257
             L    S   H  C +ED+
Sbjct  176  SLSLGKSLKLH-LCFDEDE  193



>ref|XP_004515319.1| PREDICTED: cyclin-U4-1-like [Cicer arietinum]
Length=202

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 104/149 (70%), Gaps = 6/149 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VAY+YL RF++ QP L INSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  55   LERIFKYANCSPSCFIVAYVYLDRFTQTQPSLPINSFNVHRLLITSVMVAAKFMDDVYYN  114

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP-HYPGFL  317
            NAYYAKVGGI   EMN LE+DFLFG+GFNLNVTP TF  Y  H   ++   +P H+    
Sbjct  115  NAYYAKVGGITKAEMNFLELDFLFGLGFNLNVTPITFQAYSVHLQREMFHMQPLHFADST  174

Query  316  QQLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
              L + +  H    C  ED+    H  Q+
Sbjct  175  INLAKSLKAH---LCFNEDESS--HQKQK  198



>ref|XP_009362721.1| PREDICTED: cyclin-U4-1-like [Pyrus x bretschneideri]
Length=207

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 109/148 (74%), Gaps = 5/148 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKYA+CS SC VVAY+YL RF++ QPLL I+SF+VHRLLI SVLVS KFMDD++YN
Sbjct  62   LQRIFKYADCSPSCCVVAYVYLDRFTQMQPLLPIDSFSVHRLLITSVLVSAKFMDDIYYN  121

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YA+VGGI T+EMN+LEVDFLFG+GF +NVTP+T++TYC++   ++  Q P    F  
Sbjct  122  NAFYARVGGISTQEMNLLEVDFLFGLGFQMNVTPATYYTYCTYLQREMLLQYPL--QFAD  179

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
               ++       C  +ED+     H +Q
Sbjct  180  SPVDLARRLKLHCSFDEDEST---HQKQ  204



>ref|NP_200973.1| CYCLIN P4;2 [Arabidopsis thaliana]
 sp|Q9FKF6.1|CCU43_ARATH RecName: Full=Cyclin-U4-3; Short=CycU4;3; AltName: Full=Cyclin-P4.2; 
Short=CycP4;2 [Arabidopsis thaliana]
 dbj|BAB09009.1| PREG regulatory protein-like [Arabidopsis thaliana]
 gb|AAR24219.1| At5g61650 [Arabidopsis thaliana]
 gb|AAR92360.1| At5g61650 [Arabidopsis thaliana]
 gb|AED97501.1| CYCLIN P4;2 [Arabidopsis thaliana]
Length=219

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/157 (55%), Positives = 107/157 (68%), Gaps = 3/157 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+YANCS+SC++VAYIYL RF ++QP L INSFNVHRL+I SVLVS KFMDDL YN
Sbjct  66   LERIFEYANCSYSCYIVAYIYLDRFVKKQPFLPINSFNVHRLIITSVLVSAKFMDDLSYN  125

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            N YYAKVGGI  +EMN+LE+DFLFGIGF LNVT STF+ YC     ++         FL+
Sbjct  126  NEYYAKVGGISREEMNMLELDFLFGIGFELNVTVSTFNNYCCFLQREMAMLMKMKSLFLE  185

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQHHYPMLAAA  203
                 +S+         +++ +  HH +     LAAA
Sbjct  186  PSSFKISSKTKLVMYPHEEDSLSTHHNKKQ---LAAA  219



>ref|XP_002271136.1| PREDICTED: cyclin-U4-1 [Vitis vinifera]
 emb|CBI16684.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF YANCS SC+VVAYIYL RF ++QP L INS+NVHRLLI  V+V+ KFMDD++YN
Sbjct  56   LERIFNYANCSPSCYVVAYIYLDRFVQKQPSLPINSYNVHRLLITGVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI T+EMN LEVDFLFG+ F+LNVTP+TFHTYC     ++  Q P
Sbjct  116  NAYYAKVGGISTREMNFLEVDFLFGLAFDLNVTPTTFHTYCCCLQREMLLQSP  168



>ref|XP_010524444.1| PREDICTED: cyclin-U4-1 [Tarenaya hassleriana]
Length=191

 Score =   171 bits (432),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+YL RF+  QP L I SFN+HRLLI SV+VS KF+DD++YN
Sbjct  56   LERIFKYANCSPSCFVVAYVYLDRFTHLQPSLPITSFNLHRLLITSVMVSAKFLDDIYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAK+GGIGT EMN LE+DFLFG+GF+LNVTP+TFH Y S+   +    +P     + 
Sbjct  116  NAYYAKIGGIGTAEMNFLELDFLFGLGFDLNVTPNTFHAYLSYLHKETMLLQPIPVRPVI  175

Query  313  QLGEVVSNHHHQ  278
               E  S+H  Q
Sbjct  176  AFNEEESSHQQQ  187



>ref|XP_008460076.1| PREDICTED: cyclin-U4-1-like [Cucumis melo]
Length=345

 Score =   174 bits (442),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS+SCF+VAY+YL RF+++QPLL INS+NVHRLLI SVLV+ KFMDDL YN
Sbjct  181  LERIFKYANCSNSCFIVAYVYLDRFAQKQPLLPINSYNVHRLLITSVLVAAKFMDDLCYN  240

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NA+YA+VGGI T+E+N LEVDFLFG+GF LNVTP+TFHTY S
Sbjct  241  NAFYARVGGISTREINFLEVDFLFGLGFELNVTPTTFHTYSS  282



>ref|XP_006394483.1| hypothetical protein EUTSA_v10005388mg [Eutrema salsugineum]
 gb|ESQ31769.1| hypothetical protein EUTSA_v10005388mg [Eutrema salsugineum]
Length=220

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 109/159 (69%), Gaps = 6/159 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SC++VAYIYL RF ++QP L INSFNVHRL+I SVLVS KFMDDL YN
Sbjct  66   LERIFKYANCSCSCYIVAYIYLDRFVKKQPFLPINSFNVHRLIITSVLVSAKFMDDLCYN  125

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            N YYAKVGGI  +EMN+LE+DFLFGIGF LNVT STF+ YCS    ++         FL+
Sbjct  126  NGYYAKVGGISREEMNMLELDFLFGIGFQLNVTVSTFNNYCSFLQREMVMLMKMKSLFLE  185

Query  313  QLGEVVSNHHHQCCIE--EDDECIDHHHQQHHYPMLAAA  203
                  S+   +  +   E+D    HH+++     LAAA
Sbjct  186  PSLSFRSSIKTKLVMNPLEEDSLSTHHNKKQ----LAAA  220



>emb|CDP05394.1| unnamed protein product [Coffea canephora]
Length=201

 Score =   169 bits (429),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 96/116 (83%), Gaps = 2/116 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SC +VAYIYL RFS++QP+L I S +VHRLLI SVLVS KFMDD+FYN
Sbjct  56   LERIFKYANCSPSCLIVAYIYLDRFSQKQPVLPITSLSVHRLLITSVLVSAKFMDDIFYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYP  326
            NA+YAKVGGI   EMN+LE+DFLFG+GF LNVTP+TF+TY S FI Q Q+  P  P
Sbjct  116  NAFYAKVGGISAMEMNLLEMDFLFGLGFQLNVTPTTFYTYAS-FI-QRQSWLPCPP  169



>ref|XP_002278426.1| PREDICTED: cyclin-U4-1 [Vitis vinifera]
 emb|CBI38577.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCF+VA+IYL RFS+ QP L ++SFN HRLLI SV+V+ KFMDD++YN
Sbjct  56   LERIFKYANCSPSCFIVAFIYLDRFSQSQPSLPLSSFNAHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYAKVGGI   EMN+LEVDFLFG+ F LNVTP+ FH+YCS    ++  Q P
Sbjct  116  NAYYAKVGGISRAEMNLLEVDFLFGLKFQLNVTPNAFHSYCSFLHKEMSFQSP  168



>emb|CDY65234.1| BnaC09g47870D [Brassica napus]
Length=216

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKYANCS SC++VAYIYL RF ++QP + I+SFNVHRL+I SVLVS KFMDDL YN
Sbjct  67   MERIFKYANCSDSCYIVAYIYLDRFIQKQPFVPIDSFNVHRLIITSVLVSAKFMDDLCYN  126

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYP  326
            NAYYAK+GGI T+EMN+LE+DFLFGIGF LNVT ST++ YCS    ++  +  + P
Sbjct  127  NAYYAKIGGITTEEMNLLELDFLFGIGFQLNVTLSTYNNYCSSLQREMDMRNMYSP  182



>ref|XP_009122338.1| PREDICTED: cyclin-U4-2 [Brassica rapa]
Length=216

 Score =   168 bits (425),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKYANCS SC++VAYIYL RF ++QP + I+SFNVHRL+I SVLVS KFMDD+ YN
Sbjct  67   MERIFKYANCSDSCYIVAYIYLDRFIQKQPFVPIDSFNVHRLIITSVLVSAKFMDDMCYN  126

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAK+GGI T+EMN+LE+DFLFGIGF LNVT ST++ YCS    ++   R  Y   L+
Sbjct  127  NAYYAKIGGITTEEMNLLELDFLFGIGFQLNVTLSTYNNYCSSLQREM-VMRNMYSPLLE  185

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
                 ++    Q  + ++D    H ++Q
Sbjct  186  --PSFLTLKSLQISLYDEDSLSIHQNKQ  211



>emb|CDX70040.1| BnaA10g23890D [Brassica napus]
Length=216

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 107/148 (72%), Gaps = 3/148 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKYANCS SC++VAYIY+ RF ++QP + I+SFNVHRL+I SVLVS KFMDD+ YN
Sbjct  67   MERIFKYANCSDSCYIVAYIYMDRFIQKQPFVPIDSFNVHRLIITSVLVSAKFMDDMCYN  126

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAK+GGI T+EMN+LE+DFLFGIGF LNVT ST++ YCS    ++   R  Y   L+
Sbjct  127  NAYYAKIGGITTEEMNLLELDFLFGIGFQLNVTLSTYNNYCSSLQREM-VMRNMYSPLLE  185

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
                 ++    Q  + ++D    H ++Q
Sbjct  186  --PSFLTLKSLQISLYDEDSLSIHQNKQ  211



>ref|XP_006838523.1| hypothetical protein AMTR_s00002p00190080 [Amborella trichopoda]
 gb|ERN01092.1| hypothetical protein AMTR_s00002p00190080 [Amborella trichopoda]
Length=227

 Score =   167 bits (422),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 95/123 (77%), Gaps = 7/123 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LER+FKYANCS SCFVVAY+YL RFS+RQ  L I S +VHRLLI SVLV+ KFMDDL+YN
Sbjct  67   LERVFKYANCSPSCFVVAYVYLDRFSQRQQTLPITSLSVHRLLITSVLVAAKFMDDLYYN  126

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF-------IAQIQAQRP  335
            NAYYAKVGGI   EMN LEVDFLFG+GF+LNVTP+ F++YC+H        I + Q QR 
Sbjct  127  NAYYAKVGGISITEMNCLEVDFLFGLGFHLNVTPTAFNSYCTHLQREMFECIGEYQIQRG  186

Query  334  HYP  326
              P
Sbjct  187  LSP  189



>ref|XP_006279771.1| hypothetical protein CARUB_v10027784mg [Capsella rubella]
 gb|EOA12669.1| hypothetical protein CARUB_v10027784mg [Capsella rubella]
Length=222

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 108/160 (68%), Gaps = 7/160 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS+SC++VAYIYL RF ++QP L INSFNVHRL++ SVLVS KFMDDL YN
Sbjct  67   LERIFKYANCSYSCYIVAYIYLDRFVKKQPFLPINSFNVHRLILTSVLVSAKFMDDLSYN  126

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            N YYAKVGGI  +EMN+LE+DFLFGIGF LNVT  TF+ YC     ++         FL+
Sbjct  127  NGYYAKVGGISREEMNMLELDFLFGIGFQLNVTVPTFNNYCCFLQREMVMLMKMKSLFLE  186

Query  313  QLGEVVSNHHHQCCIE---EDDECIDHHHQQHHYPMLAAA  203
                  S+   +  +    E+D    HH+++     LAAA
Sbjct  187  PSLSFRSSFKTKLLMNNPHEEDSLSTHHNEKQ----LAAA  222



>ref|XP_010491362.1| PREDICTED: cyclin-U4-2-like [Camelina sativa]
Length=219

 Score =   166 bits (420),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 103/147 (70%), Gaps = 0/147 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKYANCS SC+VVAYIYL RF ++QP L I+S+NVHRL+I+SVLVS KFMDDL YN
Sbjct  68   MERIFKYANCSDSCYVVAYIYLDRFIQKQPFLPIDSYNVHRLIISSVLVSAKFMDDLCYN  127

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAK+GGI T+EMN LE+DFLFG+GF LNVT ST+  YCS    +   +  + P F  
Sbjct  128  NAYYAKIGGITTEEMNFLELDFLFGVGFQLNVTCSTYTDYCSSLQRETVMRTMYSPVFEP  187

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQ  233
             L      +      +ED + I  + Q
Sbjct  188  FLLTSFDKNLRMHLYDEDSQSIHRNSQ  214



>ref|XP_010523281.1| PREDICTED: cyclin-U4-2-like [Tarenaya hassleriana]
Length=209

 Score =   166 bits (419),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 1/113 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKYANCSHSC++VAYIYL RF ++QP L I+SFNVHRL+I SVLVS KFMDD+ Y+
Sbjct  71   MERIFKYANCSHSCYIVAYIYLDRFMQKQPFLPIDSFNVHRLIITSVLVSSKFMDDMCYS  130

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYA+VGGI T+EMNILE+DFLFGI F+LNV PSTFH Y S F+  ++   P
Sbjct  131  NAYYARVGGISTEEMNILELDFLFGIAFHLNVAPSTFHHY-SCFLHALEPSPP  182



>ref|XP_006288646.1| hypothetical protein CARUB_v10001951mg [Capsella rubella]
 gb|EOA21544.1| hypothetical protein CARUB_v10001951mg [Capsella rubella]
Length=213

 Score =   166 bits (419),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 107/150 (71%), Gaps = 5/150 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKYANCS SC+VVAYIYL RF ++QP L I+S NVHRL+I SVL+S KFMDDL YN
Sbjct  61   MQRIFKYANCSDSCYVVAYIYLDRFIQKQPFLPIDSRNVHRLIITSVLISAKFMDDLCYN  120

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAK+GGI T+EMN+LEVDFLFG+GF LNVT S ++ YCS    ++  +  + P  L 
Sbjct  121  NAYYAKIGGITTEEMNLLEVDFLFGVGFQLNVTCSAYNEYCSSLQREMVMRTMYSP--LL  178

Query  313  QLGEVVSNHHHQCCI---EEDDECIDHHHQ  233
            +   +V N H    +   +ED + I  + Q
Sbjct  179  EPSSLVRNFHRNLLMHLYDEDSQSIHRNSQ  208



>ref|XP_010457595.1| PREDICTED: cyclin-U4-3 [Camelina sativa]
Length=221

 Score =   166 bits (419),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 106/159 (67%), Gaps = 5/159 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+YANCS+SC++VAYIYL RF ++QP L INS NVHRL+I SVLVS KFMDDL YN
Sbjct  66   LERIFEYANCSYSCYIVAYIYLDRFVKKQPFLAINSHNVHRLIITSVLVSAKFMDDLSYN  125

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            N YYAKVGGI  +EMN+LE+DFLFGI F LNVT STF+ YC     ++         FL+
Sbjct  126  NGYYAKVGGISREEMNMLELDFLFGIEFQLNVTVSTFNNYCCFLQREMVMLMKMKSLFLE  185

Query  313  QLGEVVSNHHHQCCIE--EDDECIDHHHQQHHYPMLAAA  203
                  S+   +  +   EDD    HH ++     LAAA
Sbjct  186  PSLSFRSSFKTKLLMNPHEDDSLSTHHSKKQQ---LAAA  221



>ref|NP_196362.1| cyclin p4;3 [Arabidopsis thaliana]
 sp|Q9LY16.1|CCU42_ARATH RecName: Full=Cyclin-U4-2; Short=CycU4;2; AltName: Full=Cyclin-P4.3; 
Short=CycP4;3 [Arabidopsis thaliana]
 emb|CAB87934.1| putative protein [Arabidopsis thaliana]
 dbj|BAC43685.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63299.1| At5g07450 [Arabidopsis thaliana]
 gb|AED91160.1| cyclin p4;3 [Arabidopsis thaliana]
Length=216

 Score =   165 bits (418),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 100/131 (76%), Gaps = 1/131 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKYA+CS SC++VAYIYL RF ++QPLL I+S NVHRL+I SVLVS KFMDDL YN
Sbjct  68   MERIFKYADCSDSCYIVAYIYLDRFIQKQPLLPIDSSNVHRLIITSVLVSAKFMDDLCYN  127

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YAKVGGI T+EMN+LE+DFLFGIGF LNVT ST++ YCS    ++   R  Y   L+
Sbjct  128  NAFYAKVGGITTEEMNLLELDFLFGIGFQLNVTISTYNDYCSSLQREM-VMRTMYSPLLE  186

Query  313  QLGEVVSNHHH  281
                V S H +
Sbjct  187  PAFLVRSFHKN  197



>gb|KHG14991.1| Cyclin-U4-1 -like protein [Gossypium arboreum]
Length=205

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L RI+KYANCS SCF+VAY+YL RF++RQP L INSFNVHRLLI SV+V+ KFMDD++YN
Sbjct  56   LHRIYKYANCSPSCFIVAYVYLDRFAQRQPSLPINSFNVHRLLITSVMVAAKFMDDMYYN  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF  362
            NA+YAKVGGI T EMN LEVDFLFG+GF+LNV   TFHTY S+ 
Sbjct  116  NAFYAKVGGISTTEMNFLEVDFLFGLGFHLNVNLKTFHTYYSYL  159



>emb|CDY08862.1| BnaA06g23620D [Brassica napus]
Length=211

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/102 (74%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCSHSC++VAYIYL RF ++QP L INSF++HR +I SVL+S KFMDDL YN
Sbjct  57   LERIFKYANCSHSCYIVAYIYLDRFIKKQPFLLINSFSIHRFIITSVLLSAKFMDDLCYN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            N YYA+VGGI  +EMN+LE+DFLFGIGF LNVT STF+ YCS
Sbjct  117  NGYYAQVGGISKEEMNMLELDFLFGIGFQLNVTVSTFNNYCS  158



>ref|XP_010452710.1| PREDICTED: cyclin-U4-2-like [Camelina sativa]
Length=217

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 90/102 (88%), Gaps = 0/102 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKYANCS SC+VVAYIYL RF ++QP L I+S+NVHRL+I+SVLVS KFMDDL YN
Sbjct  68   MERIFKYANCSDSCYVVAYIYLDRFIQKQPFLPIDSYNVHRLIISSVLVSAKFMDDLCYN  127

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAYYAK GGI T+EMN+LE+DFLFG+GF LNVT ST++ YCS
Sbjct  128  NAYYAKNGGITTEEMNLLELDFLFGVGFKLNVTCSTYYDYCS  169



>ref|XP_009136505.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-U4-3 [Brassica rapa]
Length=211

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/159 (54%), Positives = 108/159 (68%), Gaps = 6/159 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCSHSC++VAYIYL RF ++QP L INSF+VHR +I SVLVS KFMDDL  N
Sbjct  57   LERIFKYANCSHSCYIVAYIYLDRFIKKQPFLLINSFSVHRFIITSVLVSAKFMDDLCCN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            N YYA VGGI  +EMN+LE+DFLFG+GF LNVT STF+ YCS    ++         F++
Sbjct  117  NGYYAHVGGISKEEMNMLELDFLFGVGFQLNVTISTFNNYCSFLRREMVRLTNMNSLFVE  176

Query  313  QLGEVVSNHHHQCCIE--EDDECIDHHHQQHHYPMLAAA  203
                  S+   +  +   E+D  I HH+++     LAAA
Sbjct  177  PSLSFRSSFETKLVMNTLEEDSLITHHNKKQ----LAAA  211



>ref|XP_010423207.1| PREDICTED: cyclin-U4-2-like [Camelina sativa]
Length=226

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/104 (73%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKYANCS SC+VVAYIYL RF ++QP L I+S+NVHRL+I+SVLVS KFMDDL YN
Sbjct  68   MERIFKYANCSDSCYVVAYIYLDRFIQKQPFLPIDSYNVHRLIISSVLVSAKFMDDLCYN  127

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF  362
            NAYYAK GGI T+EMN+LE+DFLFG+GF LNVT ST++ YCS  
Sbjct  128  NAYYAKNGGITTEEMNLLELDFLFGVGFKLNVTCSTYYDYCSSL  171



>ref|XP_002873308.1| CYCP4_3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49567.1| CYCP4_3 [Arabidopsis lyrata subsp. lyrata]
Length=220

 Score =   164 bits (414),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 96/120 (80%), Gaps = 1/120 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKYA+CS SC++VAYIYL RF ++QP L I+SFNVHRL+I SVLVS KFMDDL YN
Sbjct  68   MERIFKYADCSDSCYIVAYIYLDRFIQKQPFLPIDSFNVHRLIITSVLVSAKFMDDLCYN  127

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NA+YAKVGGI T+EMN+LE+DFLFGIGF LNVT S+++ YCS    ++   R  Y   L+
Sbjct  128  NAFYAKVGGITTEEMNLLELDFLFGIGFQLNVTVSSYNDYCSSLQREM-VMRTMYSPLLE  186



>ref|XP_009389264.1| PREDICTED: cyclin-P4-1 [Musa acuminata subsp. malaccensis]
Length=197

 Score =   162 bits (411),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 98/148 (66%), Gaps = 12/148 (8%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+YANCS SC+VVAYIY+ RF  R P + ++SFNVHR LI SVL +VKFMDD++YN
Sbjct  59   LERIFRYANCSPSCYVVAYIYIDRFLWRHPAVFLDSFNVHRFLITSVLTAVKFMDDIYYN  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+AKVGGI   EMN LEVDFLFG+GF LNVTP  F +YCS    ++  + P  P  L 
Sbjct  119  NAYFAKVGGISLMEMNYLEVDFLFGVGFELNVTPVIFSSYCSTLQREMYLESPASPPRL-  177

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
                        CC+ E++       QQ
Sbjct  178  -----------HCCLTEEESSSCQQKQQ  194



>ref|XP_003572092.2| PREDICTED: cyclin-P4-1-like [Brachypodium distachyon]
Length=211

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 101/150 (67%), Gaps = 6/150 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF++A CS SC+VVAYIYL RF RR+P L ++SFNVHRLLI SVL +VKF+DD+ YN
Sbjct  65   LERIFRFAGCSPSCYVVAYIYLDRFLRRRPALAVDSFNVHRLLITSVLTAVKFVDDICYN  124

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+A+VGGI   EMN LEVDFLFG+ F+LNVTP+TF +YCS   A++       P  + 
Sbjct  125  NAYFARVGGISLMEMNYLEVDFLFGVAFDLNVTPATFDSYCSVLQAEMAFLDHPPPSPVD  184

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQHH  224
             +   +  H  Q       +   H H+Q  
Sbjct  185  DVSPALLQHQDQV------DAGRHRHEQQQ  208



>ref|NP_001065406.1| Os10g0563900 [Oryza sativa Japonica Group]
 sp|Q7XC35.1|CCP41_ORYSJ RecName: Full=Cyclin-P4-1; Short=CycP4;1 [Oryza sativa Japonica 
Group]
 gb|AAG60183.1|AC084763_3 hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP55040.1| Cyclin, N-terminal domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27243.1| Os10g0563900 [Oryza sativa Japonica Group]
 gb|EAY79543.1| hypothetical protein OsI_34672 [Oryza sativa Indica Group]
 gb|EAZ16997.1| hypothetical protein OsJ_32482 [Oryza sativa Japonica Group]
 dbj|BAG98076.1| unnamed protein product [Oryza sativa Japonica Group]
Length=212

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 103/146 (71%), Gaps = 9/146 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF++ANCS SC+VVAYIYL RF RR+P L ++SFNVHRLLI SVL +VKF+DD+ YN
Sbjct  61   LERIFRFANCSPSCYVVAYIYLDRFLRRRPALAVDSFNVHRLLITSVLTAVKFVDDICYN  120

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+A+VGGI   EMN LEVDFLFGI F+LNVTP+ F +YC+   +++         +L+
Sbjct  121  NAYFARVGGISLMEMNYLEVDFLFGIAFDLNVTPAAFASYCAVLQSEMT--------YLE  172

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHH  236
            Q   V     H CC  + D+   HH 
Sbjct  173  QPPAVDLPRLH-CCPSDQDDAGCHHK  197



>ref|XP_006662071.1| PREDICTED: cyclin-P4-1-like [Oryza brachyantha]
Length=222

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 102/139 (73%), Gaps = 8/139 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF++ANCS SC+VVAYIYL RF RR+P L ++SFNVHRLLI SVL +VKF+DD+ YN
Sbjct  67   LERIFRFANCSPSCYVVAYIYLDRFLRRRPALAVDSFNVHRLLITSVLTAVKFVDDICYN  126

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+A+VGGI   EMN LEVDFLFGI F+LNVTP+ F +YC    A +Q++      +L+
Sbjct  127  NAYFARVGGISLMEMNYLEVDFLFGIAFDLNVTPAAFASYC----AVLQSEM----AYLE  178

Query  313  QLGEVVSNHHHQCCIEEDD  257
            Q   V     H C  ++DD
Sbjct  179  QPAAVDLPSLHCCPSDQDD  197



>ref|XP_010546128.1| PREDICTED: cyclin-U4-3-like [Tarenaya hassleriana]
Length=206

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/107 (69%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKYANCSHSC++VAYIYL RF ++QP   I+SFNVHRL+I SVLVS KFMDD  YN
Sbjct  72   VERIFKYANCSHSCYIVAYIYLDRFVQKQPFSPIDSFNVHRLIITSVLVSSKFMDDKRYN  131

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ  353
            N YYAK+GGI  +EMN+LE++FLFG+GF LNVTPSTF  Y S   +Q
Sbjct  132  NGYYAKIGGISGEEMNVLEMEFLFGLGFQLNVTPSTFSGYSSFLHSQ  178



>ref|XP_004983624.1| PREDICTED: cyclin-P4-1-like [Setaria italica]
Length=227

 Score =   161 bits (407),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 99/136 (73%), Gaps = 4/136 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF++A+CS SC+VVAYIYL RF RR+P L ++SFNVHRLLI SVL +VKF+DD+ YN
Sbjct  69   LERIFRFASCSPSCYVVAYIYLDRFLRRRPALAVDSFNVHRLLITSVLTAVKFVDDICYN  128

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+A+VGGI   EMN LEVDFLFGI F+LNVTP+ F +YCS   +++    P  P    
Sbjct  129  NAYFARVGGISLVEMNYLEVDFLFGIAFDLNVTPAAFASYCSVLQSEMAYLDPPSPVDAP  188

Query  313  QL----GEVVSNHHHQ  278
            +L        S+HHH 
Sbjct  189  RLHCYSSAGTSDHHHD  204



>ref|XP_010483846.1| PREDICTED: cyclin-U4-3-like [Camelina sativa]
Length=222

 Score =   160 bits (406),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 86/101 (85%), Gaps = 0/101 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+YANCS+SC++VAYIYL RF ++QP L INS NVHRL+I SVLVS KFMDDL YN
Sbjct  67   LERIFEYANCSYSCYIVAYIYLDRFLKKQPFLPINSHNVHRLIITSVLVSAKFMDDLSYN  126

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            N YYAKVGGI  +EMN+LE+DFLFGI F LNVT STF+ YC
Sbjct  127  NGYYAKVGGISREEMNMLELDFLFGIEFQLNVTVSTFNKYC  167



>ref|XP_008794908.1| PREDICTED: cyclin-P4-1 [Phoenix dactylifera]
Length=201

 Score =   159 bits (402),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 99/140 (71%), Gaps = 13/140 (9%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+YA+CS +C+VVAY+YL RF++R P + I+SFNVHR +I SVL +VKFMDD++YN
Sbjct  60   LERIFRYASCSPACYVVAYVYLDRFTKRHPSVSIDSFNVHRFIITSVLTAVKFMDDIYYN  119

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQ-AQRPHYPGFL  317
            NAY+AKVGGI   EMN LEVDFLFG+GF LNVTP  FH+YCS    ++   + P  P  L
Sbjct  120  NAYFAKVGGITLMEMNYLEVDFLFGMGFELNVTPVIFHSYCSILQREMHLLESPPAPPRL  179

Query  316  QQLGEVVSNHHHQCCIEEDD  257
                         CC+ E++
Sbjct  180  ------------HCCLTEEE  187



>ref|XP_002467475.1| hypothetical protein SORBIDRAFT_01g028810 [Sorghum bicolor]
 gb|EER94473.1| hypothetical protein SORBIDRAFT_01g028810 [Sorghum bicolor]
Length=238

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 102/148 (69%), Gaps = 5/148 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF++A+CS SC+VVAYIYL RF RR+P L ++SFNVHRLLI SVL +VKF+DD+ YN
Sbjct  72   LERIFRFASCSPSCYVVAYIYLDRFLRRRPALAVDSFNVHRLLITSVLTAVKFVDDICYN  131

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+A+VGGI   EMN LEVDFLFGI F+LNVTP+ F +YC    A +Q++  +      
Sbjct  132  NAYFARVGGISLVEMNYLEVDFLFGIAFDLNVTPAAFASYC----AVLQSEMAYLDTPPA  187

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQ  230
             + E    HHH C         DHHH  
Sbjct  188  PVVEAPRLHHH-CYAAAAAGTSDHHHDD  214



>ref|XP_008453846.1| PREDICTED: cyclin-U4-1-like [Cucumis melo]
Length=207

 Score =   159 bits (401),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 2/110 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRF--SRRQPLLRINSFNVHRLLIASVLVSVKFMDDLF  500
            LERIFKYANCS SCFVVAY+YLHRF  +       I+SFNVHRLLI SVLVS KF DDL+
Sbjct  64   LERIFKYANCSPSCFVVAYVYLHRFLHNHHPSNFHIDSFNVHRLLITSVLVSAKFFDDLY  123

Query  499  YNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI  350
            YNNAYYAKVGGI T EMN+LE+DFLFG+ F LNV+P+TFH YCS+  +++
Sbjct  124  YNNAYYAKVGGISTMEMNLLELDFLFGLRFQLNVSPNTFHIYCSYLQSEM  173



>ref|XP_010443988.1| PREDICTED: cyclin-U4-3-like [Camelina sativa]
Length=222

 Score =   159 bits (402),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 85/101 (84%), Gaps = 0/101 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+YANCS+SC++VAYIYL R  ++QP L INS NVHRL+I SVLVS KFMDDL YN
Sbjct  67   LERIFEYANCSYSCYIVAYIYLDRLVKKQPFLPINSHNVHRLIITSVLVSAKFMDDLSYN  126

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            N YYAKVGGI  +EMN+LE+DFLFGI F LNVT STF+ YC
Sbjct  127  NGYYAKVGGISREEMNMLELDFLFGIEFQLNVTVSTFNNYC  167



>ref|XP_010919767.1| PREDICTED: cyclin-P4-1 [Elaeis guineensis]
Length=201

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+YANCS +C+VVAYIYL RF+ R P + I+S NVHR +I SVL +VKFMDD++YN
Sbjct  60   LERIFRYANCSPACYVVAYIYLDRFTLRHPSVSIDSLNVHRFIITSVLTAVKFMDDIYYN  119

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAY+AKVGGI   EMN LEVDFLFG+GF LNV+P  FH+YCS
Sbjct  120  NAYFAKVGGITLMEMNYLEVDFLFGMGFELNVSPDIFHSYCS  161



>ref|XP_004167894.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
Length=196

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRF--SRRQPLLRINSFNVHRLLIASVLVSVKFMDDLF  500
            LERIFKYANCS SCFV AY+YLHRF  +     L I+SFNVHRLLI SVLVS KF DDL+
Sbjct  57   LERIFKYANCSPSCFVAAYVYLHRFLHNHHPSNLHIDSFNVHRLLITSVLVSAKFFDDLY  116

Query  499  YNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI  350
            YNNAYYAKVGGI T EMN LE+DFLFG+ F LNV+P+TFH YCS+  +++
Sbjct  117  YNNAYYAKVGGISTMEMNHLELDFLFGLRFQLNVSPNTFHIYCSYLQSEM  166



>ref|XP_004146934.1| PREDICTED: cyclin-U4-1-like [Cucumis sativus]
 gb|KGN53181.1| hypothetical protein Csa_4G025110 [Cucumis sativus]
Length=196

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 2/110 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRF--SRRQPLLRINSFNVHRLLIASVLVSVKFMDDLF  500
            LERIFKYANCS SCFV AY+YLHRF  +     L I+SFNVHRLLI SVLVS KF DDL+
Sbjct  57   LERIFKYANCSPSCFVAAYVYLHRFLHNHHPSNLHIDSFNVHRLLITSVLVSAKFFDDLY  116

Query  499  YNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI  350
            YNNAYYAKVGGI T EMN LE+DFLFG+ F LNV+P+TFH YCS+  +++
Sbjct  117  YNNAYYAKVGGISTMEMNHLELDFLFGLRFQLNVSPNTFHIYCSYLQSEM  166



>ref|XP_009400236.1| PREDICTED: cyclin-P4-1-like [Musa acuminata subsp. malaccensis]
Length=206

 Score =   155 bits (393),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 94/147 (64%), Gaps = 9/147 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+YA CS +C+VVAYIYL RF+RR P    +S NVHR LI SVL +VKFMDD+ YN
Sbjct  59   LERIFRYAGCSPACYVVAYIYLDRFARRHPAASFDSLNVHRFLITSVLTAVKFMDDICYN  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+AKVGGI   EMN LE+DFLF IGF LNVTP+ F +YCS        QR  Y   LQ
Sbjct  119  NAYFAKVGGISLMEMNHLEIDFLFSIGFELNVTPAIFSSYCSIL------QRELY---LQ  169

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQ  233
                   + +  CC+ ED        Q
Sbjct  170  SPPPPPPSTNLHCCLTEDGSSSRQQKQ  196



>gb|EMS61422.1| hypothetical protein TRIUR3_30801 [Triticum urartu]
Length=266

 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF++A CS SC+VVAYIYL RF RR+P L ++SFNVHRLLI SVL +VKF+DD+ YN
Sbjct  84   LERIFRFAGCSPSCYVVAYIYLDRFLRRRPALAVDSFNVHRLLITSVLTAVKFVDDICYN  143

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAY+A+VGGI   EMN LEVDFLFGI F+LNVTP+ F +YC+
Sbjct  144  NAYFARVGGISLMEMNYLEVDFLFGIAFDLNVTPAVFASYCA  185



>tpg|DAA46330.1| TPA: hypothetical protein ZEAMMB73_464167 [Zea mays]
Length=226

 Score =   155 bits (391),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF++A CS SC+VVAYIYL RF RR+P L ++SFNVHRLLI SVL +VKF+DD+ YN
Sbjct  65   LERIFRFAGCSPSCYVVAYIYLDRFLRRRPALAVDSFNVHRLLITSVLTAVKFVDDICYN  124

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAY+A+VGGI   EMN LEVDFLFGI F+LNVTP+ F +YC+
Sbjct  125  NAYFARVGGISLVEMNYLEVDFLFGIAFDLNVTPAAFASYCA  166



>ref|XP_009389583.1| PREDICTED: cyclin-P4-1-like [Musa acuminata subsp. malaccensis]
Length=205

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 92/138 (67%), Gaps = 11/138 (8%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+YA CS SC+V AYIYL RF RR P + ++S NVHR LI SVL +VKF+DD+ YN
Sbjct  60   LERIFRYAGCSLSCYVAAYIYLDRFLRRHPAVSLHSLNVHRFLITSVLAAVKFVDDIHYN  119

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+AKVGGI   EMN LEVDFLFGIGF LN+TP  F +YCS    ++  + P  P  L 
Sbjct  120  NAYFAKVGGINLVEMNYLEVDFLFGIGFELNITPVMFTSYCSILQREMYLEPPPSPPRL-  178

Query  313  QLGEVVSNHHHQCCIEED  260
                      H C  EED
Sbjct  179  ----------HSCSTEED  186



>gb|EMT31645.1| hypothetical protein F775_30140 [Aegilops tauschii]
Length=239

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L RIF++A CS SC+VVAYIYL RF RR+P L ++SFNVHRLLI SVL +VKF+DD+ YN
Sbjct  84   LARIFRFAGCSPSCYVVAYIYLDRFLRRRPALAVDSFNVHRLLITSVLTAVKFVDDICYN  143

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAY+A+VGGI   EMN LEVDFLFGI F+LNVTP+ F +YC+
Sbjct  144  NAYFARVGGISLMEMNYLEVDFLFGIAFDLNVTPAVFASYCA  185



>gb|KHG29431.1| Cyclin-U4-1 -like protein [Gossypium arboreum]
Length=182

 Score =   151 bits (382),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 91/125 (73%), Gaps = 1/125 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L RIFK+ANCS  CFV+AY+YL RF +  P L +NSFNVHRLLI SVLVS +FMDD+ Y 
Sbjct  57   LHRIFKHANCSPCCFVLAYVYLDRFMQMHPSLPLNSFNVHRLLITSVLVSAQFMDDICYI  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQR-PHYPGFL  317
            NAYYAKVG I T+EMNILEVDFLFG+GF LNV P TF TY      +++ Q  P +  F 
Sbjct  117  NAYYAKVGSISTEEMNILEVDFLFGLGFQLNVKPDTFRTYFCFLQREMRLQTPPPFYKFW  176

Query  316  QQLGE  302
            Q L +
Sbjct  177  QNLSK  181



>ref|XP_010934119.1| PREDICTED: cyclin-P4-1-like [Elaeis guineensis]
Length=200

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 91/121 (75%), Gaps = 7/121 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF YA+CS +C+VVAY+YL RF+RR P + INSFN+HRLL+ S+L ++KFM+ + Y+
Sbjct  59   LERIFHYADCSPTCYVVAYVYLERFARRHPPVFINSFNIHRLLLTSILTAIKFMERIHYD  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQ-------AQRP  335
            NAY+A+VGGI   EMN LEV+FLFG+GF LNVTP+ F++YCS    ++          RP
Sbjct  119  NAYFARVGGITLMEMNNLEVNFLFGVGFELNVTPTVFYSYCSRLREEMHLLESPPAPPRP  178

Query  334  H  332
            H
Sbjct  179  H  179



>ref|XP_008786194.1| PREDICTED: cyclin-P4-1 [Phoenix dactylifera]
Length=194

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 83/101 (82%), Gaps = 0/101 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF++A+CS +C+ VAY+YL RF+RR P + I+SFNVHRLLI ++L +VKFMDD+ Y 
Sbjct  61   LERIFRHADCSPACYAVAYVYLDRFTRRHPPVLIDSFNVHRLLITTILAAVKFMDDIHYG  120

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NAY+AKVGGI   EMN LE+DFLFG+GF LNVTP  FH+ C
Sbjct  121  NAYFAKVGGISLMEMNCLEMDFLFGVGFELNVTPMIFHSCC  161



>ref|XP_002966846.1| hypothetical protein SELMODRAFT_68732, partial [Selaginella moellendorffii]
 gb|EFJ31445.1| hypothetical protein SELMODRAFT_68732, partial [Selaginella moellendorffii]
Length=157

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+Y+ RF +++P L I S NVHRLL+ SV+V+ KF+DD +YN
Sbjct  49   LERIFKYANCSPSCFVVAYVYIDRFIQQKPSLPITSLNVHRLLVTSVMVAAKFLDDAYYN  108

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQ  347
            NAYYAKVGG+ T+EMN LE++FLF + F L VT S F +YC+    ++ 
Sbjct  109  NAYYAKVGGVNTQEMNRLELEFLFHLNFRLQVTVSVFESYCNRLEKEVS  157



>ref|XP_006648892.1| PREDICTED: cyclin-P4-1-like [Oryza brachyantha]
Length=179

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 96/156 (62%), Gaps = 18/156 (12%)
 Frame = -2

Query  667  RIFKYANCSHSCFVVAYIYLHRFSRRQP--LLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            RI ++A CS +C+VVAYIYL R  RR     L ++S++VHRLLI +VL +VKFMDD+ YN
Sbjct  40   RIARFAGCSPACYVVAYIYLDRLLRRGRCLALAVDSYSVHRLLITAVLSAVKFMDDICYN  99

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+AKVGGI   EMN LEVDFLFG+GF+LNVTP TF  YC+   +++    P       
Sbjct  100  NAYFAKVGGISLAEMNYLEVDFLFGLGFDLNVTPETFGDYCAVLQSEMLTAAPP------  153

Query  313  QLGEVVSNHHHQCCIEEDDECIDHHHQQHHYPMLAA  206
                      H CC+ EDD        +   PM A+
Sbjct  154  --------RLHSCCLSEDDA--GSSSLREAAPMEAS  179



>ref|XP_002994358.1| hypothetical protein SELMODRAFT_48686, partial [Selaginella moellendorffii]
 gb|EFJ04573.1| hypothetical protein SELMODRAFT_48686, partial [Selaginella moellendorffii]
Length=157

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS SCFVVAY+Y+ RF +++P L + S NVHRLL+ SV+V+ KF+DD +YN
Sbjct  49   LERIFKYANCSPSCFVVAYVYIDRFIQQKPSLPVTSLNVHRLLVTSVMVAAKFLDDAYYN  108

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQ  347
            NAYYAKVGG+ T+EMN LE++FLF + F L VT S F +YC+    ++ 
Sbjct  109  NAYYAKVGGVNTQEMNRLELEFLFHLNFRLQVTVSVFESYCNRLEKEVS  157



>ref|XP_002985239.1| hypothetical protein SELMODRAFT_48560, partial [Selaginella moellendorffii]
 gb|EFJ13733.1| hypothetical protein SELMODRAFT_48560, partial [Selaginella moellendorffii]
Length=170

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKYANCS +CFVVAY Y+ RF  +QP + I S NVHRLLI SV+V+ KF+DD +YN
Sbjct  50   LERIFKYANCSPACFVVAYAYMDRFIHQQPDVPITSLNVHRLLITSVMVAAKFLDDAYYN  109

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI  350
            NAYYAKVGG+ T EMN LE+ FLF + F L VT + F +YCSH   ++
Sbjct  110  NAYYAKVGGVSTLEMNRLELQFLFRLDFRLQVTVTMFESYCSHLEREV  157



>ref|XP_010544563.1| PREDICTED: cyclin-U4-1-like [Tarenaya hassleriana]
Length=194

 Score =   142 bits (358),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L RIFKY+ CS SC VVAY+Y+ RF++  P + I SFNVHRLLI S +VS KF DD++Y+
Sbjct  56   LNRIFKYSKCSPSCVVVAYVYIDRFAQLHPSVPITSFNVHRLLITSFMVSAKFFDDIYYS  115

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF  362
            NAYYAK+GGI T E+N LE+DFLFG+ F LN+ P+TFH Y S+ 
Sbjct  116  NAYYAKIGGITTAEINTLELDFLFGLRFRLNLKPNTFHAYLSYL  159



>dbj|BAK01932.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=210

 Score =   142 bits (359),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 98/152 (64%), Gaps = 13/152 (9%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRF--SRRQPLLRINSFNVHRLLIASVLVSVKFMDDLF  500
            + RI ++A CS +C+VVAYIYL R     R+  L ++S++VHRLLI +VL +VKFMDD+ 
Sbjct  66   VARIARFAGCSPACYVVAYIYLDRLLHRARRFALAVDSYSVHRLLITTVLAAVKFMDDVC  125

Query  499  YNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQ-AQRPHYPG  323
            YNNAY+AKVGGI   EMN LEVDFLFG+GF+LNVTP TF  YC+   +++  A+ P  P 
Sbjct  126  YNNAYFAKVGGISLVEMNYLEVDFLFGVGFDLNVTPETFGHYCAVLQSEMLCAEAPPAPP  185

Query  322  FLQQLGEVVSNHHHQCCIEEDDECIDHHHQQH  227
             LQ          H C  E +D+      QQ 
Sbjct  186  RLQ----------HCCLSESEDDAASCGSQQQ  207



>dbj|BAJ89972.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=215

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 89/139 (64%), Gaps = 0/139 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            + RI ++A CS +CFVV YIYL R   R+  L ++S+ VHRLLI +VL +VKFMDD+ YN
Sbjct  59   MARIARFAGCSPACFVVGYIYLDRLLGRRRALAVDSYCVHRLLITTVLSAVKFMDDICYN  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+AKVGGI   EMN LEVDFLFG+GF+LNV+P TF  YC+   +++          L 
Sbjct  119  NAYFAKVGGISLPEMNYLEVDFLFGVGFDLNVSPETFGHYCAILQSEMLCLELEPEPLLP  178

Query  313  QLGEVVSNHHHQCCIEEDD  257
                        CC+ EDD
Sbjct  179  PTTAYAPGSRMHCCVSEDD  197



>ref|XP_010934125.1| PREDICTED: cyclin-P4-1 [Elaeis guineensis]
Length=204

 Score =   141 bits (356),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF++A+CS +C+VVAY+YL RF++R P + INS NVH LL+ S+L +VKFM+ + Y+
Sbjct  59   LERIFRHADCSPTCYVVAYVYLERFAQRHPPVFINSLNVHLLLLTSILTAVKFMERIHYD  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI  350
            NAY+A+VGGI   EMN LEV+FLFG+GF LNVTP+ F++YCS    ++
Sbjct  119  NAYFARVGGITLMEMNNLEVNFLFGVGFELNVTPTVFYSYCSRLREEM  166



>gb|EMT32586.1| hypothetical protein F775_21459 [Aegilops tauschii]
Length=206

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 96/143 (67%), Gaps = 14/143 (10%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRF--SRRQPLLRINSFNVHRLLIASVLVSVKFMDDLF  500
            + RI ++A CS +C+VVAYIYL R     R+  L ++S++VHRLLI +VL +VKFMDD+ 
Sbjct  64   VARIARFAGCSPACYVVAYIYLDRLLHRARRFALAVDSYSVHRLLITTVLAAVKFMDDVC  123

Query  499  YNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQ-AQRPHYPG  323
            YNNAY+AKVGGI   EMN LEVDFLFG+GF+LNVTP TF  YC+   +++  A+ P  P 
Sbjct  124  YNNAYFAKVGGISLVEMNYLEVDFLFGVGFDLNVTPETFGHYCAVLQSEMLCAEAPSAPP  183

Query  322  FLQQLGEVVSNHHHQCCIEEDDE  254
             LQ            CC+ E ++
Sbjct  184  RLQ-----------YCCLTESED  195



>ref|XP_008669070.1| PREDICTED: cyclin-P4-1-like [Zea mays]
 tpg|DAA36623.1| TPA: hypothetical protein ZEAMMB73_627938 [Zea mays]
Length=207

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 92/139 (66%), Gaps = 12/139 (9%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRR-QPLLRINSFNVHRLLIASVLVSVKFMDDLFY  497
            + RI ++A CS +C+VVAY+YL R  RR +    ++S+ VHRLLI +VL +VKFMDD+ Y
Sbjct  64   MARIARFAGCSPACYVVAYVYLDRLLRRARSAPAVDSYTVHRLLITAVLAAVKFMDDVCY  123

Query  496  NNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ---IQAQRPHYP  326
            NNAY+A+VGGI   EMN LEVDFLF +GF+LNV+P TF  YC+   A+   ++ + P  P
Sbjct  124  NNAYFARVGGISLSEMNYLEVDFLFAVGFDLNVSPETFGHYCTVLRAEMLYLELEGPPPP  183

Query  325  GFLQQLGEVVSNHHHQCCI  269
                      S   H+CC+
Sbjct  184  A--------ASTSLHRCCL  194



>ref|XP_011040342.1| PREDICTED: cyclin-U4-1-like isoform X2 [Populus euphratica]
Length=124

 Score =   134 bits (337),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 9/113 (8%)
 Frame = -2

Query  595  RRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYNNAYYAKVGGIGTKEMNILEVDFLFGI  416
            +RQ    +NSFNVHRLLI SVLVSVKFMDD++YNNA+YAKVGGI T+EMN+LEVDFLFG+
Sbjct  12   KRQSCFPLNSFNVHRLLITSVLVSVKFMDDIYYNNAFYAKVGGISTREMNLLEVDFLFGL  71

Query  415  GFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQQLGEVVSNHHHQCCIEEDD  257
            GF LNVTP+TFH YCS+   ++  Q P        +   +  H   CC  ED+
Sbjct  72   GFQLNVTPATFHFYCSYLQREMSIQSP------LNIARPLKIH---CCFNEDE  115



>gb|EMT12283.1| hypothetical protein F775_15957 [Aegilops tauschii]
Length=221

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 91/140 (65%), Gaps = 1/140 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            + RI ++A CS +CFVV YIYL R  RR+  L ++S++VHRLLI +VL +VKFMDD+ YN
Sbjct  63   MARIARFAGCSPACFVVGYIYLDRLLRRRRALAVDSYSVHRLLITTVLSAVKFMDDICYN  122

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+AKVGGI   EMN LEVDFLFG+GF+LNV+P TF  YC+   +++          L 
Sbjct  123  NAYFAKVGGISLPEMNYLEVDFLFGVGFDLNVSPETFGHYCAILQSEMLCLELEPESLLP  182

Query  313  QLG-EVVSNHHHQCCIEEDD  257
                         CC+ EDD
Sbjct  183  PTAVAAAPGSRMHCCLSEDD  202



>ref|XP_004953300.1| PREDICTED: cyclin-P4-1-like [Setaria italica]
Length=211

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 98/153 (64%), Gaps = 14/153 (9%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLL--RINSFNVHRLLIASVLVSVKFMDDLF  500
            + RI ++A CS +C+VVAY+YL R  RR   L   ++S++VHRLLI SVL +VKFMDD+ 
Sbjct  67   MARIARFAGCSPACYVVAYVYLDRLLRRGRRLALAVDSYSVHRLLITSVLAAVKFMDDIC  126

Query  499  YNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQ-AQRPHYPG  323
            YNNAY+AKVGGI   EMN LEVDFLFG+GF+LNV P TF  YC+   +++  A+ P  P 
Sbjct  127  YNNAYFAKVGGITLAEMNYLEVDFLFGVGFDLNVAPETFADYCAVLQSELLCAEAPPPPL  186

Query  322  FLQQLGEVVSNHHHQCCIEEDDECIDHHHQQHH  224
             LQ            CC+ +DD+       QH 
Sbjct  187  RLQ-----------HCCLSDDDDAAAGCSAQHQ  208



>ref|XP_009387832.1| PREDICTED: cyclin-P3-1-like [Musa acuminata subsp. malaccensis]
Length=222

 Score =   136 bits (343),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 84/116 (72%), Gaps = 4/116 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+ CS SCFV+AYIY+ RF  +QP + + S NVHRLLIASV+V+ KF+DD F++
Sbjct  79   MERIFKYSKCSPSCFVLAYIYIERF-LQQPNICLTSLNVHRLLIASVVVAAKFIDDAFFS  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ---IQAQRP  335
            NAYYAKVGGI T EMN LE++FLF + F L VT  TF  YC     +    Q +RP
Sbjct  138  NAYYAKVGGISTMEMNRLEINFLFSVDFRLQVTVGTFEAYCLRLEKENKVYQVERP  193



>ref|NP_001047597.1| Os02g0652000 [Oryza sativa Japonica Group]
 dbj|BAD24970.1| cyclin-like [Oryza sativa Japonica Group]
 dbj|BAD26570.1| cyclin-like [Oryza sativa Japonica Group]
 dbj|BAF09511.1| Os02g0652000 [Oryza sativa Japonica Group]
 dbj|BAG98538.1| unnamed protein product [Oryza sativa Japonica Group]
Length=212

 Score =   134 bits (337),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 91/142 (64%), Gaps = 18/142 (13%)
 Frame = -2

Query  667  RIFKYANCSHSCFVVAYIYLHRFSRRQPL-----LRINSFNVHRLLIASVLVSVKFMDDL  503
            RI ++A CS +C+VVAYIYL R  RR        L ++S++VHRLLI +VL +VKFMDD+
Sbjct  67   RIARFAGCSPACYVVAYIYLDRLLRRGRRCLALALAVDSYSVHRLLITAVLSAVKFMDDI  126

Query  502  FYNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPG  323
             YNNAY+AKVGGI   EMN LEVDFLFG+GF+LNVTP TF  YC+   +++    P    
Sbjct  127  CYNNAYFAKVGGISLAEMNYLEVDFLFGVGFDLNVTPETFADYCAVLQSEMLCAAP----  182

Query  322  FLQQLGEVVSNHHHQCCIEEDD  257
                         H CC+ EDD
Sbjct  183  ---------PTRLHYCCLSEDD  195



>ref|XP_002452825.1| hypothetical protein SORBIDRAFT_04g033250 [Sorghum bicolor]
 gb|EES05801.1| hypothetical protein SORBIDRAFT_04g033250 [Sorghum bicolor]
Length=214

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 97/144 (67%), Gaps = 16/144 (11%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLL--RINSFNVHRLLIASVLVSVKFMDDLF  500
            + RI ++A CS +C+VVAY+YL R  RR   L   ++S++VHRLLI +VL +VKFMDD+ 
Sbjct  68   MARIARFAGCSPACYVVAYVYLDRLLRRGRRLALAVDSYSVHRLLITAVLTAVKFMDDIC  127

Query  499  YNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI---QAQRPHY  329
            YNNAY+AKVGGI   EMN LEVDFLFG+GF+LNV+P TF  YC+   +++   +A+ P  
Sbjct  128  YNNAYFAKVGGISLVEMNYLEVDFLFGVGFDLNVSPETFGDYCAVLQSELLCAEAEAPPA  187

Query  328  PGFLQQLGEVVSNHHHQCCIEEDD  257
            P  LQ            CC+ EDD
Sbjct  188  PLRLQ-----------YCCLSEDD  200



>gb|ACG36976.1| PREG-like protein [Zea mays]
Length=234

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYNN  491
            ERIFKYA CS SCFV+A IY+ R+  +QP + + SF+VHRLLI SV+V+ KF+DD F+NN
Sbjct  81   ERIFKYAKCSPSCFVLALIYMERY-LQQPNIYMTSFSVHRLLITSVVVAAKFIDDAFFNN  139

Query  490  AYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            AYY +VGGI T+EMN+LE+D LFG+ F L V   TF +YC
Sbjct  140  AYYGRVGGISTREMNMLELDLLFGLDFRLKVDIETFESYC  179



>ref|NP_001149845.1| LOC100283473 [Zea mays]
 gb|ACL54060.1| unknown [Zea mays]
 gb|ACR35554.1| unknown [Zea mays]
 gb|ACR37589.1| unknown [Zea mays]
 gb|AFW77918.1| PREG-like protein [Zea mays]
Length=236

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYNN  491
            ERIFKYA CS SCFV+A IY+ R+  +QP + + SF+VHRLLI SV+V+ KF+DD F+NN
Sbjct  83   ERIFKYAKCSPSCFVLALIYMERY-LQQPNIYMTSFSVHRLLITSVVVAAKFIDDAFFNN  141

Query  490  AYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            AYY +VGGI T+EMN+LE+D LFG+ F L V   TF +YC
Sbjct  142  AYYGRVGGISTREMNMLELDLLFGLDFRLKVDIETFESYC  181



>emb|CDP03631.1| unnamed protein product [Coffea canephora]
Length=217

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+ CS SCF+VAYIY+ RF +R   + + S NVHRLLI SV+V+ K++DD FYN
Sbjct  79   IERIFKYSCCSPSCFIVAYIYVERFIKRTNAV-VTSLNVHRLLITSVMVAAKYIDDAFYN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAYYA+VGG+ T E+N LE+ FLFG+GF L V+  TF  YC+
Sbjct  138  NAYYARVGGVSTLELNKLEIKFLFGVGFQLFVSSDTFGKYCA  179



>ref|XP_001784037.1| predicted protein [Physcomitrella patens]
 gb|EDQ51143.1| predicted protein [Physcomitrella patens]
Length=171

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKY NCS SCFVV Y+++ R   RQP L + S NVHRLL+ SV+V+ K +DD+ +N
Sbjct  60   LERIFKYTNCSASCFVVGYVFIDRLIHRQPDLLVTSLNVHRLLVTSVMVATKILDDVHFN  119

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQA  344
            NA++A+VGG+   E+N LE++FLF + F L VT S F +YCS+   ++ A
Sbjct  120  NAFFARVGGVSVGELNRLELEFLFRLDFRLTVTVSIFESYCSYLEKEVMA  169



>ref|XP_003569998.1| PREDICTED: cyclin-P4-1-like [Brachypodium distachyon]
Length=216

 Score =   132 bits (332),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPL------LRINSFNVHRLLIASVLVSVKFM  512
            + RI ++A CS +C+VVAYIYL R   R         L ++S++VHRLLI +VL +VKFM
Sbjct  70   VARIARFAGCSPACYVVAYIYLDRLLHRGGGRRRRFALAVDSYSVHRLLITTVLAAVKFM  129

Query  511  DDLFYNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            DD+ YNNAY+AKVGGI   EMN LEVDFLFG+GF+LNVTP TF  YC+
Sbjct  130  DDICYNNAYFAKVGGISLAEMNYLEVDFLFGVGFDLNVTPETFGDYCA  177



>ref|XP_001784038.1| predicted protein [Physcomitrella patens]
 gb|EDQ51144.1| predicted protein [Physcomitrella patens]
Length=166

 Score =   130 bits (328),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKY NCS SCFVV Y+YL R   RQP L + S NVHRLL+ SV+V+ K +DD+ +N
Sbjct  59   LERIFKYTNCSPSCFVVGYVYLDRLIHRQPDLLVTSLNVHRLLVTSVMVATKMLDDVHFN  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF  362
            NA++A+VGG+   E+N LE++FLF + F L+VT S F +YCS+ 
Sbjct  119  NAFFARVGGVSVVELNRLELEFLFRLDFKLSVTISVFESYCSYL  162



>emb|CAC39033.1| PREG-like protein [Oryza sativa]
 gb|EAY86916.1| hypothetical protein OsI_08300 [Oryza sativa Indica Group]
Length=213

 Score =   131 bits (330),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 92/143 (64%), Gaps = 19/143 (13%)
 Frame = -2

Query  667  RIFKYANCSHSCFVVAYIYLHRFSRRQPL-----LRINSFNVHRLLIASVLVSVKFMDDL  503
            RI ++A CS +C+VVAYIYL R  RR        L ++S++VHRLLI +VL +VKFMDD+
Sbjct  67   RIARFAGCSPACYVVAYIYLDRLLRRGRRCLALALAVDSYSVHRLLITAVLSAVKFMDDI  126

Query  502  FYNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQ-AQRPHYP  326
             YNNAY+AKVGGI   EMN LEVDFLFG+GF+LNVTP TF  YC+   +++  A  P   
Sbjct  127  CYNNAYFAKVGGISLAEMNYLEVDFLFGVGFDLNVTPETFADYCAVLQSEMLCAAAP---  183

Query  325  GFLQQLGEVVSNHHHQCCIEEDD  257
                          H CC+ EDD
Sbjct  184  ----------PTRLHYCCLSEDD  196



>ref|XP_001763676.1| predicted protein [Physcomitrella patens]
 gb|EDQ71566.1| predicted protein, partial [Physcomitrella patens]
Length=161

 Score =   130 bits (326),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKY NCS SCFVVAY++L R   RQP L + + NVHRLL+ SV+V+ K +DD+ +N
Sbjct  54   LERIFKYTNCSPSCFVVAYVFLDRLVHRQPDLLVTTLNVHRLLVTSVMVATKMLDDVHFN  113

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF  362
            NA++A+VGG+   E+N LE++FLF + F L+VT S F +YC++ 
Sbjct  114  NAFFARVGGVSVVELNRLELEFLFRLDFKLSVTISVFESYCTYL  157



>ref|XP_011079855.1| PREDICTED: cyclin-P3-1-like [Sesamum indicum]
 ref|XP_011079856.1| PREDICTED: cyclin-P3-1-like [Sesamum indicum]
Length=217

 Score =   131 bits (330),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKYA CS SCFV+A IYL RF +R  L  + S N+HRLLI SV+V+ KFMDD F+N
Sbjct  79   IDRIFKYACCSPSCFVIANIYLDRFIQRTNLF-LTSLNIHRLLITSVMVAAKFMDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF  362
            NAYYA+VGG+ T E+N LE+ FLFG+ F ++VT  TF  YCS F
Sbjct  138  NAYYARVGGVSTAELNKLEIKFLFGLDFRIHVTVKTFGEYCSVF  181



>ref|XP_007050616.1| Cyclin p1,1 isoform 1 [Theobroma cacao]
 gb|EOX94773.1| Cyclin p1,1 isoform 1 [Theobroma cacao]
Length=218

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKYA CS SCFVVAYIY+ RF + Q  + + S NVHRLLI SV+V+ KF+DD F+N
Sbjct  79   IDRIFKYAGCSPSCFVVAYIYVDRFVQ-QTDVHLTSLNVHRLLITSVMVAAKFIDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI----QAQRP  335
            NAYYA+VGGI T E+N LE+ FLF + F L V+ +TF  YCS    +     Q +RP
Sbjct  138  NAYYARVGGISTAELNRLEMKFLFSLDFRLQVSVNTFQRYCSQLQKESSEGHQIERP  194



>ref|XP_003570865.1| PREDICTED: cyclin-P4-1-like [Brachypodium distachyon]
Length=262

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 83/118 (70%), Gaps = 7/118 (6%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPL---LRINSFNVHRLLIASVLVSVKFMDDLF  500
            ERI++YA CS +CFVVAY YL R +  +     LR++S++VHRLLI SVLV+ KFMDD+ 
Sbjct  99   ERIYRYAGCSPACFVVAYAYLDRLAAAEDEEAALRVDSYSVHRLLITSVLVAAKFMDDIH  158

Query  499  YNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC----SHFIAQIQAQR  338
            YNNAY+A+VGG+  +EMN LE++FLF + F LNVTP  F +YC    SH      A R
Sbjct  159  YNNAYFARVGGVELREMNGLELEFLFALRFRLNVTPDDFASYCAALESHIAPSASAGR  216



>ref|XP_006851092.1| hypothetical protein AMTR_s00025p00245040 [Amborella trichopoda]
 gb|ERN12673.1| hypothetical protein AMTR_s00025p00245040 [Amborella trichopoda]
Length=227

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 84/116 (72%), Gaps = 3/116 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+Y++CS SCF++AYIY+ RF  +QP + + S NVHRLLI SV+V+ KF+DD F++
Sbjct  80   LERIFEYSSCSPSCFILAYIYMDRFIHQQPEVPLTSLNVHRLLITSVMVAAKFIDDAFFD  139

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI---QAQRP  335
            NAYYAKVGG+ T E+N LE++ LF + F L V+   F T C+H   +    Q +RP
Sbjct  140  NAYYAKVGGVSTTEINRLELELLFTLDFRLQVSIVAFQTCCAHLEKEAGGYQIERP  195



>ref|XP_004493668.1| PREDICTED: cyclin-P3-1-like [Cicer arietinum]
Length=218

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 89/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ RF +   + ++ S NVHRLLI S++++ KFMDD F+N
Sbjct  79   IDRIFKYSGCSPSCFVVAHIYVDRFLQNTDI-KLTSLNVHRLLITSIMLAAKFMDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRPHYP  326
            NAYYAKVGG+ T E+N LE+ FLFGI F L V+  TF  YC     +    +Q +RP   
Sbjct  138  NAYYAKVGGVSTAELNRLEMSFLFGIDFRLQVSVDTFGRYCWDLEKEASETLQIERPMKA  197

Query  325  GFLQQLGEVVSNHHHQCC  272
                ++ E  SN     C
Sbjct  198  C---RIKESWSNKDDPSC  212



>gb|AFK40409.1| unknown [Medicago truncatula]
 gb|KEH23761.1| cyclin p4 [Medicago truncatula]
Length=218

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 89/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ R  +   + ++ S NVHRLLI S++++ KFMDD F+N
Sbjct  78   IDRIFKYSGCSPSCFVVAHIYVDRLLQNTEI-KLTSLNVHRLLITSIMLAAKFMDDAFFN  136

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF----IAQIQAQRPHYP  326
            NAYYA+VGG+ T E+N LE+ FLFGI F L V+  TFH YC       +  +Q +RP   
Sbjct  137  NAYYARVGGVKTCELNRLEMSFLFGIDFRLQVSVDTFHKYCWQLEEEGLETLQIERPMQA  196

Query  325  GFLQQLGEVVSNHHHQCC  272
                ++ E  SN     C
Sbjct  197  C---RIKESWSNKDDPSC  211



>ref|XP_002448263.1| hypothetical protein SORBIDRAFT_06g024180 [Sorghum bicolor]
 gb|EES12591.1| hypothetical protein SORBIDRAFT_06g024180 [Sorghum bicolor]
Length=218

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 94/148 (64%), Gaps = 17/148 (11%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLR------INSFNVHRLLIASVLVSVKFM  512
            + RI ++A CS +C+VVAY+YL R  RR    R      ++S++VHRLLI +VL +VKFM
Sbjct  67   MARIARFAGCSPACYVVAYVYLDRLLRRGRRGRGRRALAVDSYSVHRLLITAVLAAVKFM  126

Query  511  DDLFYNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPH  332
            DD+ YNNAY+A+VGGI   EMN LEVDFLF +GF+LNV+P TF  YC+   A++      
Sbjct  127  DDVCYNNAYFARVGGISLAEMNYLEVDFLFAVGFDLNVSPETFGHYCAVLRAEML-----  181

Query  331  YPGFLQQLGE---VVSNHHHQCCIEEDD  257
               +L+  G          H CC+ EDD
Sbjct  182  ---YLELEGPPPAAAGPRLHSCCLSEDD  206



>gb|EMS63928.1| hypothetical protein TRIUR3_31342 [Triticum urartu]
Length=307

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 92/139 (66%), Gaps = 1/139 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            + RI ++A CS +CFVV YIYL R  RR+  L ++S++VHRLLI +VL +VKFMDD+ YN
Sbjct  63   MARIARFAGCSPACFVVGYIYLDRLLRRRRALAVDSYSVHRLLITTVLSAVKFMDDICYN  122

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAY+AKVGGI   EMN LEVDFLFG+GF LNV+P TF  YC+   +++          L 
Sbjct  123  NAYFAKVGGISLPEMNYLEVDFLFGVGFELNVSPETFGHYCAILQSEMLCLELEPEPLLP  182

Query  313  QLGEVVSNHHHQCCIEEDD  257
                   +  H CC+ EDD
Sbjct  183  PNAAAPGSAMH-CCLSEDD  200



>gb|ACJ84821.1| unknown [Medicago truncatula]
 gb|AFK46113.1| unknown [Medicago truncatula]
Length=218

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 89/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ R  +   + ++ S NVHRLLI S++++ KFMDD F+N
Sbjct  78   IDRIFKYSGCSPSCFVVAHIYVDRLLQNTEI-KLTSLNVHRLLITSIMLAAKFMDDAFFN  136

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF----IAQIQAQRPHYP  326
            NAYYA+VGG+ T E+N LE+ FLFGI F L V+  TFH YC       +  +Q +RP   
Sbjct  137  NAYYARVGGVKTCELNRLEMSFLFGIDFRLQVSVDTFHKYCWQLEEEGLETLQIERPMQA  196

Query  325  GFLQQLGEVVSNHHHQCC  272
                ++ E  SN     C
Sbjct  197  C---RIKESWSNKDDPSC  211



>gb|KEH23760.1| cyclin p4 [Medicago truncatula]
Length=233

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 89/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ R  +   + ++ S NVHRLLI S++++ KFMDD F+N
Sbjct  93   IDRIFKYSGCSPSCFVVAHIYVDRLLQNTEI-KLTSLNVHRLLITSIMLAAKFMDDAFFN  151

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF----IAQIQAQRPHYP  326
            NAYYA+VGG+ T E+N LE+ FLFGI F L V+  TFH YC       +  +Q +RP   
Sbjct  152  NAYYARVGGVKTCELNRLEMSFLFGIDFRLQVSVDTFHKYCWQLEEEGLETLQIERPMQA  211

Query  325  GFLQQLGEVVSNHHHQCC  272
                ++ E  SN     C
Sbjct  212  C---RIKESWSNKDDPSC  226



>ref|XP_010255964.1| PREDICTED: cyclin-P3-1-like isoform X2 [Nelumbo nucifera]
 ref|XP_010255965.1| PREDICTED: cyclin-P3-1-like isoform X2 [Nelumbo nucifera]
Length=221

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY++CS SCFVVAYIY+ RF +R  +  + S NVHRLLI SV+V+ KF+DD F+N
Sbjct  79   IDRIFKYSSCSPSCFVVAYIYMDRFLQRTDIY-LTSLNVHRLLITSVMVAAKFLDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NAYYAKVGG+   EMN LE+ FLF + F L+VT  TF +YC
Sbjct  138  NAYYAKVGGVSLAEMNRLEMKFLFTLDFRLHVTVETFKSYC  178



>gb|ABK22429.1| unknown [Picea sitchensis]
Length=241

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 76/108 (70%), Gaps = 0/108 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERI+KY +CS SCFVV Y+Y+ R   RQP   + S N+HRLL+ SV+++ K +DD  YN
Sbjct  81   LERIYKYTSCSPSCFVVGYVYIDRLVHRQPDFPVISLNIHRLLLTSVMIAAKMLDDAHYN  140

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI  350
            NA+YA+VGGI   E+N LE+DFLF +GF L VT   F +YC H   ++
Sbjct  141  NAFYARVGGISNTELNRLEIDFLFRLGFRLKVTGKVFESYCLHLEKEM  188



>ref|XP_007162425.1| hypothetical protein PHAVU_001G151100g [Phaseolus vulgaris]
 ref|XP_007162426.1| hypothetical protein PHAVU_001G151100g [Phaseolus vulgaris]
 gb|ESW34419.1| hypothetical protein PHAVU_001G151100g [Phaseolus vulgaris]
 gb|ESW34420.1| hypothetical protein PHAVU_001G151100g [Phaseolus vulgaris]
Length=217

 Score =   129 bits (325),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 89/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ RF +   + ++ S NVHRLLI S++++ KF+DD FYN
Sbjct  78   IDRIFKYSGCSPSCFVVAHIYVDRFIQHTEI-KLTSLNVHRLLITSIMLAAKFIDDAFYN  136

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRPHYP  326
            NAYYAKVGG+ T E+N LE+ FLFG+ F L V+  TF  YC     +    +Q +RP   
Sbjct  137  NAYYAKVGGVSTSELNRLEMSFLFGVDFRLQVSVDTFGRYCRQLEKEAAETLQIERPMQA  196

Query  325  GFLQQLGEVVSNHHHQCC  272
                ++ E  SN     C
Sbjct  197  C---RIKESWSNKDDPTC  211



>ref|XP_002441059.1| hypothetical protein SORBIDRAFT_09g019600 [Sorghum bicolor]
 gb|EES19489.1| hypothetical protein SORBIDRAFT_09g019600 [Sorghum bicolor]
Length=237

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 95/152 (63%), Gaps = 9/152 (6%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYNN  491
            ERIFKYA CS SCFV+  IY+ R+  +QP + + SF+VHRLLIASV+V+ KF+DD F+NN
Sbjct  83   ERIFKYAKCSPSCFVLGLIYIERY-LQQPNIYMTSFSVHRLLIASVVVAAKFIDDAFFNN  141

Query  490  AYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQQ  311
            AYY +VGGI T+EMN+LE+D LF + F L V   TF +YC      +Q ++      L++
Sbjct  142  AYYGRVGGITTREMNMLELDLLFSLDFRLKVDIETFGSYC------LQLEKEALVLVLER  195

Query  310  LGEVVSNH--HHQCCIEEDDECIDHHHQQHHY  221
              +V + +   H  C    DE   H   +  Y
Sbjct  196  PIQVQAANVTKHLICNSSADETCKHELVRERY  227



>ref|XP_010255963.1| PREDICTED: cyclin-P3-1-like isoform X1 [Nelumbo nucifera]
Length=246

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY++CS SCFVVAYIY+ RF +R  +  + S NVHRLLI SV+V+ KF+DD F+N
Sbjct  104  IDRIFKYSSCSPSCFVVAYIYMDRFLQRTDIY-LTSLNVHRLLITSVMVAAKFLDDAFFN  162

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NAYYAKVGG+   EMN LE+ FLF + F L+VT  TF +YC
Sbjct  163  NAYYAKVGGVSLAEMNRLEMKFLFTLDFRLHVTVETFKSYC  203



>ref|XP_001753286.1| predicted protein [Physcomitrella patens]
 gb|EDQ81915.1| predicted protein [Physcomitrella patens]
Length=164

 Score =   127 bits (320),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 79/108 (73%), Gaps = 0/108 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKY NCS SCFVV Y+++ R   +QP L + S NVHRLL+ SV+V+ K +DD+ +N
Sbjct  57   LERIFKYTNCSASCFVVGYVFIDRLIHQQPELLVTSLNVHRLLVTSVMVATKILDDVHFN  116

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI  350
            NA++A+ GG+   E+N LE++FLF +GF L VT S F +YCS+   ++
Sbjct  117  NAFFARGGGVSVSELNRLELEFLFRLGFRLTVTVSLFESYCSYLEKEV  164



>ref|XP_002274682.1| PREDICTED: cyclin-P3-1 isoform X1 [Vitis vinifera]
Length=226

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ RF +      + S NVHRLLI SV+V+ KF+DD F+N
Sbjct  88   IDRIFKYSGCSPSCFVVAHIYVDRFLQHTDA-HLTSLNVHRLLITSVMVAAKFIDDAFFN  146

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI----QAQRP  335
            NAYYAKVGG+ T E+N LE+ FLF + F L VT  TF +YCS    ++    Q +RP
Sbjct  147  NAYYAKVGGVSTAELNRLEMKFLFSLDFRLQVTVETFRSYCSQLDKEVAGGLQIERP  203



>ref|XP_010652114.1| PREDICTED: cyclin-P3-1 isoform X2 [Vitis vinifera]
Length=217

 Score =   129 bits (323),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ RF +      + S NVHRLLI SV+V+ KF+DD F+N
Sbjct  79   IDRIFKYSGCSPSCFVVAHIYVDRFLQHTDA-HLTSLNVHRLLITSVMVAAKFIDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI----QAQRP  335
            NAYYAKVGG+ T E+N LE+ FLF + F L VT  TF +YCS    ++    Q +RP
Sbjct  138  NAYYAKVGGVSTAELNRLEMKFLFSLDFRLQVTVETFRSYCSQLDKEVAGGLQIERP  194



>ref|XP_010942426.1| PREDICTED: cyclin-P3-1-like [Elaeis guineensis]
Length=222

 Score =   129 bits (324),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 86/133 (65%), Gaps = 1/133 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKY+ CS SCFV+A+IY+ RF   QP + + S NVHRLLI S++V+ KF+DD F+N
Sbjct  79   LERIFKYSKCSPSCFVLAHIYIDRF-LHQPDIHLTSLNVHRLLITSIVVAAKFIDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGG+ T EMN LE++FLF + F L V   TF +YC     Q        P  + 
Sbjct  138  NAYYAKVGGVSTVEMNRLELNFLFNLDFRLQVNLETFGSYCLQLKKQATECSVERPIQVC  197

Query  313  QLGEVVSNHHHQC  275
            +L +  +    +C
Sbjct  198  RLKDWTTKEDSKC  210



>gb|KHF97746.1| Cyclin-P3-1 [Gossypium arboreum]
Length=264

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKYA CS SCF+VAYIY+ RF + Q  + + S NVHRLLI SVLV+ KF+DD F+N
Sbjct  125  IDRIFKYAGCSPSCFLVAYIYVDRFVQ-QTDVHLTSLNVHRLLITSVLVAAKFIDDAFFN  183

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI----QAQRP  335
            NAYYA+VGG+ T E+N LE+ FLFG+ F L VT +TF  YC     +     Q +RP
Sbjct  184  NAYYARVGGVSTAELNRLEMSFLFGLDFRLQVTVNTFQRYCCQLQKECWEGNQIERP  240



>gb|KHG00595.1| Cyclin-P3-1 [Gossypium arboreum]
Length=215

 Score =   129 bits (323),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 82/114 (72%), Gaps = 2/114 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKYA CS SCF+VAYIYL RFS+ Q  + + S NVHRLLI SV+V+ KF+DD ++N
Sbjct  79   IDRIFKYARCSPSCFLVAYIYLDRFSQ-QTDMHLTSLNVHRLLITSVMVAAKFIDDTYFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI-QAQRP  335
            NAYYA+VGGI T E+N LE+ FL  + F L V+ +TF  YC     +  Q +RP
Sbjct  138  NAYYARVGGISTAELNRLEMKFLLSLDFRLQVSINTFRRYCLQLQKEGNQVERP  191



>dbj|BAJ86315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=222

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 80/122 (66%), Gaps = 7/122 (6%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRIN-------SFNVHRLLIASVLVSVKFM  512
            ERI++YA CS +CFVVAY YL R +   P            S++VHRLLI SV+V+ KFM
Sbjct  62   ERIYRYAGCSPACFVVAYAYLDRLASPSPEEEDAAAAVAVDSYSVHRLLITSVMVAAKFM  121

Query  511  DDLFYNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPH  332
            DD+ YNNAY+A+VGG+  +EMN LE++FLF + F LNVTP  F +YC+    ++ A    
Sbjct  122  DDMHYNNAYFARVGGVELREMNGLELEFLFALRFRLNVTPDGFASYCAALEGEMMATDTP  181

Query  331  YP  326
             P
Sbjct  182  PP  183



>ref|XP_006576896.1| PREDICTED: cyclin-P3-1-like isoform X1 [Glycine max]
 ref|XP_006576897.1| PREDICTED: cyclin-P3-1-like isoform X2 [Glycine max]
 gb|KHN19896.1| Cyclin-P3-1 [Glycine soja]
Length=217

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 88/138 (64%), Gaps = 8/138 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ RF +   + ++ S NVHRLLI S++++ KF+DD FYN
Sbjct  78   IDRIFKYSGCSPSCFVVAHIYVDRFIQHTEI-KLTSLNVHRLLITSIMLAAKFIDDAFYN  136

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRPHYP  326
            NAYYAKVGG+ T E+N LE+ FLFGI F L  +  TF  YC     +    +Q +RP   
Sbjct  137  NAYYAKVGGVSTSELNRLEMSFLFGIDFRLQFSVDTFGRYCRQLEKEAAEVVQIERPMQA  196

Query  325  GFLQQLGEVVSNHHHQCC  272
                ++ E  SN     C
Sbjct  197  C---RIKESWSNKDDPTC  211



>ref|XP_009627788.1| PREDICTED: cyclin-P3-1 [Nicotiana tomentosiformis]
Length=217

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKY+ CS SCFVVA+IY+ RF        + S NVHRLLI SV+V+ KF+DD FYN
Sbjct  79   LDRIFKYSCCSPSCFVVAHIYMERFIEHTSA-HLTSLNVHRLLITSVMVAAKFIDDAFYN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAYYA+VGG+ TKE+N LE+ FLFG+ F L+V   TF +YCS
Sbjct  138  NAYYARVGGVTTKELNKLEMKFLFGLDFRLHVNVKTFGSYCS  179



>ref|XP_002976722.1| hypothetical protein SELMODRAFT_416667 [Selaginella moellendorffii]
 gb|EFJ22391.1| hypothetical protein SELMODRAFT_416667 [Selaginella moellendorffii]
Length=264

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 84/123 (68%), Gaps = 5/123 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKY NCS +CFVV Y+Y+ R S + P L I   NVHRLL+ SV+ + K +DD+ +N
Sbjct  119  LERIFKYTNCSPACFVVGYVYIDRLSHKHPDLPITPLNVHRLLVTSVMTASKILDDVHFN  178

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFI--AQIQAQRP---HY  329
            NA++A+VGGI T E+N LE++FLF + F L VT   F +YCS+    A++ + RP   H 
Sbjct  179  NAFFARVGGISTSEVNKLELEFLFRLDFRLTVTVQEFESYCSYLDREARLPSARPDHHHR  238

Query  328  PGF  320
             GF
Sbjct  239  SGF  241



>gb|EPS72561.1| hypothetical protein M569_02197, partial [Genlisea aurea]
Length=157

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            + RIFKY++CS SCFVVA+IYL R+  R  L R NS N+HRLLI S++V+ KFMDDLF+ 
Sbjct  54   IHRIFKYSSCSPSCFVVAHIYLDRYVHRTRL-RWNSLNIHRLLITSLVVAAKFMDDLFFK  112

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            N+YYA+VGGI T E+N LE+ FLF I F L V+  TF  YCS
Sbjct  113  NSYYARVGGISTAELNELELKFLFAIDFRLFVSVQTFMNYCS  154



>ref|XP_004962162.1| PREDICTED: cyclin-P3-1-like [Setaria italica]
Length=237

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 81/115 (70%), Gaps = 4/115 (3%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYNN  491
            ERIFKYA CS SCFV+A IY+ R+  +QP + + SF+VHRLLI SV+V+ KF+DD F+NN
Sbjct  83   ERIFKYAQCSPSCFVLALIYMERY-LQQPNIYMTSFSVHRLLITSVVVAAKFIDDSFFNN  141

Query  490  AYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQA---QRP  335
            AYY +VGGI T+EMN LE+D LF + F L V   TF +YC     +  A   +RP
Sbjct  142  AYYGRVGGISTREMNRLELDLLFSLDFRLKVNLETFRSYCLQLEKEALALVLERP  196



>ref|XP_003580261.1| PREDICTED: cyclin-P4-1-like [Brachypodium distachyon]
Length=222

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 81/103 (79%), Gaps = 1/103 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPL-LRINSFNVHRLLIASVLVSVKFMDDLFY  497
            + RI ++A CS +CFVVAYIYL R   R+   + ++S++VHRLLI +VL +VKF+DD+ Y
Sbjct  63   MARIARFAGCSPACFVVAYIYLDRLLSRRRRAIAVDSYSVHRLLITAVLAAVKFLDDICY  122

Query  496  NNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NNAY+AKVGGI   EMN LEVDFLFG+GF+LNV+P TF  YC+
Sbjct  123  NNAYFAKVGGISLPEMNYLEVDFLFGVGFDLNVSPETFGNYCA  165



>gb|AFK44566.1| unknown [Lotus japonicus]
Length=214

 Score =   127 bits (320),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFV+A+IY+ RF +   + ++ S NVHRLLI S++++ KFMDD F+N
Sbjct  78   IDRIFKYSGCSPSCFVLAHIYVDRFLQHTEI-KLTSLNVHRLLITSIMLATKFMDDAFFN  136

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYAKVGG+ T E+N LE+ FLFGI F L V+   F  YC     +    +Q +RP
Sbjct  137  NAYYAKVGGVSTSELNRLEMSFLFGIDFRLQVSVDKFQRYCWQLEKESADILQIERP  193



>gb|AFK44207.1| unknown [Lotus japonicus]
Length=214

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFV+A+IY+ RF +   + ++ S NVHRLLI S++++ KFMDD F+N
Sbjct  78   IDRIFKYSGCSPSCFVLAHIYVDRFLQHTEI-KLTSLNVHRLLITSIMLAAKFMDDAFFN  136

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYAKVGG+ T E+N LE+ FLFGI F L V+   F  YC     +    +Q +RP
Sbjct  137  NAYYAKVGGVSTSELNRLEMSFLFGIDFRLQVSVDKFQRYCWQLEKESADILQIERP  193



>gb|AFK40008.1| unknown [Lotus japonicus]
Length=214

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFV+A+IY+ RF +   + ++ S NVHRLLI S++++ KFMDD F+N
Sbjct  78   IDRIFKYSGCSPSCFVLAHIYVDRFLQHTEI-KLTSLNVHRLLITSIMLAAKFMDDAFFN  136

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYAKVGG+ T E+N LE+ FLFGI F L V+   F  YC     +    +Q +RP
Sbjct  137  NAYYAKVGGVSTSELNRLEMSFLFGIDFRLQVSVDKFQRYCWQLEKESADILQIERP  193



>ref|XP_008235285.1| PREDICTED: cyclin-P3-1 [Prunus mume]
 ref|XP_008235286.1| PREDICTED: cyclin-P3-1 [Prunus mume]
Length=217

 Score =   127 bits (319),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/115 (56%), Positives = 82/115 (71%), Gaps = 4/115 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA IY+ RF +   + R+ SFNVHRLLI SV+++ KF+DD F+N
Sbjct  79   VDRIFKYSGCSPSCFVVAQIYVDRFIQCTEV-RLTSFNVHRLLITSVMLAAKFIDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF---IAQIQAQR  338
            NAYYAKVGG+ T E+N LE+ FLF I F L V+  TF  YCS      A +Q +R
Sbjct  138  NAYYAKVGGVSTSELNRLEMKFLFTIDFRLQVSIETFKRYCSQLEKEAAGLQIER  192



>ref|XP_001760666.1| predicted protein [Physcomitrella patens]
 gb|EDQ74405.1| predicted protein, partial [Physcomitrella patens]
Length=166

 Score =   125 bits (315),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKY +CS SCFVV Y++L R   RQP L + S NVHRLL+ SV+V+ K +DD+ +N
Sbjct  58   LERIFKYTSCSPSCFVVGYVFLDRLIHRQPDLLVTSLNVHRLLVTSVMVATKMLDDVHFN  117

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NA++A+VGG+   E+N LE++FLF + F L+VT S F +YC+
Sbjct  118  NAFFARVGGVSVLELNRLELEFLFRLDFKLSVTISVFESYCT  159



>ref|XP_009804077.1| PREDICTED: cyclin-P3-1 [Nicotiana sylvestris]
Length=217

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 76/102 (75%), Gaps = 1/102 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKY+ CS SCFVVA IY+ RF        + S NVHRLLI SV+V+ KF+DD FYN
Sbjct  79   LDRIFKYSCCSPSCFVVAQIYMERFIEHTSA-HLTSLNVHRLLITSVMVAAKFIDDAFYN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAYYA+VGG+ TKE+N LE+ FLFG+ F L+V   TF +YCS
Sbjct  138  NAYYARVGGVTTKELNKLEMKFLFGLDFRLHVNVKTFGSYCS  179



>ref|XP_002973135.1| hypothetical protein SELMODRAFT_413599 [Selaginella moellendorffii]
 gb|EFJ25509.1| hypothetical protein SELMODRAFT_413599 [Selaginella moellendorffii]
Length=267

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 81/115 (70%), Gaps = 2/115 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIFKY NCS +CFVV Y+Y+ R S + P L I   NVHRLL+ SV+ + K +DD+ +N
Sbjct  119  LERIFKYTNCSPACFVVGYVYIDRLSHKHPDLPITPLNVHRLLVTSVMTASKILDDVHFN  178

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFI--AQIQAQRP  335
            NA++A+VGGI T E+N LE++FLF + F L VT   F +YCS+    A++ + RP
Sbjct  179  NAFFARVGGISTSEVNKLELEFLFRLDFRLTVTVQEFESYCSYLDREARLPSARP  233



>ref|XP_002520742.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF41704.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=219

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 83/117 (71%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCF+VA+IY+ RF +   +  + S NVHRLLI SV+V+ KF+DD F+N
Sbjct  79   IDRIFKYSGCSPSCFIVAHIYVDRFIQNTDI-HLTSLNVHRLLITSVMVAAKFIDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI----QAQRP  335
            NAYYAKVGG+ T+E+N LE+ FLF I F L V+ +TF  YCS    +     Q +RP
Sbjct  138  NAYYAKVGGVSTEELNKLEMKFLFSIDFRLQVSVNTFGRYCSQLEKEAAEGHQIERP  194



>gb|AAC32127.1| PREG-like protein [Picea mariana]
Length=284

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 86/134 (64%), Gaps = 6/134 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LER++KY +CS SCFVVAYIY+ R   RQP   + S N+HRLL+ S++++ K +DD  YN
Sbjct  114  LERVYKYTSCSPSCFVVAYIYIDRLVHRQPNFPVISLNIHRLLLTSLMIAAKMLDDAHYN  173

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI----QAQR--PH  332
            NA+YA+VGG+   E+N LEVDFLF + F L VT S F +YC H   ++      QR    
Sbjct  174  NAFYARVGGVSIAELNRLEVDFLFRLDFRLKVTASVFESYCLHLEKEMLCGASGQRIDRT  233

Query  331  YPGFLQQLGEVVSN  290
             PGF +    V S+
Sbjct  234  LPGFHRSTDVVSSD  247



>ref|XP_004290653.1| PREDICTED: cyclin-P3-1-like [Fragaria vesca subsp. vesca]
Length=214

 Score =   126 bits (317),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++R+FKY+ CS SCFVVA IY+ R+  +   + + SFNVHRLLI SV+++ KF+DD F+N
Sbjct  79   IDRVFKYSGCSPSCFVVAKIYVDRY-LQSTQVHLTSFNVHRLLITSVMLAAKFIDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF  362
            NAYYAKVGG+ T E+N LE+ FLF I F L V+  TF  YCSH 
Sbjct  138  NAYYAKVGGVSTAELNRLEMKFLFSIDFRLQVSIDTFKKYCSHL  181



>ref|XP_006444072.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 ref|XP_006479719.1| PREDICTED: cyclin-P3-1-like isoform X1 [Citrus sinensis]
 ref|XP_006479720.1| PREDICTED: cyclin-P3-1-like isoform X2 [Citrus sinensis]
 gb|ESR57312.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 gb|KDO68736.1| hypothetical protein CISIN_1g026467mg [Citrus sinensis]
 gb|KDO68737.1| hypothetical protein CISIN_1g026467mg [Citrus sinensis]
Length=217

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 80/117 (68%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY  CS SCFV+A+IY+ RF ++     + S NVHRLLI SV+V+ KF+DD F+N
Sbjct  78   IDRIFKYGACSPSCFVIAHIYMDRFLQKTDG-HLTSLNVHRLLITSVMVAAKFIDDAFFN  136

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYA+VGG+ T EMN +EV FLF + F L V   TFH +CS    +    +Q  RP
Sbjct  137  NAYYARVGGVSTAEMNRMEVKFLFSLDFRLQVNVETFHKFCSQLGKEAAEGLQIDRP  193



>ref|XP_011082555.1| PREDICTED: cyclin-P3-1 [Sesamum indicum]
 ref|XP_011082556.1| PREDICTED: cyclin-P3-1 [Sesamum indicum]
Length=211

 Score =   126 bits (316),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFV+A+IY+ RF +R  L  + S N+HRLLI SV+V+ KFMDD F+N
Sbjct  73   IDRIFKYSCCSPSCFVIAHIYVDRFIQRTNLC-LTSLNIHRLLITSVMVAAKFMDDAFFN  131

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAYYA+VGG+ T E+N LE+ FLF + F L+V+  TF  YCS
Sbjct  132  NAYYARVGGVSTAELNKLEMKFLFSLNFQLHVSVQTFRNYCS  173



>ref|XP_008812796.1| PREDICTED: cyclin-P3-1-like [Phoenix dactylifera]
Length=222

 Score =   126 bits (317),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+ CS SCFV+A+IY+++F  +QP + + S NVHRL+I SV+V+ KF+DD F+N
Sbjct  79   VERIFKYSKCSPSCFVLAHIYINKF-LQQPGIHLTSLNVHRLMITSVVVAAKFIDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NAYYAKVGGI T EMN LE++FLF + F L V   TF  YC
Sbjct  138  NAYYAKVGGISTVEMNRLELNFLFSLDFRLQVDLETFGKYC  178



>ref|XP_006444071.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 gb|ESR57311.1| hypothetical protein CICLE_v10021982mg [Citrus clementina]
 gb|KDO68735.1| hypothetical protein CISIN_1g026467mg [Citrus sinensis]
Length=238

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 80/117 (68%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY  CS SCFV+A+IY+ RF ++     + S NVHRLLI SV+V+ KF+DD F+N
Sbjct  99   IDRIFKYGACSPSCFVIAHIYMDRFLQKTDG-HLTSLNVHRLLITSVMVAAKFIDDAFFN  157

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYA+VGG+ T EMN +EV FLF + F L V   TFH +CS    +    +Q  RP
Sbjct  158  NAYYARVGGVSTAEMNRMEVKFLFSLDFRLQVNVETFHKFCSQLGKEAAEGLQIDRP  214



>gb|EYU46584.1| hypothetical protein MIMGU_mgv1a013898mg [Erythranthe guttata]
Length=207

 Score =   126 bits (316),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 82/113 (73%), Gaps = 2/113 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFV+A IY+ RF +R  L  +NS N+HRLLI SV+V+ KF+DD F+N
Sbjct  79   IDRIFKYSCCSPSCFVIANIYMDRFMQRTNL-SLNSLNIHRLLITSVMVAAKFIDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRP  335
            NAYYA+VGG+ T E+N LE+ FLF + F L+V+  TF  YC+  + Q  A  P
Sbjct  138  NAYYARVGGVSTAELNKLEMKFLFSLDFRLHVSVQTFRKYCA-LLKQEAAGGP  189



>ref|XP_010684268.1| PREDICTED: cyclin-P3-1-like [Beta vulgaris subsp. vulgaris]
Length=232

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ER++KYA CS SCFVVAYIY+ R+  +Q    + S NVHRLL+ SV+V+ KF+DD F+N
Sbjct  93   IERMYKYAGCSPSCFVVAYIYVDRY-LQQTKTYLTSLNVHRLLVTSVMVAAKFIDDSFFN  151

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYP  326
            NAYYAKVGGI T EMN LE+  LFG+ F L V   TF  YC     ++      +P
Sbjct  152  NAYYAKVGGINTSEMNRLEMKLLFGVDFRLQVNVETFRRYCLLLDKEVGGCELDWP  207



>ref|XP_007200546.1| hypothetical protein PRUPE_ppa011715mg [Prunus persica]
 gb|EMJ01745.1| hypothetical protein PRUPE_ppa011715mg [Prunus persica]
Length=199

 Score =   125 bits (314),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 81/115 (70%), Gaps = 4/115 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA IY+ RF +   + R+ SFN+HRLLI  V+++ KF+DD F+N
Sbjct  79   IDRIFKYSGCSPSCFVVAQIYVDRFIQCTEV-RLTSFNIHRLLITGVMLAAKFIDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF---IAQIQAQR  338
            NAYYAKVGG+ T E+N LE+ FLF I F L V+  TF  YCS      A +Q +R
Sbjct  138  NAYYAKVGGVSTSELNRLEMKFLFTIDFRLQVSIETFKRYCSQLEKEAAGLQIER  192



>ref|NP_001053459.1| Os04g0544200 [Oryza sativa Japonica Group]
 emb|CAE04344.1| OSJNBb0038F03.8 [Oryza sativa Japonica Group]
 dbj|BAF15373.1| Os04g0544200 [Oryza sativa Japonica Group]
 gb|EAY95036.1| hypothetical protein OsI_16850 [Oryza sativa Indica Group]
 gb|EAZ31513.1| hypothetical protein OsJ_15654 [Oryza sativa Japonica Group]
Length=212

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPL---LRINSFNVHRLLIASVLVSVKFMDDL  503
            + RI ++A CS +C+VVAYIYL R  RR+       ++S++VHRLLI +VL +VKFMDD+
Sbjct  62   MARIARFAGCSPACYVVAYIYLDRLLRRRRRACAFSVDSYSVHRLLITAVLAAVKFMDDI  121

Query  502  FYNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
             YNNAY+AKVGG+   EMN LEVDFLFG+GF+LNV+P TF  YC+
Sbjct  122  CYNNAYFAKVGGVSLPEMNYLEVDFLFGVGFDLNVSPETFGHYCA  166



>ref|XP_003554251.1| PREDICTED: cyclin-P3-1-like [Glycine max]
 gb|KHN10660.1| Cyclin-P3-1 [Glycine soja]
Length=246

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 81/117 (69%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ RF +   + ++ S NVHRLLI S++++ KF+DD FYN
Sbjct  107  IDRIFKYSGCSPSCFVVAHIYVDRFIQHTEI-KLTSLNVHRLLITSIMLAAKFIDDAFYN  165

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYAKVGG+ T E+N  E+ FLFGI F L V   TF  YC     +    +Q +RP
Sbjct  166  NAYYAKVGGVSTSELNRFEMSFLFGIDFRLQVGVETFGRYCRQLEKEAAEVVQIERP  222



>ref|XP_004956426.1| PREDICTED: cyclin-P4-1-like [Setaria italica]
Length=231

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 92/145 (63%), Gaps = 6/145 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLR----INSFNVHRLLIASVLVSVKFMDD  506
            + RI ++A CS +C+VVAY+YL R  RR    R    ++S++VHRLLI +VL +VKFMDD
Sbjct  70   MARIARFAGCSPACYVVAYVYLDRLLRRGRRGRGALAVDSYSVHRLLITAVLAAVKFMDD  129

Query  505  LFYNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQR--PH  332
            + YNNAY+A+VGGI   EMN LEVDFLF +GF+LNV+P TF  YC+   A++ +      
Sbjct  130  VRYNNAYFARVGGISLPEMNYLEVDFLFAVGFDLNVSPETFGHYCTVLQAEMLSLELGKT  189

Query  331  YPGFLQQLGEVVSNHHHQCCIEEDD  257
             P              H CC+ EDD
Sbjct  190  PPPTTMTTPAAAGPRLHSCCLSEDD  214



>ref|XP_004247165.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum]
 ref|XP_010326376.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum]
 ref|XP_010326378.1| PREDICTED: cyclin-P3-1 [Solanum lycopersicum]
Length=217

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RI+KY+ CS SCFVVA+IY+ RF        + S NVHRLLI SV+V+ KF+DD FYN
Sbjct  79   LDRIYKYSCCSPSCFVVAHIYMERFIECTSA-HLTSLNVHRLLITSVMVAAKFIDDAFYN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAYYA+VGG+ TKE+N LE+ FLFG+ F L+V   TF +YCS
Sbjct  138  NAYYARVGGVTTKELNKLEMKFLFGLDFQLHVNVPTFGSYCS  179



>ref|XP_008246475.1| PREDICTED: cyclin-P3-1 [Prunus mume]
Length=196

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY++CS SCFVVAYIY+ RF +R+ +  + S N+HRLLI S++V+ KFMDD  Y+
Sbjct  72   IERIFKYSSCSPSCFVVAYIYIERFLQRRGIC-LTSLNIHRLLITSIVVAAKFMDDECYS  130

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF  362
            NAYYAK+GG+   E+N LE++FL  + F L+VT  TF  YC   
Sbjct  131  NAYYAKIGGVSLSELNKLEIEFLLSLDFKLHVTIDTFGKYCRQL  174



>ref|XP_010277841.1| PREDICTED: cyclin-P3-1-like [Nelumbo nucifera]
 ref|XP_010277851.1| PREDICTED: cyclin-P3-1-like [Nelumbo nucifera]
Length=221

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 85/117 (73%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ C+ SCFVVAYIY+ RF  +Q  + + S NVHRLLI +V+++VKF++D++YN
Sbjct  79   IDRIFKYSGCTPSCFVVAYIYMDRF-LQQTDVYLTSLNVHRLLITAVMLAVKFVEDVYYN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC----SHFIAQIQAQRP  335
            NAYYA+VGGI   EMN +E+ FLF + F L+VT  TF +YC        A+ + +RP
Sbjct  138  NAYYARVGGITIAEMNRMEMKFLFSLEFRLHVTTETFKSYCLQLEKEAAAEYKIERP  194



>ref|XP_006349677.1| PREDICTED: cyclin-P3-1-like isoform X1 [Solanum tuberosum]
Length=223

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RI+KY+ CS SCFVVA+IY+ RF        + S NVHRLLI SV+V+ KF+DD FYN
Sbjct  85   LDRIYKYSCCSPSCFVVAHIYMERFIECTGA-HLTSLNVHRLLITSVMVAAKFIDDAFYN  143

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAYYA+VGG+ TKE+N LE+ FLFG+ F L+V   TF +YCS
Sbjct  144  NAYYARVGGVTTKELNKLEMKFLFGLDFQLHVNVQTFGSYCS  185



>ref|XP_006349678.1| PREDICTED: cyclin-P3-1-like isoform X2 [Solanum tuberosum]
Length=217

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RI+KY+ CS SCFVVA+IY+ RF        + S NVHRLLI SV+V+ KF+DD FYN
Sbjct  79   LDRIYKYSCCSPSCFVVAHIYMERFIECTGA-HLTSLNVHRLLITSVMVAAKFIDDAFYN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            NAYYA+VGG+ TKE+N LE+ FLFG+ F L+V   TF +YCS
Sbjct  138  NAYYARVGGVTTKELNKLEMKFLFGLDFQLHVNVQTFGSYCS  179



>ref|XP_008368850.1| PREDICTED: cyclin-P3-1-like [Malus domestica]
Length=219

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RI KY+ CS SCFVVA IYL R+ +   +  + SFNVHRLLI SV+++ KFMDD F+N
Sbjct  79   IDRICKYSGCSPSCFVVAQIYLDRYLQCXQV-HLTSFNVHRLLITSVMLAAKFMDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF  362
            NAYYAKVGG+ T E+N LE+ FLF I F L VT  TF+ YCS  
Sbjct  138  NAYYAKVGGVSTAELNRLEIKFLFTIDFRLQVTIETFNKYCSQL  181



>gb|KCW58844.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
Length=215

 Score =   124 bits (312),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+ CS SCFV+A IY+ RF +   +L + S NVHRLLI S+ V+ KF+DD F+N
Sbjct  77   IERIFKYSACSPSCFVIAQIYMDRFVQNTDVL-LTSLNVHRLLITSLTVAAKFVDDAFFN  135

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NAYYAKVGG+ T E+N LE+ FLF I F L+V+  TF  YC
Sbjct  136  NAYYAKVGGVSTSELNRLEMKFLFSIDFRLHVSIDTFQRYC  176



>ref|XP_003568501.1| PREDICTED: cyclin-P3-1 [Brachypodium distachyon]
 ref|XP_010231401.1| PREDICTED: cyclin-P3-1 [Brachypodium distachyon]
Length=235

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 78/113 (69%), Gaps = 1/113 (1%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYNN  491
            ERIFKYA+CS SCFV+A +Y+ R+  +QP + + SF+VHRLLI SV+V+ KF DD F+NN
Sbjct  81   ERIFKYADCSPSCFVLALVYIERY-LQQPHVYMTSFSVHRLLITSVVVAAKFTDDAFFNN  139

Query  490  AYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPH  332
            A+YA+VGGI T EMN LE+D LF + F L V   TF +YC     Q     P 
Sbjct  140  AFYARVGGISTIEMNRLELDLLFNLDFRLKVNLETFGSYCLQLEKQAATFAPE  192



>ref|XP_004230189.1| PREDICTED: cyclin-P3-1 isoform X1 [Solanum lycopersicum]
Length=226

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 81/117 (69%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+NCS SCFVVAYIYL RF      L + S NVHRLLI S++++VKF+DD  YN
Sbjct  81   IERIFKYSNCSPSCFVVAYIYLERFLNLTDCL-LTSLNVHRLLITSIMLAVKFVDDDCYN  139

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIA----QIQAQRP  335
            NAYYAKVGGI T+E+N LEV FL  + F L+V+  +F  YC         ++Q  RP
Sbjct  140  NAYYAKVGGITTRELNKLEVKFLAALDFRLHVSVESFDKYCLQLEKDSNEKLQIDRP  196



>ref|XP_002512374.1| cyclin-dependent protein kinase, putative [Ricinus communis]
 gb|EEF49826.1| cyclin-dependent protein kinase, putative [Ricinus communis]
Length=221

 Score =   124 bits (311),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 71/101 (70%), Gaps = 1/101 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ER+FKY  CS SCFVVAYIY+ RF RR     + S NVHRLLI S++++ KF+DD  YN
Sbjct  73   IERVFKYTKCSTSCFVVAYIYVERFLRRMDAC-LTSLNVHRLLITSIMLAAKFLDDECYN  131

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NAYYAKVGG+ T EMN +E   LF + F L VT   F +YC
Sbjct  132  NAYYAKVGGVSTPEMNRMETKLLFNLDFRLQVTVEAFRSYC  172



>ref|XP_010070213.1| PREDICTED: cyclin-P3-1 isoform X2 [Eucalyptus grandis]
 gb|KCW58845.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
Length=228

 Score =   124 bits (312),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+ CS SCFV+A IY+ RF +   +L + S NVHRLLI S+ V+ KF+DD F+N
Sbjct  90   IERIFKYSACSPSCFVIAQIYMDRFVQNTDVL-LTSLNVHRLLITSLTVAAKFVDDAFFN  148

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NAYYAKVGG+ T E+N LE+ FLF I F L+V+  TF  YC
Sbjct  149  NAYYAKVGGVSTSELNRLEMKFLFSIDFRLHVSIDTFQRYC  189



>gb|ACU23185.1| unknown [Glycine max]
Length=246

 Score =   125 bits (313),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 81/117 (69%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ RF +   + ++ S NVHRLLI S++++ KF+DD FYN
Sbjct  107  IDRIFKYSGCSPSCFVVAHIYVDRFIQHTEI-KLTSLNVHRLLITSIMLAAKFIDDAFYN  165

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYAKVGG+ T E+N  E+ FLFGI F L V   TF  YC     +    +Q +RP
Sbjct  166  NAYYAKVGGVSTFELNRFEMSFLFGIDFRLQVGVETFGRYCRQLEKEAAEVVQIERP  222



>ref|XP_009355462.1| PREDICTED: cyclin-P3-1-like [Pyrus x bretschneideri]
 ref|XP_009355466.1| PREDICTED: cyclin-P3-1-like [Pyrus x bretschneideri]
 ref|XP_009367646.1| PREDICTED: cyclin-P3-1-like [Pyrus x bretschneideri]
 ref|XP_009367663.1| PREDICTED: cyclin-P3-1-like [Pyrus x bretschneideri]
 ref|XP_009367681.1| PREDICTED: cyclin-P3-1-like [Pyrus x bretschneideri]
Length=219

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 80/115 (70%), Gaps = 4/115 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RI KY+ CS SCFVVA IY+ R+ +   +  + SFNVHRLLI SV+++ KFMDD F+N
Sbjct  79   IDRICKYSGCSPSCFVVAQIYVDRYLKCTEV-HLTSFNVHRLLITSVMLAAKFMDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF---IAQIQAQR  338
            NAYYAKVGG+ T E+N LE+ FLF I F L VT  TF  YCS      A +Q +R
Sbjct  138  NAYYAKVGGVSTAELNRLEMKFLFTIDFRLQVTLETFTKYCSQLEKEAAGVQIER  192



>gb|AFW72776.1| hypothetical protein ZEAMMB73_097402 [Zea mays]
Length=195

 Score =   123 bits (309),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 81/104 (78%), Gaps = 2/104 (2%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLL--RINSFNVHRLLIASVLVSVKFMDDLF  500
            + RI ++A CS +C+VVAY+YL R  RR  LL   ++S++VHRLLI +VL +VKFMDD+ 
Sbjct  66   MARIARFAGCSPACYVVAYVYLDRLLRRGRLLALAVDSYSVHRLLITAVLAAVKFMDDIC  125

Query  499  YNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCS  368
            YNNAY+AKVGGI   EMN LEVDFLFG+GF+LNV P TF  YC+
Sbjct  126  YNNAYFAKVGGISLVEMNYLEVDFLFGVGFDLNVAPETFGDYCA  169



>ref|XP_010070212.1| PREDICTED: cyclin-P3-1 isoform X1 [Eucalyptus grandis]
 gb|KCW58846.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
 gb|KCW58847.1| hypothetical protein EUGRSUZ_H01477 [Eucalyptus grandis]
Length=239

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+ CS SCFV+A IY+ RF +   +L + S NVHRLLI S+ V+ KF+DD F+N
Sbjct  101  IERIFKYSACSPSCFVIAQIYMDRFVQNTDVL-LTSLNVHRLLITSLTVAAKFVDDAFFN  159

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NAYYAKVGG+ T E+N LE+ FLF I F L+V+  TF  YC
Sbjct  160  NAYYAKVGGVSTSELNRLEMKFLFSIDFRLHVSIDTFQRYC  200



>ref|XP_002306774.1| cyclin family protein [Populus trichocarpa]
 gb|EEE93770.1| cyclin family protein [Populus trichocarpa]
Length=219

 Score =   124 bits (310),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ RF  +Q  + + + NVHRLLI SV+++ KF+DD F+N
Sbjct  79   VDRIFKYSACSPSCFVVAHIYMDRF-LQQTDIHLTALNVHRLLITSVMIAAKFVDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF----IAQIQAQRP  335
            NAYYAKVGG+ T+E+N LE+ FLF I F L V  +TF  +C       +  +Q +RP
Sbjct  138  NAYYAKVGGVSTEELNRLEMKFLFSIDFRLQVNVNTFGKHCYQLEKESVGGLQIERP  194



>gb|KDO56332.1| hypothetical protein CISIN_1g045984mg, partial [Citrus sinensis]
Length=127

 Score =   121 bits (303),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 76/115 (66%), Gaps = 1/115 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+ CS SC VVAYIYL RF +R     +   NVHRLLI S LV+ KF+DD  YN
Sbjct  3    IERIFKYSRCSPSCSVVAYIYLDRFLQRISGC-LTRLNVHRLLITSFLVAAKFVDDECYN  61

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHY  329
            NAYYAK+GGI T EMN LE++FLF + F L+VT   F  YCS    +  A    +
Sbjct  62   NAYYAKIGGISTAEMNKLELNFLFTLEFKLHVTTEVFAKYCSQLDMEGAAAEESW  116



>ref|XP_010552777.1| PREDICTED: cyclin-U3-1 [Tarenaya hassleriana]
Length=222

 Score =   124 bits (310),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRI--NSFNVHRLLIASVLVSVKFMDDLF  500
            L+RIFKY+ CS SCFVVA IY+ RF +   L R+   S NVHRLLI SV+++ K +DD +
Sbjct  79   LDRIFKYSGCSPSCFVVAQIYMDRFLQ---LARVHLTSLNVHRLLITSVMLAAKVLDDRY  135

Query  499  YNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQ  341
            +NNAYYA+VGG+ T+E+N LE+  LF + F L V P TFH YC     +   +
Sbjct  136  FNNAYYARVGGVSTRELNRLEMKLLFTLDFKLQVKPQTFHVYCCQLEKETSGE  188



>gb|EAZ24027.1| hypothetical protein OsJ_07758 [Oryza sativa Japonica Group]
Length=200

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 85/134 (63%), Gaps = 18/134 (13%)
 Frame = -2

Query  643  SHSCFVVAYIYLHRFSRRQPL-----LRINSFNVHRLLIASVLVSVKFMDDLFYNNAYYA  479
            + +C+VVAYIYL R  RR        L ++S++VHRLLI +VL +VKFMDD+ YNNAY+A
Sbjct  63   APACYVVAYIYLDRLLRRGRRCLALALAVDSYSVHRLLITAVLSAVKFMDDICYNNAYFA  122

Query  478  KVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQQLGEV  299
            KVGGI   EMN LEVDFLFG+GF+LNVTP TF  YC+   +++    P            
Sbjct  123  KVGGISLAEMNYLEVDFLFGVGFDLNVTPETFADYCAVLQSEMLCAAP------------  170

Query  298  VSNHHHQCCIEEDD  257
                 H CC+ EDD
Sbjct  171  -PTRLHYCCLSEDD  183



>gb|ABK92673.1| unknown [Populus trichocarpa]
Length=169

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ RF  +Q  + + + NVHRLLI SV+++ KF+DD F+N
Sbjct  29   VDRIFKYSACSPSCFVVAHIYMDRF-LQQTDIHLTALNVHRLLITSVMIAAKFVDDAFFN  87

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYAKVGG+ T+E+N LE+ FLF I F L V  +TF  +C     +    +Q +RP
Sbjct  88   NAYYAKVGGVSTEELNRLEMKFLFSIDFRLQVNVNTFGKHCYQLEKESAGGLQIERP  144



>dbj|BAD08008.1| PREG-like protein [Oryza sativa Japonica Group]
Length=253

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 82/126 (65%), Gaps = 16/126 (13%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLLR----------------INSFNVHRLLIA  539
            ERI++YA CS +CFVVA +YL R + R P                   ++S++VHRLLI 
Sbjct  71   ERIYRYAGCSPACFVVARVYLDRLAGRSPEEESSPSPSPPATAAAAVCVDSYSVHRLLIT  130

Query  538  SVLVSVKFMDDLFYNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFI  359
            SV+V+ KFMDD+ YNNAY+A+VGG+   EMN LE++ LF + F LNVTP+TF TYC+   
Sbjct  131  SVMVAAKFMDDIHYNNAYFARVGGVEVAEMNGLELELLFALRFRLNVTPATFATYCAALE  190

Query  358  AQIQAQ  341
             ++ A 
Sbjct  191  GEMAAD  196



>ref|XP_010938791.1| PREDICTED: cyclin-P3-1-like isoform X2 [Elaeis guineensis]
Length=232

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+ CS SCFV+A+IY+ +F  +Q  + + S NVHRLLI SV+V+ KF+DD F+N
Sbjct  79   VERIFKYSKCSPSCFVLAHIYIDKF-LQQSDIHLTSLNVHRLLITSVVVAAKFIDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NAYYAKVGGI T EMN LE++FLF + F L V   TF  YC
Sbjct  138  NAYYAKVGGISTVEMNRLELNFLFSLDFRLQVDLDTFGKYC  178



>ref|XP_011026170.1| PREDICTED: cyclin-P3-1 [Populus euphratica]
 ref|XP_011026172.1| PREDICTED: cyclin-P3-1 [Populus euphratica]
Length=219

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 83/117 (71%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA++Y+ RF  +Q  + + S NVHRLLI SV+++ KF+DD F+N
Sbjct  79   VDRIFKYSACSPSCFVVAHVYVDRF-LQQTDIHLTSRNVHRLLITSVMIAAKFVDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYA+VGG+  +E+N LE+ FLFGI F L V  +TF  YC     +    +Q +RP
Sbjct  138  NAYYARVGGVSKEELNRLEMKFLFGIDFRLQVNVNTFGKYCYRLDKESSDGLQIERP  194



>ref|XP_010468884.1| PREDICTED: cyclin-U3-1 [Camelina sativa]
Length=227

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIFKY+ CS SCFV+A+IY H F +R   L +N  NVHRLLI SV+++ K  DD ++N
Sbjct  85   LDRIFKYSCCSPSCFVIAHIYTHLFLQRTRSL-LNPLNVHRLLITSVMLAAKVFDDRYFN  143

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ  353
            NAYYA+VGG+ T+E+N LE+  LF + F L V P TFHT+C     Q
Sbjct  144  NAYYARVGGVSTRELNRLEMKLLFTLDFKLQVDPQTFHTHCCQLEKQ  190



>ref|XP_006402307.1| hypothetical protein EUTSA_v10006204mg [Eutrema salsugineum]
 gb|ESQ43760.1| hypothetical protein EUTSA_v10006204mg [Eutrema salsugineum]
Length=247

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            L+RIF Y+ CS SCFV+A+IY+H F +R   L +N  NVHRLLI +V+++ K  DD +YN
Sbjct  100  LDRIFNYSGCSPSCFVIAHIYIHLFLQRTRAL-LNPLNVHRLLITTVMLAAKVFDDRYYN  158

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ  353
            NAYYA+VGG+ T+E+N LE+  LF + F L V P TFHT+C     Q
Sbjct  159  NAYYARVGGVSTRELNRLEMKLLFTLDFKLQVDPPTFHTHCCQLEKQ  205



>ref|XP_010938790.1| PREDICTED: cyclin-P3-1-like isoform X1 [Elaeis guineensis]
Length=248

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 76/101 (75%), Gaps = 1/101 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+ CS SCFV+A+IY+ +F  +Q  + + S NVHRLLI SV+V+ KF+DD F+N
Sbjct  79   VERIFKYSKCSPSCFVLAHIYIDKF-LQQSDIHLTSLNVHRLLITSVVVAAKFIDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NAYYAKVGGI T EMN LE++FLF + F L V   TF  YC
Sbjct  138  NAYYAKVGGISTVEMNRLELNFLFSLDFRLQVDLDTFGKYC  178



>ref|XP_011032712.1| PREDICTED: cyclin-P3-1-like isoform X2 [Populus euphratica]
 ref|XP_011032713.1| PREDICTED: cyclin-P3-1-like isoform X2 [Populus euphratica]
 ref|XP_011032715.1| PREDICTED: cyclin-P3-1-like isoform X2 [Populus euphratica]
Length=219

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (71%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ RF  +Q  + + S NVHRLLI SV+++ KF+DD F+N
Sbjct  79   VDRIFKYSACSPSCFVVAHIYMDRF-LQQTDIHLTSRNVHRLLITSVMIAAKFVDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYAKVGG+ T+E+N LE+ FLF I F L V  +TF  +C     +    +Q +RP
Sbjct  138  NAYYAKVGGVSTEELNRLEMKFLFSIDFRLQVNVNTFGKHCYQLEKESAGGLQIERP  194



>ref|XP_004952051.1| PREDICTED: cyclin-P4-1-like [Setaria italica]
Length=264

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 83/125 (66%), Gaps = 18/125 (14%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLL------------------RINSFNVHRLL  545
            ERI++YA CS +CFVV+Y+YL R ++++ L+                   ++S++VHRLL
Sbjct  56   ERIYRYAGCSPACFVVSYVYLDRLAQQRTLVDGEGEEEEEEMAAAAVVGVVDSYSVHRLL  115

Query  544  IASVLVSVKFMDDLFYNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSH  365
            I +VLV+ KFMDD+ YNNAY+A+VGG+   EMN LE++ LF + F LNVTP TF  YC+ 
Sbjct  116  ITAVLVAAKFMDDMHYNNAYFARVGGVEVAEMNGLELELLFALRFRLNVTPDTFARYCAA  175

Query  364  FIAQI  350
              A +
Sbjct  176  LEAHM  180



>ref|XP_011032710.1| PREDICTED: cyclin-P3-1-like isoform X1 [Populus euphratica]
 ref|XP_011032711.1| PREDICTED: cyclin-P3-1-like isoform X1 [Populus euphratica]
Length=227

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 83/117 (71%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA+IY+ RF  +Q  + + S NVHRLLI SV+++ KF+DD F+N
Sbjct  87   VDRIFKYSACSPSCFVVAHIYMDRF-LQQTDIHLTSRNVHRLLITSVMIAAKFVDDAFFN  145

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYAKVGG+ T+E+N LE+ FLF I F L V  +TF  +C     +    +Q +RP
Sbjct  146  NAYYAKVGGVSTEELNRLEMKFLFSIDFRLQVNVNTFGKHCYQLEKESAGGLQIERP  202



>ref|XP_007147054.1| hypothetical protein PHAVU_006G092300g [Phaseolus vulgaris]
 gb|ESW19048.1| hypothetical protein PHAVU_006G092300g [Phaseolus vulgaris]
Length=179

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+NCS SCFV+A+IYL RF +++    + SFN HRLLI S++V+ KF+DD +Y+
Sbjct  73   MERIFKYSNCSTSCFVIAHIYLERFFQKKSGY-LTSFNAHRLLITSIMVAAKFLDDKYYS  131

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NAY+AKVGG+ T+EMN +E++FLF + F L VT   F   C
Sbjct  132  NAYFAKVGGVSTEEMNRMEIEFLFNLEFRLFVTTELFLKNC  172



>gb|ACG23927.1| nuc-1 negative regulatory protein preg [Zea mays]
Length=223

 Score =   122 bits (305),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 82/135 (61%), Gaps = 16/135 (12%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQ--------------PLLRINSFNVHRLLIASV  533
            ERI++YA CS +C+VVAY+YL R +R Q               ++ I+S+ VHRLLI SV
Sbjct  61   ERIYRYAGCSPACYVVAYVYLDRLARGQCDSGAGEDEDEDEAAVVGIDSYTVHRLLITSV  120

Query  532  LVSVKFMDDLFYNNAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ  353
            LV+ KFMDD  +NNAY+A+VGG+   EMN LE+  LF + F LNV P TF  YC+    +
Sbjct  121  LVAAKFMDDRHHNNAYFARVGGVEVAEMNALELRLLFALRFRLNVAPDTFARYCAAL--E  178

Query  352  IQAQRPHYPGFLQQL  308
                 P   G + Q+
Sbjct  179  CHVDTPDAGGPVPQM  193



>ref|XP_006368127.1| PREDICTED: cyclin-P3-1-like, partial [Solanum tuberosum]
Length=161

 Score =   120 bits (301),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 79/117 (68%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+NCS SCFVVAYIYL RF      L + S NVHRLLI S++++VKF+DD  YN
Sbjct  16   IERIFKYSNCSPSCFVVAYIYLERFLNLTHCL-LTSLNVHRLLITSIMLAVKFVDDDCYN  74

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIA----QIQAQRP  335
            NAYYAKVGGI T E+N LE+ FL  + F L+V+   F  YC         ++Q  RP
Sbjct  75   NAYYAKVGGITTTELNKLEMKFLAALDFRLHVSVENFDKYCLQLEKDTNEKLQIDRP  131



>ref|XP_008386497.1| PREDICTED: cyclin-P3-1-like [Malus domestica]
Length=219

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 79/115 (69%), Gaps = 4/115 (3%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RI KY+ CS SCFVVA IY+ R+ +   +  + SFNVHRLLI SV+++ KFMDD F+N
Sbjct  79   IDRICKYSGCSPSCFVVAQIYVDRYLKCTEV-HLTSFNVHRLLITSVMLAAKFMDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHF---IAQIQAQR  338
            NAYYAKVGG+ T E+N LE+ FLF I F L V   TF  YCS      A +Q +R
Sbjct  138  NAYYAKVGGVSTAELNRLEMKFLFTIDFRLQVNLETFTKYCSQLEKEAAGVQIER  192



>ref|XP_006386267.1| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
 ref|XP_006386268.1| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
 ref|XP_006386270.1| cyclin family protein [Populus trichocarpa]
 gb|ERP64064.1| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
 gb|ERP64065.1| hypothetical protein POPTR_0002s05370g [Populus trichocarpa]
 gb|ERP64067.1| cyclin family protein [Populus trichocarpa]
Length=219

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 82/117 (70%), Gaps = 5/117 (4%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            ++RIFKY+ CS SCFVVA++Y+ RF  +Q  + + S NVHRLLI SV+++ KF+DD F+N
Sbjct  79   VDRIFKYSACSPSCFVVAHVYVDRF-LQQTDIHLTSLNVHRLLITSVMIAAKFVDDAFFN  137

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQ----IQAQRP  335
            NAYYA+VGG+  +E+N LE+ FLF I F L V  +TF  YC     +    +Q +RP
Sbjct  138  NAYYARVGGVSKEELNRLEMKFLFSIDFRLQVNVNTFGKYCYRLEKESSDGLQIERP  194



>gb|KHG04231.1| Cyclin-U2-2 -like protein [Gossypium arboreum]
Length=225

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+Y     S +VVAY+Y+ RF +  P  RIN+ NVHRLLI  ++V+ K+++D+ Y 
Sbjct  82   LERIFRYTKAGPSVYVVAYVYMDRFRQANPGFRINARNVHRLLITIIMVASKYVEDMNYR  141

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI  350
            N+Y+A+VGG+ TKE+N LEV+FLF +GF L+V    F +YCSH   ++
Sbjct  142  NSYFARVGGLTTKELNKLEVEFLFMMGFKLHVNVRVFESYCSHLEREV  189



>gb|EMT04744.1| hypothetical protein F775_06753 [Aegilops tauschii]
Length=231

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 79/115 (69%), Gaps = 5/115 (4%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYNN  491
            ERIFKYA CS SCFV+A +Y+ R+  +QP + +  F+VHRLLI SV+V+ KF DD F+NN
Sbjct  82   ERIFKYAECSPSCFVLALVYMERY-LQQPNVYMTPFSVHRLLITSVVVAAKFTDDAFFNN  140

Query  490  AYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYP  326
            A+YA+VGGI T EMN LE+D LF + F L V   TF +YC     Q++   P  P
Sbjct  141  AFYARVGGIRTIEMNRLELDLLFNLDFRLKVNLETFGSYC----LQLEKHAPVSP  191



>gb|KDP23522.1| hypothetical protein JCGZ_23355 [Jatropha curcas]
Length=218

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 79/120 (66%), Gaps = 7/120 (6%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ER+FKY+ CS SCFVV+YIY+ RF  R  +  + S NVHRLLI S++V+ KF+DD  YN
Sbjct  70   IERVFKYSRCSTSCFVVSYIYIERFLHRMDV-SLTSLNVHRLLITSIMVAAKFLDDECYN  128

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQRPHYPGFLQ  314
            NAYYAKVGG+ T EMN +E+  LF + F L VT   F  YC      ++ +R     FLQ
Sbjct  129  NAYYAKVGGVSTAEMNRMEMKLLFNLDFRLQVTVEGFKNYC------LKLEREGGGEFLQ  182



>sp|Q75HV0.1|CCP31_ORYSJ RecName: Full=Cyclin-P3-1; Short=CycP3;1 [Oryza sativa Japonica 
Group]
 gb|AAT07648.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU10797.1| unknown protein [Oryza sativa Japonica Group]
Length=236

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYNN  491
            ERIFKY+ CS SCFV+A IY+ R+  +QP + + S +VHRLLI SV+V+ KF DD F+NN
Sbjct  84   ERIFKYSECSPSCFVLALIYMERY-LQQPHVYMTSLSVHRLLITSVVVAAKFTDDAFFNN  142

Query  490  AYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            A+YA+VGGI T EMN LE+D LF + F L V   TF +YC
Sbjct  143  AFYARVGGISTVEMNRLELDLLFNLDFRLKVDLETFGSYC  182



>gb|EEC79180.1| hypothetical protein OsI_19875 [Oryza sativa Indica Group]
Length=234

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYNN  491
            ERIFKY+ CS SCFV+A IY+ R+  +QP + + S +VHRLLI SV+V+ KF DD F+NN
Sbjct  82   ERIFKYSECSPSCFVLALIYMERY-LQQPHVYMTSLSVHRLLITSVVVAAKFTDDAFFNN  140

Query  490  AYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            A+YA+VGGI T EMN LE+D LF + F L V   TF +YC
Sbjct  141  AFYARVGGISTVEMNRLELDLLFNLDFRLKVDLETFGSYC  180



>gb|EEE63644.1| hypothetical protein OsJ_18461 [Oryza sativa Japonica Group]
Length=234

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = -2

Query  670  ERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYNN  491
            ERIFKY+ CS SCFV+A IY+ R+  +QP + + S +VHRLLI SV+V+ KF DD F+NN
Sbjct  82   ERIFKYSECSPSCFVLALIYMERY-LQQPHVYMTSLSVHRLLITSVVVAAKFTDDAFFNN  140

Query  490  AYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            A+YA+VGGI T EMN LE+D LF + F L V   TF +YC
Sbjct  141  AFYARVGGISTVEMNRLELDLLFNLDFRLKVDLETFGSYC  180



>ref|XP_010091558.1| hypothetical protein L484_000801 [Morus notabilis]
 gb|EXC36981.1| hypothetical protein L484_000801 [Morus notabilis]
Length=199

 Score =   120 bits (302),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERIFKY+NCS SC+V AYIY+ RF +++    + S  VHRLLI SV+++ KF+DD   +
Sbjct  83   VERIFKYSNCSTSCYVFAYIYIERFLQKRASFYLTSLTVHRLLITSVMLAAKFLDDATES  142

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQIQAQ  341
            NAYYA+VGG+ T+EMN LE+ FLF + F+L VT   F  YC +   ++  +
Sbjct  143  NAYYAEVGGVSTEEMNELEMAFLFSLEFSLLVTAEDFAHYCQYLEVKVAGE  193



>emb|CBI36766.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   120 bits (301),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            +ERI KYANCS SC+VVA++Y++R+ +R  + R+ S NVHRLLI +V+++ KFMDD+FY+
Sbjct  60   MERIDKYANCSPSCYVVAFLYINRYLKRVGV-RLTSLNVHRLLITAVMLAAKFMDDMFYD  118

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYC  371
            NA+YA +GG+  KEMN LEV  LF + F L+VT  TF   C
Sbjct  119  NAFYAVIGGLSIKEMNSLEVKLLFDMDFRLHVTVETFRRCC  159



>ref|XP_010258918.1| PREDICTED: cyclin-U2-1 [Nelumbo nucifera]
Length=232

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = -2

Query  673  LERIFKYANCSHSCFVVAYIYLHRFSRRQPLLRINSFNVHRLLIASVLVSVKFMDDLFYN  494
            LERIF+Y   +   +VVAY+Y+ R  + QP  RI S NV+RLLI +++V+ KF++D+ Y 
Sbjct  82   LERIFRYTRVASPVYVVAYVYIDRLCQIQPEFRITSSNVYRLLITTIMVASKFVEDMNYR  141

Query  493  NAYYAKVGGIGTKEMNILEVDFLFGIGFNLNVTPSTFHTYCSHFIAQI  350
            N+Y+AKVGG+ TKEMN LEVDFLF +GF L+V  S F +YC H   ++
Sbjct  142  NSYFAKVGGLTTKEMNKLEVDFLFLMGFRLHVNVSVFESYCCHLEREV  189



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1009851894054