BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1021_g2_i1 len=524 path=[636:0-523]

Length=524
                                                                      Score     E

ref|XP_010432340.1|  PREDICTED: aquaporin PIP2-7                        120   1e-29   
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   120   2e-29   
dbj|BAA22098.1|  unnamed protein product                                117   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   119   3e-29   
gb|AAL49751.1|AF452013_1  aquaporin-like protein                        118   4e-29   Petunia x hybrida [garden petunia]
ref|XP_006284279.1|  hypothetical protein CARUB_v10005443mg             118   6e-29   
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   118   6e-29   
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             118   7e-29   
gb|KDO68093.1|  hypothetical protein CISIN_1g023370mg                   117   7e-29   
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   117   1e-28   
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   117   1e-28   
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               117   1e-28   
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                  117   1e-28   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 117   1e-28   
gb|AAB65787.1|  plasma membrane intrinsic protein                       117   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   117   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AAW80918.1|  putative plasma membrane intrinsic protein              117   1e-28   Astragalus penduliflorus
gb|ACB42441.1|  aquaporin PIP2;4                                        117   2e-28   Gossypium hirsutum [American cotton]
ref|XP_010489282.1|  PREDICTED: probable aquaporin PIP2-8               117   2e-28   
ref|XP_002869108.1|  hypothetical protein ARALYDRAFT_491143             117   2e-28   
gb|KHG29841.1|  putative aquaporin PIP2-2                               117   2e-28   
gb|ABB88840.1|  aquaporin                                               117   2e-28   Stevia rebaudiana
emb|CBI37861.3|  unnamed protein product                                115   2e-28   
dbj|BAF63508.1|  plasma membrane intrinsic protein                      117   3e-28   Potamogeton distinctus
gb|KHG00060.1|  putative aquaporin PIP2-2                               117   3e-28   
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             116   3e-28   
gb|AIA83106.1|  putative aquaporin PIP2                                 117   3e-28   
ref|XP_009803627.1|  PREDICTED: aquaporin PIP2-7-like                   116   3e-28   
dbj|BAG68661.1|  plasma membrane intrinsic protein                      116   4e-28   Tulipa gesneriana
gb|AIA83104.1|  putative aquaporin PIP2                                 116   4e-28   
tpg|DAA33864.1|  TPA: aquaporin PIP2;4                                  116   4e-28   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             116   5e-28   
gb|ACU87555.1|  PIP protein                                             116   5e-28   
ref|NP_179277.1|  putative aquaporin PIP2-8                             116   5e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               116   5e-28   
gb|ABO69705.2|  aquaporin PIP2                                          116   5e-28   Prunus humilis
ref|NP_001280185.1|  aquaporin PIP2-2                                   116   5e-28   
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8               116   5e-28   
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               116   5e-28   
emb|CDX72515.1|  BnaC07g45370D                                          115   6e-28   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   115   6e-28   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               115   6e-28   
gb|ACU87558.1|  PIP protein                                             115   6e-28   
gb|ACX37448.1|  plasma membrane intrinsic protein                       110   6e-28   Hevea brasiliensis [jebe]
gb|ACB42440.1|  aquaporin PIP2;3                                        115   6e-28   Gossypium hirsutum [American cotton]
ref|XP_002884019.1|  PIP2_8/PIP3B                                       115   7e-28   
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               115   7e-28   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6               115   8e-28   
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    115   8e-28   
gb|EMT32724.1|  Aquaporin PIP2-1                                        112   8e-28   
emb|CDX69112.1|  BnaC01g03410D                                          115   8e-28   
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               115   8e-28   
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         115   8e-28   
gb|AAG30607.1|AF314656_1  aquaporin                                     115   9e-28   Brassica oleracea
gb|ACB87734.1|  aquaporin                                               115   1e-27   Manihot esculenta [manioc]
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        115   1e-27   
gb|KFK36762.1|  hypothetical protein AALP_AA4G166800                    115   1e-27   
ref|XP_009803290.1|  PREDICTED: probable aquaporin PIP2-4               111   1e-27   
gb|ACU17538.1|  unknown                                                 109   1e-27   Glycine max [soybeans]
ref|NP_001274381.1|  aquaporin PIP2-7-like                              115   1e-27   
ref|NP_001267957.1|  aquaporin PIP2;2                                   115   1e-27   
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          115   1e-27   
gb|ABH09327.1|  putative aquaporin                                      115   1e-27   Vitis vinifera
emb|CDP04351.1|  unnamed protein product                                113   1e-27   
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        115   1e-27   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     115   1e-27   Vitis cinerea var. helleri x Vitis rupestris
gb|AEQ29857.1|  aquaporin PIP2                                          115   1e-27   
ref|XP_009782764.1|  PREDICTED: aquaporin PIP2-7                        115   1e-27   
gb|AEY75244.1|  plasma membrane intrinsic protein                       115   1e-27   
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        115   1e-27   
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               115   1e-27   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        115   1e-27   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        115   1e-27   
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             115   1e-27   
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               115   1e-27   
gb|AEY75242.1|  plasma membrane intrinsic protein                       115   1e-27   
gb|ACR56613.1|  plasma intrinsic protein 2;3                            115   1e-27   Juglans regia
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  115   1e-27   Pyrus communis
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg             115   1e-27   
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         115   2e-27   
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             115   2e-27   
gb|ACE60220.1|  plasma membrane aquaporin                               114   2e-27   Rosa hybrid cultivar
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         114   2e-27   Ricinus communis
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         114   2e-27   Ricinus communis
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               114   2e-27   
dbj|BAF32042.1|  putative aquaporin                                     114   2e-27   Cryptomeria japonica
ref|XP_009615212.1|  PREDICTED: aquaporin PIP2-7                        114   2e-27   
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               114   2e-27   
ref|NP_001275065.1|  major intrinsic protein 2                          114   2e-27   
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               114   2e-27   
gb|AAL49750.1|AF452012_1  aquaporin-like protein                        114   2e-27   Petunia x hybrida [garden petunia]
gb|ABM54183.1|  aquaporin                                               114   2e-27   Jatropha curcas
dbj|BAF32141.1|  putative aquaporin                                     114   2e-27   Taxodium distichum [bald cypress]
emb|CAB46351.1|  major intrinsic protein 2                              114   2e-27   Solanum tuberosum [potatoes]
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                        114   2e-27   
gb|EMS52371.1|  Aquaporin PIP2-1                                        114   2e-27   
gb|ACU87556.1|  PIP protein                                             114   2e-27   
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   114   2e-27   
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 114   2e-27   
emb|CDQ12456.1|  plasma membrane intrinsic protein 2;1                  112   2e-27   
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    114   3e-27   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                114   3e-27   
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              114   3e-27   
gb|ABB13430.2|  plasma membrane intrinsic protein                       114   3e-27   Olea europaea
gb|ADL16407.1|  aquaporin                                               114   3e-27   
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               114   3e-27   
gb|AEF32110.1|  aquaporin PIP2                                          114   3e-27   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     114   3e-27   
ref|XP_009600501.1|  PREDICTED: aquaporin PIP2-7-like                   114   3e-27   
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   114   3e-27   
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             114   3e-27   
gb|ABL76066.1|  aquaporin 2                                             114   4e-27   Bruguiera gymnorhiza [Burma mangrove]
gb|AAL33586.1|AF440272_1  aquaporin                                     114   4e-27   Nicotiana tabacum [American tobacco]
ref|XP_010107654.1|  Aquaporin PIP2-7                                   114   4e-27   
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         114   4e-27   Ricinus communis
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   114   4e-27   
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               114   4e-27   
gb|AFO63679.1|  plasma intrinsic protein 2                              114   4e-27   
ref|XP_009400343.1|  PREDICTED: probable aquaporin PIP2-6               114   4e-27   
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         113   4e-27   Ricinus communis
emb|CDX88767.1|  BnaA03g08820D                                          113   4e-27   
gb|EAY92738.1|  hypothetical protein OsI_14490                          110   4e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             114   4e-27   
emb|CBI16313.3|  unnamed protein product                                111   4e-27   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        113   5e-27   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               113   5e-27   
emb|CDY31523.1|  BnaA10g13480D                                          113   5e-27   
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               113   5e-27   
emb|CDX76314.1|  BnaA08g10860D                                          113   5e-27   
emb|CDY17511.1|  BnaC03g65520D                                          113   5e-27   
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                113   5e-27   
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               113   5e-27   
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  113   5e-27   Pyrus communis
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     114   5e-27   
dbj|BAD90701.1|  plasma membrane intrinsic protein 2;5                  113   6e-27   Mimosa pudica [sensitive-plant]
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               113   6e-27   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        113   6e-27   
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             113   6e-27   
gb|ACB71281.1|  plasma membrane intrinsic protein                       113   6e-27   Tamarix hispida
gb|ACU87557.1|  PIP protein                                             113   6e-27   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   113   6e-27   Allium cepa
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   113   6e-27   
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   113   6e-27   
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     113   7e-27   
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               113   7e-27   
ref|XP_002306187.1|  membrane intrinsic family protein                  113   7e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   113   8e-27   
ref|XP_007200557.1|  hypothetical protein PRUPE_ppa009691mg             113   8e-27   
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               113   8e-27   
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   113   8e-27   
ref|XP_011089904.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    112   8e-27   
sp|P42767.1|PIP1_ATRCA  RecName: Full=Aquaporin PIP-type                113   8e-27   Atriplex canescens [shadscale]
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               112   8e-27   
gb|AAF61463.1|AF139814_1  plasma membrane intrinsic protein 1           113   9e-27   Triticum aestivum [Canadian hard winter wheat]
dbj|BAG06231.1|  plasma membrane intrinsic protein                      113   9e-27   Hordeum vulgare [barley]
ref|XP_007046620.1|  Plasma membrane intrinsic protein 3 isoform 1      112   9e-27   
emb|CAH60721.1|  putative plasma membrane intrinsic protein             112   9e-27   Populus tremula x Populus tremuloides
ref|XP_008382110.1|  PREDICTED: probable aquaporin PIP2-8               112   9e-27   
ref|XP_006495474.1|  PREDICTED: aquaporin PIP2-2-like                   107   9e-27   
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  112   9e-27   
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             112   1e-26   
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   112   1e-26   
emb|CAH60724.1|  putative plasma membrane intrinsic protein             112   1e-26   Populus tremula x Populus tremuloides
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  112   1e-26   
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                112   1e-26   Populus trichocarpa x Populus deltoides
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   112   1e-26   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    112   1e-26   
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2-like                   112   1e-26   
gb|ABC70536.1|  aquaporin protein                                       109   1e-26   Vitis pseudoreticulata
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                112   1e-26   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               112   1e-26   
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   112   1e-26   
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               112   1e-26   
emb|CDX71032.1|  BnaC03g11160D                                          112   1e-26   
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        112   1e-26   
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               112   1e-26   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7-like                   112   2e-26   
gb|ACX37450.1|  plasma membrane intrinsic protein                       112   2e-26   Hevea brasiliensis [jebe]
gb|KHN38765.1|  Aquaporin PIP2-7                                        112   2e-26   
gb|AHG32323.1|  PIP2-2                                                  112   2e-26   
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                112   2e-26   
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                112   2e-26   
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         112   2e-26   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        112   2e-26   Solanum chacoense
gb|AEY75254.1|  aquaporin                                               112   2e-26   
ref|XP_010098191.1|  Aquaporin PIP2-7                                   112   2e-26   
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             112   2e-26   
gb|AGD98708.1|  aquaporin protein 5                                     112   2e-26   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                   112   2e-26   
ref|XP_008447947.1|  PREDICTED: aquaporin PIP2-7                        112   2e-26   
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                   112   2e-26   
gb|ACV66986.1|  plasma membrane aquaporin 2                             112   2e-26   Hevea brasiliensis [jebe]
ref|NP_001274376.1|  aquaporin PIP2-7-like                              112   2e-26   
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    112   2e-26   
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8               111   2e-26   
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             112   2e-26   
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          112   2e-26   
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   111   2e-26   
gb|AFQ23186.1|  aquaporin PIP2;1                                        111   2e-26   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  112   2e-26   
ref|NP_001268056.1|  aquaporin PIP2                                     111   2e-26   
ref|XP_003591907.1|  Aquaporin PIP                                      110   2e-26   
emb|CAA04654.1|  major intrinsic protein PIPC                           109   2e-26   Craterostigma plantagineum
gb|AFH36336.1|  aquaporin PIP2;1                                        111   2e-26   
gb|ACU21481.1|  unknown                                                 111   2e-26   Glycine max [soybeans]
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   111   2e-26   
ref|NP_001237286.1|  PIP2,2                                             111   2e-26   
gb|AIG92831.1|  aquaporin PIP2                                          111   2e-26   
gb|AHB33479.1|  plasma intrinsic protein 2-3                            111   3e-26   
gb|ACR56614.1|  plasma intrinsic protein 2;4                            111   3e-26   Juglans regia
ref|NP_001105639.1|  aquaporin PIP2-7                                   111   3e-26   Zea mays [maize]
ref|XP_003522619.2|  PREDICTED: aquaporin PIP2-7                        112   3e-26   
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             111   3e-26   
emb|CBI31462.3|  unnamed protein product                                109   3e-26   
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             111   3e-26   
gb|ABE68718.1|  putative aquaporin                                      106   3e-26   Arachis hypogaea [goober]
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8               111   3e-26   
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                         111   3e-26   
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   111   3e-26   
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   111   3e-26   
gb|AHA84284.1|  prolactin-inducible protein                             111   3e-26   
ref|XP_003625627.1|  Aquaporin PIP2-1                                   111   3e-26   
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             111   3e-26   
ref|NP_001233846.1|  putative PIP-type aquaporin                        111   3e-26   
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             111   3e-26   
emb|CAC82712.1|  major intrinsic protein 1                              111   3e-26   Populus tremula x Populus tremuloides
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                   111   3e-26   
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                111   3e-26   
ref|NP_001234625.1|  aquaporin                                          111   3e-26   
gb|AGD98714.1|  aquaporin protein 11                                    111   3e-26   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  111   3e-26   Mimosa pudica [sensitive-plant]
ref|XP_010107541.1|  Aquaporin PIP2-2                                   111   3e-26   
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             111   3e-26   
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               111   3e-26   
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   111   4e-26   
ref|XP_007137341.1|  hypothetical protein PHAVU_009G118900g             111   4e-26   
ref|XP_010690355.1|  PREDICTED: aquaporin PIP-type                      111   4e-26   
gb|AFK33316.1|  unknown                                                 111   4e-26   
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        111   4e-26   
gb|AAB67869.1|  plasma membrane major intrinsic protein 2               111   4e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN05685.1|  Aquaporin PIP2-7                                        111   4e-26   
gb|ACR56615.1|  plasma intrinsic protein 2;5                            110   4e-26   Juglans regia
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  111   4e-26   Mimosa pudica [sensitive-plant]
gb|KHG19287.1|  Aquaporin PIP2-7 -like protein                          110   4e-26   
ref|NP_001052292.1|  Os04g0233400                                       110   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001240223.1|  prolactin-inducible protein                        110   5e-26   
pdb|1Z98|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    110   5e-26   
ref|XP_003597235.1|  Aquaporin PIP2-7                                   110   5e-26   
gb|ABU94631.1|  putative aquaporin PIP2;3                               110   5e-26   Phaseolus vulgaris [French bean]
gb|ACM50914.1|  aquaporin                                               110   5e-26   Medicago falcata [sickle alfalfa]
ref|XP_006664813.1|  PREDICTED: probable aquaporin PIP2-6-like          110   5e-26   
pdb|2B5F|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    111   5e-26   
gb|ABC69040.1|  aquaporin PIP2-1                                        110   5e-26   Rhododendron catawbiense [Catawba rosebay]
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          110   5e-26   
gb|AEQ20672.1|  PIP2;1                                                  110   5e-26   
ref|XP_006664814.1|  PREDICTED: probable aquaporin PIP2-6-like          110   5e-26   
pdb|3CLL|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    111   5e-26   
gb|AAL32127.1|  aquaporin                                               110   6e-26   Medicago truncatula
ref|XP_004307390.1|  PREDICTED: probable aquaporin PIP2-5-like          110   6e-26   
gb|ADJ67992.1|  aquaporin                                               110   6e-26   
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               110   6e-26   
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               110   7e-26   
gb|AFN53630.1|  putative aquaporin PIP2-8                               114   7e-26   
ref|XP_010933360.1|  PREDICTED: probable aquaporin PIP2-6               110   7e-26   
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             110   7e-26   
emb|CAB61749.1|  putative water channel protein                         109   7e-26   Cicer arietinum [garbanzo]
ref|XP_003606383.1|  Aquaporin PIP2-7                                   110   7e-26   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   110   8e-26   
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   110   8e-26   
gb|AFK47442.1|  unknown                                                 110   8e-26   
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          110   9e-26   Sorghum bicolor [broomcorn]
gb|EYU37965.1|  hypothetical protein MIMGU_mgv1a011471mg                110   9e-26   
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   109   9e-26   
gb|AIK66515.1|  putative aquaporin                                      110   1e-25   
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        110   1e-25   
dbj|BAD94576.1|  plasma membrane intrinsic protein 2a                   104   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322877.1|  major intrinsic protein 1                          110   1e-25   Populus trichocarpa [western balsam poplar]
ref|NP_001289823.1|  aquaporin PIP2-1-like                              110   1e-25   
ref|XP_003591905.1|  Aquaporin PIP                                      110   1e-25   
gb|AFQ23181.1|  aquaporin PIP2;2                                        110   1e-25   
gb|KHG08488.1|  putative aquaporin PIP2-2                               110   1e-25   
gb|AAW55294.1|  aquaporin 2                                             108   1e-25   
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     110   1e-25   
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                110   1e-25   
ref|XP_010028741.1|  PREDICTED: uncharacterized protein LOC104418957    113   1e-25   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               109   1e-25   
gb|AFN53685.1|  putative aquaporin PIP2-8                               113   1e-25   
gb|AAO39008.1|  plasma intrinsic protein 2,2                            109   1e-25   
gb|AFH36337.1|  aquaporin PIP2;2                                        109   1e-25   
ref|XP_003604054.1|  Aquaporin PIP22                                    109   1e-25   
gb|ADK25057.1|  plasma membrane intrinsic protein                       109   1e-25   
gb|EMT02787.1|  Putative aquaporin PIP2-6                               107   1e-25   
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             109   1e-25   
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             109   1e-25   
ref|NP_001267922.1|  aquaporin-like                                     109   1e-25   
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    109   2e-25   
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    109   2e-25   
gb|ABH09326.1|  putative aquaporin                                      109   2e-25   
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               109   2e-25   
pdb|3CN5|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    109   2e-25   
gb|AAV69744.1|  aquaporin                                               109   2e-25   
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               109   2e-25   
pdb|3CN6|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    109   2e-25   
emb|CAN75442.1|  hypothetical protein VITISV_019657                     109   2e-25   
ref|XP_011088776.1|  PREDICTED: uncharacterized protein LOC105169921    113   2e-25   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     109   2e-25   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               109   2e-25   
gb|EPS67791.1|  hypothetical protein M569_06982                         107   2e-25   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             109   2e-25   
ref|XP_009108681.1|  PREDICTED: aquaporin PIP2-7-like                   109   2e-25   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        109   2e-25   
emb|CDX79719.1|  BnaC03g20550D                                          103   2e-25   
gb|KHN32779.1|  Aquaporin PIP2-2                                        108   2e-25   
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         109   2e-25   
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   109   2e-25   
gb|ABU94630.1|  putative aquaporin PIP2;2                               109   2e-25   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   109   2e-25   
emb|CAL07977.1|  aquaporin                                              103   2e-25   
emb|CDY09192.1|  BnaA02g06180D                                          108   3e-25   
gb|AAD31846.1|AF133530_1  water channel protein MipH                    108   3e-25   
gb|AAB18227.1|  MipC                                                    108   3e-25   
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             108   3e-25   
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        108   3e-25   
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   108   3e-25   
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein     108   3e-25   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               108   3e-25   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          108   4e-25   
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   108   4e-25   
ref|NP_001105024.1|  aquaporin PIP2-1                                   108   4e-25   
gb|AAO86707.1|  aquaporin                                               108   4e-25   
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   108   4e-25   
gb|ACG32567.1|  aquaporin PIP2.1                                        108   4e-25   
ref|XP_002971714.1|  hypothetical protein SELMODRAFT_441556             108   4e-25   
ref|XP_007046621.1|  Plasma membrane intrinsic protein 3 isoform 2      108   4e-25   
ref|XP_002862904.1|  predicted protein                                  103   4e-25   
gb|AFB82643.1|  aquaporin                                               108   4e-25   
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               108   5e-25   
emb|CAH60720.1|  putative plasma membrane intrinsic protein             108   5e-25   
gb|AAA68701.1|  similar to mipB gene product in Mesembryanthemum ...    107   5e-25   
ref|NP_200874.1|  putative aquaporin PIP2-4                             108   5e-25   
ref|XP_011045923.1|  PREDICTED: probable aquaporin PIP2-8               108   5e-25   
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              108   5e-25   
ref|XP_002312952.1|  hypothetical protein POPTR_0009s13890g             108   5e-25   
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         108   5e-25   
gb|ACZ06859.1|  plasma membrane intrinsic protein                       108   5e-25   
gb|ACU24483.1|  unknown                                                 108   5e-25   
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6                108   5e-25   
ref|XP_002991582.1|  hypothetical protein SELMODRAFT_448485             108   5e-25   
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   108   5e-25   
gb|ACJ85173.1|  unknown                                                 108   5e-25   
gb|ACU19125.1|  unknown                                                 108   5e-25   
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   108   5e-25   
gb|ACG39551.1|  aquaporin PIP2.1                                        108   6e-25   
ref|NP_001289846.1|  probable aquaporin PIP2-1                          108   6e-25   
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          108   6e-25   
gb|ABX83874.1|  plasma membrane intrinsic protein                       107   6e-25   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               107   6e-25   
emb|CDY70391.1|  BnaC03g72010D                                          105   6e-25   
gb|ABI96815.1|  plasma membrane intrinsic protein                       107   6e-25   
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        107   7e-25   
dbj|BAG06230.1|  plasma membrane intrinsic protein                      107   7e-25   
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   107   7e-25   
gb|AAB18228.1|  MipE                                                    107   7e-25   
ref|NP_001105638.1|  aquaporin PIP2-2                                   107   7e-25   
gb|ACF79873.1|  unknown                                                 107   7e-25   
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        107   8e-25   
gb|AFK47400.1|  unknown                                                 107   8e-25   
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   107   8e-25   
ref|XP_010100853.1|  Aquaporin PIP2-1                                   107   8e-25   
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   107   8e-25   
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   107   9e-25   
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    107   9e-25   
gb|KFK36804.1|  hypothetical protein AALP_AA4G173500                    107   9e-25   
gb|AAO39007.1|  plasma intrinsic protein 2,1                            107   1e-24   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        107   1e-24   
gb|AAY22203.1|  putative aquaporin                                      107   1e-24   
gb|ABK60196.1|  PIP2 protein                                            107   1e-24   
gb|ACU20229.1|  unknown                                                 107   1e-24   
ref|XP_010553324.1|  PREDICTED: aquaporin PIP2-2                        105   1e-24   
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        107   1e-24   
gb|AAU43629.1|  putative aquaporin PIP-type                             104   1e-24   
ref|NP_001274308.1|  aquaporin PIP2-1-like                              107   1e-24   
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                107   2e-24   
ref|NP_001105025.1|  aquaporin PIP2-3                                   107   2e-24   
gb|ACG33001.1|  aquaporin PIP2.2                                        107   2e-24   
gb|AGD98705.1|  aquaporin                                               106   2e-24   
ref|NP_001105026.1|  aquaporin PIP2-4                                   107   2e-24   
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               106   2e-24   
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5               106   2e-24   
emb|CDY14415.1|  BnaC03g21800D                                          106   2e-24   
ref|NP_001240039.1|  uncharacterized protein LOC100782155               106   2e-24   
ref|NP_001288933.1|  probable aquaporin PIP2-6                          106   2e-24   
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        106   2e-24   
gb|KHN00691.1|  Aquaporin PIP2-2                                        106   2e-24   
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   106   2e-24   
ref|NP_190910.1|  aquaporin PIP2-1                                      106   2e-24   
ref|NP_181254.1|  aquaporin PIP2-2                                      106   2e-24   
ref|NP_001235204.1|  Pip1 protein                                       106   2e-24   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               106   2e-24   
ref|XP_002876271.1|  PIP2_5/PIP2D                                       106   2e-24   
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    106   2e-24   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               106   2e-24   
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   106   2e-24   
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        106   2e-24   
ref|XP_004500724.1|  PREDICTED: uncharacterized protein LOC101494283    109   2e-24   
ref|NP_191042.1|  putative aquaporin PIP2-5                             106   3e-24   
gb|EAY86778.1|  hypothetical protein OsI_08158                          106   3e-24   
gb|AEO13898.1|  aquaporin 7                                             106   3e-24   
emb|CAB45651.1|  putative plasma membrane intrinsic protein             106   3e-24   
gb|AAX92685.1|  probable aquaporin                                      104   3e-24   
gb|AAC17529.1|  aquaporin 2                                             105   3e-24   
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   105   3e-24   
ref|XP_009345758.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        105   4e-24   
gb|ACN40330.1|  unknown                                                 105   4e-24   
gb|ABK60195.2|  PIP2 protein                                            105   4e-24   
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             105   4e-24   
gb|EMS56715.1|  putative aquaporin PIP2-2                               106   4e-24   
gb|EMT09900.1|  Putative aquaporin PIP2-2                               106   4e-24   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             105   4e-24   
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           105   4e-24   
emb|CDX91340.1|  BnaC04g08100D                                          105   4e-24   
ref|NP_001274386.1|  aquaporin PIP2-1-like                              105   4e-24   
ref|XP_002879655.1|  aquaporin                                          105   4e-24   
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           105   5e-24   
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   105   5e-24   
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             105   5e-24   
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        105   5e-24   
gb|AGG39693.1|  aquaporin protein AQU15                                 105   5e-24   
emb|CDY46759.1|  BnaA03g17030D                                          105   5e-24   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   105   5e-24   
gb|AGD98707.1|  aquaporin protein 4                                     105   5e-24   
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   105   5e-24   
ref|XP_008340653.1|  PREDICTED: aquaporin PIP2-1-like                   103   5e-24   
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             105   5e-24   
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   105   5e-24   
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        105   6e-24   
ref|NP_181255.1|  aquaporin PIP2-3                                      105   6e-24   
ref|XP_002879778.1|  PIP2_6/PIP2E                                       105   6e-24   
gb|AAV80229.1|  aquaporin 2                                             105   6e-24   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  105   6e-24   
emb|CDX74984.1|  BnaA05g07300D                                          105   6e-24   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   105   6e-24   
gb|EAZ23886.1|  hypothetical protein OsJ_07605                          105   7e-24   
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  105   7e-24   
ref|XP_006648854.1|  PREDICTED: probable aquaporin PIP2-2-like          104   7e-24   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             105   7e-24   
ref|XP_009345757.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    105   7e-24   
gb|ABK22146.1|  unknown                                                 105   7e-24   
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        105   8e-24   
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          105   8e-24   
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        107   8e-24   
ref|NP_001047491.1|  Os02g0629200                                       105   8e-24   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             104   8e-24   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               105   8e-24   
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               105   8e-24   
ref|NP_001266257.1|  aquaporin PIP2-7-like                              104   9e-24   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             104   9e-24   
emb|CDP07111.1|  unnamed protein product                                104   9e-24   
dbj|BAO18630.1|  plasmamembrane intrinsic protein 2;8                   104   9e-24   
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          104   1e-23   
emb|CDY07519.1|  BnaC06g15450D                                          104   1e-23   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   104   1e-23   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     105   1e-23   
emb|CDX67611.1|  BnaA07g16510D                                          104   1e-23   
ref|XP_006359706.1|  PREDICTED: aquaporin PIP2-7-like                   104   1e-23   
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             104   1e-23   
ref|XP_010042277.1|  PREDICTED: aquaporin PIP2-1-like                   103   1e-23   
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             104   1e-23   
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    104   1e-23   
emb|CAH60723.1|  putative plasma membrane intrinsic protein             104   1e-23   
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               104   1e-23   
ref|XP_011043133.1|  PREDICTED: probable aquaporin PIP2-8               104   1e-23   
gb|KHN33668.1|  Aquaporin PIP2-7                                        104   1e-23   
gb|AAC32107.1|  probable aquaporin                                      104   1e-23   
gb|ABK24156.1|  unknown                                                 104   1e-23   
gb|ABK22173.1|  unknown                                                 104   1e-23   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               104   1e-23   
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               104   1e-23   
dbj|BAA23744.1|  HvPIP2;1                                               104   1e-23   
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6               103   2e-23   
dbj|BAE02729.1|  PIP aquaporin                                          104   2e-23   
gb|ABK93567.1|  unknown                                                 103   2e-23   
ref|XP_002316367.1|  putative aquaporin family protein                  103   2e-23   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             103   2e-23   
gb|KFK36606.1|  hypothetical protein AALP_AA4G145300                    103   2e-23   
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       103   2e-23   
ref|XP_008350380.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    104   2e-23   
gb|KHN02341.1|  Putative aquaporin PIP2-1                               102   2e-23   
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   103   2e-23   
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   103   2e-23   
gb|AFH36338.1|  aquaporin PIP2;3                                        103   2e-23   
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             103   2e-23   
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   103   2e-23   
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        103   2e-23   
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   103   2e-23   
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             103   2e-23   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        103   2e-23   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  103   2e-23   
gb|ABK23750.1|  unknown                                                 103   2e-23   
ref|XP_004289073.1|  PREDICTED: aquaporin PIP2-7-like                   103   3e-23   



>ref|XP_010432340.1| PREDICTED: aquaporin PIP2-7 [Camelina sativa]
 ref|XP_010437523.1| PREDICTED: aquaporin PIP2-7 isoform X1 [Camelina sativa]
 ref|XP_010437524.1| PREDICTED: aquaporin PIP2-7 isoform X2 [Camelina sativa]
 ref|XP_010437525.1| PREDICTED: aquaporin PIP2-7 isoform X2 [Camelina sativa]
 ref|XP_010446981.1| PREDICTED: aquaporin PIP2-7 [Camelina sativa]
Length=280

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDDQWIFWVGPF+GA AAA+YHQFVLRAS+IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAIYHQFVLRASAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWD+ WIFWVGPFIGAFAAAVYHQF+LRA +IKAL SFR
Sbjct  225  TGTGINPARSFGAAVIYNQDKAWDEHWIFWVGPFIGAFAAAVYHQFILRAGAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>dbj|BAA22098.1| unnamed protein product [Arabidopsis thaliana]
Length=193

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDDQWIFWVGPF+GA AAA YHQ++LRAS+IKAL SFR
Sbjct  129  TGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFR  188

Query  182  SN  187
            SN
Sbjct  189  SN  190



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWD+ WIFWVGPFIGAFAAAVYHQF+LRA +IKAL SFR
Sbjct  225  TGTGINPARSFGAAVIYNHDKAWDEHWIFWVGPFIGAFAAAVYHQFILRAGAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>gb|AAL49751.1|AF452013_1 aquaporin-like protein [Petunia x hybrida]
Length=256

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWDDQWIFWVGPFIGA  AA+YHQFVLRA ++KAL SFR
Sbjct  192  TGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGALIAALYHQFVLRAGAVKALGSFR  251

Query  182  SN  187
            SN
Sbjct  252  SN  253



>ref|XP_006284279.1| hypothetical protein CARUB_v10005443mg [Capsella rubella]
 gb|EOA17177.1| hypothetical protein CARUB_v10005443mg [Capsella rubella]
Length=280

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA+YHQFVLRAS+IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFLGALAAAIYHQFVLRASAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWDD W+FWVGPFIGA AAAVYHQ+VLRA++IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNQDKAWDDHWLFWVGPFIGALAAAVYHQYVLRAAAIKALGSFR  283

Query  182  SN  187
            SN
Sbjct  284  SN  285



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   118 bits (296),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+KAWDDQWIFWVGPFIGAF AA YHQ++LRA++IKAL SFR
Sbjct  227  TGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFR  286

Query  182  SN  187
            SN
Sbjct  287  SN  288



>gb|KDO68093.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=212

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  148  TGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  207

Query  182  SN  187
            SN
Sbjct  208  SN  209



>ref|XP_009786071.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64678.1| TPA_exp: aquaporin PIP2 4b [Nicotiana tabacum]
Length=287

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWD+ WIFWVGPF+GAFAAAVYHQ++LRA ++KAL SFR
Sbjct  225  TGTGINPARSFGAAVIYNQDKAWDEHWIFWVGPFVGAFAAAVYHQYILRAGALKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>ref|XP_009615789.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=287

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWD+ WIFWVGPF+GAFAAAVYHQ++LRA ++KAL SFR
Sbjct  225  TGTGINPARSFGAAVIYNQDKAWDEHWIFWVGPFVGAFAAAVYHQYILRAGALKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+KAWDDQWIFWVGP IGA AAA+YHQF+LRA++IKAL SFR
Sbjct  223  TGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>gb|AAB36949.1| plasma membrane intrinsic protein PIP3 [Arabidopsis thaliana]
Length=280

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDDQWIFWVGPF+GA AAA YHQ++LRAS+IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>tpg|DAA64677.1| TPA_exp: aquaporin PIP2 4a [Nicotiana tabacum]
Length=287

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWD+ WIFWVGPF+GAFAAAVYHQ++LRA ++KAL SFR
Sbjct  225  TGTGINPARSFGAAVIYNQDKAWDEHWIFWVGPFVGAFAAAVYHQYILRAGALKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>gb|AAB65787.1| plasma membrane intrinsic protein [Arabidopsis thaliana]
Length=280

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDDQWIFWVGPF+GA AAA YHQ++LRAS+IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>ref|NP_195236.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 ref|NP_001190920.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 sp|P93004.2|PIP27_ARATH RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; Short=AtPIP2;7; AltName: Full=Plasma 
membrane intrinsic protein 3; AltName: Full=Salt stress-induced 
major intrinsic protein; Contains: RecName: Full=Aquaporin 
PIP2-7, N-terminally processed [Arabidopsis thaliana]
 gb|AAL06563.1|AF412110_1 AT4g35100/M4E13_150 [Arabidopsis thaliana]
 emb|CAA17774.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 emb|CAB80227.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAL32881.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM10142.1| plasma membrane intrinsic protein (SIMIP) [Arabidopsis thaliana]
 gb|AAM66021.1| plasma membrane intrinsic protein SIMIP [Arabidopsis thaliana]
 dbj|BAH30556.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86464.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
 gb|AEE86465.1| plasma membrane intrinsic protein 3 [Arabidopsis thaliana]
Length=280

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDDQWIFWVGPF+GA AAA YHQ++LRAS+IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPF+GA  AA YHQFVLRA++IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAAAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>gb|ACB42441.1| aquaporin PIP2;4 [Gossypium hirsutum]
 gb|KHG19165.1| Aquaporin PIP2-7 -like protein [Gossypium arboreum]
Length=278

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD WIFWVGPF+GA AAA+YHQ++LRA++IKAL SFR
Sbjct  214  TGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAIYHQYILRAAAIKALGSFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|XP_010489282.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD WIFWVGPF+GA AAA YHQ++LRA++IKALASFR
Sbjct  214  TGTGINPARSFGAAVIYNDDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|XP_002869108.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45367.1| hypothetical protein ARALYDRAFT_491143 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDDQWIFWVGPF+GA AAA YHQ++LRAS+IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRASAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN++KAWDDQWIFWVGPFIGAF AA YHQ++LRA++IKAL SFR
Sbjct  229  TGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFR  288

Query  182  SN  187
            SN
Sbjct  289  SN  290



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/62 (90%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGA  AA YHQFVLRA +IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFVLRAGAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>emb|CBI37861.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +K WDDQWIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  134  TGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  193

Query  182  SN  187
            SN
Sbjct  194  SN  195



>dbj|BAF63508.1| plasma membrane intrinsic protein [Potamogeton distinctus]
Length=280

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDK WDD WIFWVGPFIGA AAA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNKDKPWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+KAWDDQWIFWVGPFIGA AAA YHQ++LRA++IKAL SFR
Sbjct  227  TGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAAAAFYHQYILRAAAIKALGSFR  286

Query  182  SN  187
            SN
Sbjct  287  SN  288



>ref|XP_007205689.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
 gb|EMJ06888.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
Length=281

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFW+GPFIGA  AA+YHQ++LRA +IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRAGAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+KAWDDQWI WVGPFIGAF AA YHQ++LRA++IKAL SFR
Sbjct  230  TGTGINPARSFGAAVIYNKEKAWDDQWILWVGPFIGAFVAAFYHQYILRAAAIKALGSFR  289

Query  182  SN  187
            SN
Sbjct  290  SN  291



>ref|XP_009803627.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64681.1| TPA_exp: aquaporin PIP2 6b [Nicotiana tabacum]
Length=283

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+K WDDQWIFWVGPF+GA  AA+YHQFVLRA ++KAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPFVGALIAAIYHQFVLRAGAVKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>dbj|BAG68661.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/62 (89%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGA  AA YHQ+VLRA +IKAL SFR
Sbjct  226  TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRAGAIKALGSFR  285

Query  182  SN  187
            SN
Sbjct  286  SN  287



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/61 (87%), Positives = 58/61 (95%), Gaps = 0/61 (0%)
 Frame = +2

Query  5    GTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFRS  184
            GTGINPARSFGAAVIYNK+KAWDDQWIFWVGPFIGAF AA YHQ++LRA++IKAL SFRS
Sbjct  229  GTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRS  288

Query  185  N  187
            N
Sbjct  289  N  289



>tpg|DAA33864.1| TPA_inf: aquaporin PIP2;4 [Gossypium hirsutum]
Length=270

 Score =   116 bits (290),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWD+ WIFWVGPF+GA AAA+YHQ++LRA++IKAL SFR
Sbjct  206  TGTGINPARSFGAAVIYNNDKAWDEHWIFWVGPFVGALAAAIYHQYILRATAIKALGSFR  265

Query  182  SN  187
            SN
Sbjct  266  SN  267



>ref|XP_006422584.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 ref|XP_006486723.1| PREDICTED: aquaporin PIP2-7-like [Citrus sinensis]
 gb|ESR35824.1| hypothetical protein CICLE_v10029003mg [Citrus clementina]
 gb|KDO68090.1| hypothetical protein CISIN_1g023370mg [Citrus sinensis]
Length=283

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>gb|ACU87555.1| PIP protein [Gossypium hirsutum]
Length=278

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDDQWIFWVGP +GA AAA YHQ++LRA++IKAL SFR
Sbjct  214  TGTGINPARSFGAAVIYNNDKAWDDQWIFWVGPMVGALAAAAYHQYILRAAAIKALGSFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|NP_179277.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
 sp|Q9ZVX8.1|PIP28_ARATH RecName: Full=Probable aquaporin PIP2-8; AltName: Full=Plasma 
membrane intrinsic protein 2-8; Short=AtPIP2;8; AltName: Full=Plasma 
membrane intrinsic protein 3b; Short=PIP3b; Contains: 
RecName: Full=Probable aquaporin PIP2-8, N-terminally processed 
[Arabidopsis thaliana]
 gb|AAC64216.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAM15086.1| putative plasma membrane intrinsic protein [Arabidopsis thaliana]
 gb|AAO63278.1| At2g16850 [Arabidopsis thaliana]
 dbj|BAF00056.1| putative aquaporin [Arabidopsis thaliana]
 gb|AEC06543.1| putative aquaporin PIP2-8 [Arabidopsis thaliana]
Length=278

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKALASFR
Sbjct  214  TGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWD+ WIFWVGPFIGAFAAA YHQ++LRA ++KAL SFR
Sbjct  221  TGTGINPARSFGAAVIYNQDKAWDEHWIFWVGPFIGAFAAAAYHQYILRAGAVKALGSFR  280

Query  182  SN  187
            SN
Sbjct  281  SN  282



>gb|ABO69705.2| aquaporin PIP2 [Prunus humilis]
Length=281

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFW+GPFIGA  AA+YHQ++LRA +IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRAGAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFW+GPFIGA  AA+YHQ++LRA +IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRAGAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>ref|XP_010266854.1| PREDICTED: probable aquaporin PIP2-8 [Nelumbo nucifera]
Length=280

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD WIFWVGPFIGA AAA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNGDKAWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>ref|XP_010548112.1| PREDICTED: probable aquaporin PIP2-8 [Tarenaya hassleriana]
Length=281

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>emb|CDX72515.1| BnaC07g45370D [Brassica napus]
Length=254

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA+++KALASFR
Sbjct  190  TGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFR  249

Query  182  SN  187
            SN
Sbjct  250  SN  251



>ref|XP_009138343.1| PREDICTED: aquaporin PIP2-7-like [Brassica rapa]
Length=281

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKALASFR
Sbjct  217  TGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_010920097.1| PREDICTED: probable aquaporin PIP2-6 [Elaeis guineensis]
Length=282

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+ KAWDDQWIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  218  TGTGINPARSFGAAVIYNQGKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQW+FWVGPFIGA  AA+YHQ++LRA ++KAL SFR
Sbjct  220  TGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIAAIYHQYILRAGAMKALGSFR  279

Query  182  SN  187
            SN
Sbjct  280  SN  281



>gb|ACX37448.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=75

 Score =   110 bits (275),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWDDQWIFWVGPFIGA  AA YHQ++LRA+++KAL SFR
Sbjct  11   TGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAVKALGSFR  70

Query  182  SN  187
            S 
Sbjct  71   ST  72



>gb|ACB42440.1| aquaporin PIP2;3 [Gossypium hirsutum]
 gb|AIL95755.1| aquaporin [Gossypium hirsutum]
Length=278

 Score =   115 bits (289),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWD+ WIFWVGPF+GA AAA+YHQ++LRA++IKAL SFR
Sbjct  214  TGTGINPARSFGAAVIYNNDKAWDEHWIFWVGPFVGALAAAIYHQYILRAAAIKALGSFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|XP_002884019.1| PIP2_8/PIP3B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60278.1| PIP2_8/PIP3B [Arabidopsis lyrata subsp. lyrata]
Length=278

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKALASFR
Sbjct  214  TGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFLGALAAAAYHQYILRAAAIKALASFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+KAWDDQWIFWVGP IGA AAA+YHQF+LRA++IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFR  283

Query  182  SN  187
            S+
Sbjct  284  SS  285



>ref|XP_009412922.1| PREDICTED: probable aquaporin PIP2-6 [Musa acuminata subsp. malaccensis]
Length=282

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN+DKAWDD WIFWVGPFIGA AAA YHQ++LRA++IKAL SFR
Sbjct  218  TGTGINPARSLGAAVIYNQDKAWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>gb|KFK30134.1| hypothetical protein AALP_AA7G221400 [Arabis alpina]
Length=282

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDDQWIFWVGPF+GA AAA YHQ++LRA+++KAL SFR
Sbjct  218  TGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFLGALAAAAYHQYILRAAAVKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>gb|EMT32724.1| Aquaporin PIP2-1 [Aegilops tauschii]
Length=143

 Score =   112 bits (280),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFWVGP IGA  AA YHQ++LRA +IKAL SFR
Sbjct  81   TGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIKALGSFR  140

Query  182  SN  187
            SN
Sbjct  141  SN  142



>emb|CDX69112.1| BnaC01g03410D [Brassica napus]
Length=281

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA+++KALASFR
Sbjct  217  TGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_010467415.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score =   115 bits (288),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAW+D WIFWVGPF+GA AAA YHQ++LRA++IKALASFR
Sbjct  214  TGTGINPARSFGAAVIYNDDKAWNDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   115 bits (289),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPF+GA  AA YHQ++LRA++IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFVGAAIAAFYHQYILRAAAIKALGSFR  283

Query  182  SN  187
            SN
Sbjct  284  SN  285



>gb|AAG30607.1|AF314656_1 aquaporin [Brassica oleracea]
Length=281

 Score =   115 bits (288),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA+++KALASFR
Sbjct  217  TGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>gb|ACB87734.1| aquaporin [Manihot esculenta]
Length=280

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DK WDD WIFWVGPFIGA AAA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>ref|XP_008463943.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=283

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+NK+KAWDDQWIFWVGPFIGA  AA+YHQ+VLRA +IKAL SFR
Sbjct  221  TGTGINPARSFGAAVIFNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRAGAIKALGSFR  280

Query  182  SN  187
            SN
Sbjct  281  SN  282



>gb|KFK36762.1| hypothetical protein AALP_AA4G166800 [Arabis alpina]
Length=278

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKA+ASFR
Sbjct  214  TGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKAIASFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|XP_009803290.1| PREDICTED: probable aquaporin PIP2-4, partial [Nicotiana sylvestris]
Length=139

 Score =   111 bits (278),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  77   TGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  136

Query  182  SN  187
            SN
Sbjct  137  SN  138



>gb|ACU17538.1| unknown [Glycine max]
Length=72

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFG AVI+N DKAWDDQWI+WVGPF+GA  AA+YHQ++LR S+IKAL SFR
Sbjct  10   TGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFR  69

Query  182  SN  187
            SN
Sbjct  70   SN  71



>ref|NP_001274381.1| aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004145740.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004169567.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33480.1| plasma intrinsic protein 2-4 [Cucumis sativus]
 gb|KGN46837.1| hypothetical protein Csa_6G140850 [Cucumis sativus]
Length=283

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+NK+KAWDDQWIFWVGPFIGA  AA+YHQ+VLRA +IKAL SFR
Sbjct  221  TGTGINPARSFGAAVIFNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRAGAIKALGSFR  280

Query  182  SN  187
            SN
Sbjct  281  SN  282



>ref|NP_001267957.1| aquaporin PIP2;2 [Vitis vinifera]
 gb|AEZ35023.1| plasma membrane 2;2 aquaporin [Vitis vinifera]
Length=279

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +K WDDQWIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  215  TGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  274

Query  182  SN  187
            SN
Sbjct  275  SN  276



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWD+ WIFWVGPFIGAF AA YHQFVLRA +IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNGDKAWDEHWIFWVGPFIGAFIAAFYHQFVLRAGAIKALGSFR  283

Query  182  SN  187
            SN
Sbjct  284  SN  285



>gb|ABH09327.1| putative aquaporin [Vitis vinifera]
 gb|ABN14351.1| aquaporin PIP2;2 [Vitis vinifera]
 emb|CAN77349.1| hypothetical protein VITISV_007541 [Vitis vinifera]
Length=279

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +K WDDQWIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  215  TGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  274

Query  182  SN  187
            SN
Sbjct  275  SN  276



>emb|CDP04351.1| unnamed protein product [Coffea canephora]
Length=199

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  134  TGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  193

Query  182  SN  187
            S+
Sbjct  194  SS  195



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFW+GPFIGA  AA YHQ++LRA +IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>gb|AAF71820.1|AF141900_1 putative aquaporin PIP2-2 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=279

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +K WDDQWIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  215  TGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  274

Query  182  SN  187
            SN
Sbjct  275  SN  276



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFW+GPFIGA  AA YHQ++LRA +IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>ref|XP_009782764.1| PREDICTED: aquaporin PIP2-7 [Nicotiana sylvestris]
 tpg|DAA64682.1| TPA_exp: aquaporin PIP2 7a [Nicotiana tabacum]
Length=284

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +K WDDQWIFWVGPF+GA  AAVYHQ++LR S+IKAL SFR
Sbjct  220  TGTGINPARSFGAAVIYNTEKVWDDQWIFWVGPFVGALVAAVYHQYILRGSAIKALGSFR  279

Query  182  SN  187
            SN
Sbjct  280  SN  281



>gb|AEY75244.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=281

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFW+GPFIGA  AA YHQ++LRA +IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGA  AA+YHQ VLRA ++KAL SFR
Sbjct  220  TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAIYHQIVLRAGAVKALGSFR  279

Query  182  SN  187
            S+
Sbjct  280  SS  281



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  223  TGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>ref|XP_010032196.1| PREDICTED: aquaporin PIP2-1 [Eucalyptus grandis]
Length=284

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  222  TGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  281

Query  182  SN  187
            SN
Sbjct  282  SN  283



>ref|XP_009367074.1| PREDICTED: aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=288

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFW+GPFIGA  AA YHQ++LRA +IKAL SFR
Sbjct  226  TGTGINPARSFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFR  285

Query  182  SN  187
            SN
Sbjct  286  SN  287



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN++KAWDDQWIFWVGP IGA AAA+YHQFVLRA++IKAL SFR
Sbjct  223  TGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAAIKALGSFR  282

Query  182  SN  187
            S+
Sbjct  283  SS  284



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  223  TGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  223  TGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWDDQWIFWVGPFIGA  AA YHQF+LRA  +KAL SFR
Sbjct  222  TGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAEPLKALGSFR  281

Query  182  SN  187
            SN
Sbjct  282  SN  283



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  223  TGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>ref|XP_006298288.1| hypothetical protein CARUB_v10014353mg [Capsella rubella]
 gb|EOA31186.1| hypothetical protein CARUB_v10014353mg [Capsella rubella]
Length=278

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN  KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKALASFR
Sbjct  214  TGTGINPARSFGAAVIYNDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALASFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGA  AA+YHQ++LRA ++KAL SFR
Sbjct  220  TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAVKALGSFR  279

Query  182  SN  187
            S 
Sbjct  280  ST  281



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+KAWDDQWIFWVGP IGA AAA+YHQF+LRA++IKAL SFR
Sbjct  235  TGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALNSFR  294

Query  182  SN  187
            S+
Sbjct  295  SS  296



>gb|ACE60220.1| plasma membrane aquaporin [Rosa hybrid cultivar]
Length=281

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN++K WDDQWIFWVGPF+GA  AA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNEEKVWDDQWIFWVGPFVGALCAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+KAWDDQWIFWVGPFIGA  AA YHQ++LRA++IKAL SFR
Sbjct  225  TGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>ref|XP_002521292.1| Aquaporin PIP2.7, putative [Ricinus communis]
 emb|CAE53883.1| aquaporin [Ricinus communis]
 gb|EEF41148.1| Aquaporin PIP2.7, putative [Ricinus communis]
Length=280

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DK WDD WIFWVGPF+GA AAA YHQ+VLRA+ IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYHQYVLRAAGIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>ref|XP_010526891.1| PREDICTED: probable aquaporin PIP2-8 [Tarenaya hassleriana]
Length=281

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>dbj|BAF32042.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32043.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32044.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32045.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32046.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32047.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32048.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32049.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32050.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32051.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32052.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32053.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32054.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32055.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32056.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32057.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32058.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32059.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32060.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32061.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32062.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32063.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32064.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32065.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32066.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32067.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32068.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32069.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32070.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32071.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32072.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32073.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32074.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32075.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32076.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32077.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32078.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32079.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32080.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32081.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32082.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32083.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32084.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32085.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32086.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32087.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32088.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32089.1| putative aquaporin [Cryptomeria japonica]
Length=275

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY  DK WDDQWIFWVGPF+GAFAAA YHQ++LRA++IKAL SFR
Sbjct  211  TGTGINPARSFGAAVIYGHDKIWDDQWIFWVGPFLGAFAAAFYHQYILRAAAIKALGSFR  270

Query  182  SN  187
            SN
Sbjct  271  SN  272



>ref|XP_009615212.1| PREDICTED: aquaporin PIP2-7 [Nicotiana tomentosiformis]
 tpg|DAA64683.1| TPA_exp: aquaporin PIP2 7b [Nicotiana tabacum]
Length=284

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +K WDDQWIFWVGPF+GA  AAVYHQ++LR S+IKAL SFR
Sbjct  220  TGTGINPARSFGAAVIYNTEKIWDDQWIFWVGPFVGALVAAVYHQYILRGSAIKALGSFR  279

Query  182  SN  187
            SN
Sbjct  280  SN  281



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQW+FWVGPFIGA  AA YHQ++LRA ++KAL SFR
Sbjct  222  TGTGINPARSFGAAVIYNKDKAWDDQWMFWVGPFIGAAIAAFYHQYILRAGAVKALGSFR  281

Query  182  SN  187
            SN
Sbjct  282  SN  283



>ref|NP_001275065.1| major intrinsic protein 2 [Solanum tuberosum]
 gb|ABB29939.1| major intrinsic protein 2-like [Solanum tuberosum]
 emb|CBI99236.1| major intrinsic protein 2 [Solanum tuberosum]
Length=287

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N DKAWD+ WIFWVGPFIGAF AAVYHQ++LRA +IKAL SFR
Sbjct  225  TGTGINPARSFGAAVIFNGDKAWDEHWIFWVGPFIGAFIAAVYHQYILRAGAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN++KAWDDQWIFWVGP IGA AAA+YHQF+LRA++IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFR  283

Query  182  SN  187
            S+
Sbjct  284  SS  285



>gb|AAL49750.1|AF452012_1 aquaporin-like protein [Petunia x hybrida]
Length=283

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DK WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>gb|ABM54183.1| aquaporin [Jatropha curcas]
 gb|KDP29674.1| hypothetical protein JCGZ_18836 [Jatropha curcas]
Length=280

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DK WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFVGAIAAAAYHQYILRAAAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>dbj|BAF32141.1| putative aquaporin [Taxodium distichum]
Length=274

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY  DK WDDQWIFWVGPF+GAFAAA YHQ++LRA++IKAL SFR
Sbjct  210  TGTGINPARSFGAAVIYGHDKIWDDQWIFWVGPFLGAFAAAFYHQYILRAAAIKALGSFR  269

Query  182  SN  187
            SN
Sbjct  270  SN  271



>emb|CAB46351.1| major intrinsic protein 2 [Solanum tuberosum]
Length=286

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N DKAWD+ WIFWVGPFIGAF AAVYHQ++LRA +IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIFNGDKAWDEHWIFWVGPFIGAFIAAVYHQYILRAGAIKALGSFR  283

Query  182  SN  187
            SN
Sbjct  284  SN  285



>ref|XP_011092966.1| PREDICTED: aquaporin PIP2-7 [Sesamum indicum]
Length=283

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DK WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>gb|EMS52371.1| Aquaporin PIP2-1 [Triticum urartu]
Length=255

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFWVGP IGA  AA YHQ++LRA +IKAL SFR
Sbjct  193  TGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIKALGSFR  252

Query  182  SN  187
            SN
Sbjct  253  SN  254



>gb|ACU87556.1| PIP protein [Gossypium hirsutum]
Length=278

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD WIFWVGP +GA AAA YHQ++LRA++IKAL SFR
Sbjct  214  TGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPMVGALAAAAYHQYILRAAAIKALGSFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY KDKAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  229  TGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  288

Query  182  SN  187
            SN
Sbjct  289  SN  290



>gb|KHF98939.1| putative aquaporin PIP2-8 -like protein [Gossypium arboreum]
Length=278

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD WIFWVGP +GA AAA YHQ++LRA++IKAL SFR
Sbjct  214  TGTGINPARSFGAAVIYNNDKAWDDHWIFWVGPMVGALAAAAYHQYILRAAAIKALGSFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>emb|CDQ12456.1| plasma membrane intrinsic protein 2;1, partial [Vicia faba var. 
minor]
Length=182

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFG AVI+N DKAWDDQWI+WVGPFIGA  AA+YHQ++LR S+IKAL SFR
Sbjct  120  TGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIKALGSFR  179

Query  182  SN  187
            SN
Sbjct  180  SN  181



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAW++ WIFWVGPFIGAFAAA YHQ++LRA ++KAL SFR
Sbjct  220  TGTGINPARSFGAAVIYNQDKAWNEHWIFWVGPFIGAFAAAAYHQYILRAGAVKALGSFR  279

Query  182  SN  187
            SN
Sbjct  280  SN  281



>gb|AHZ08398.1| phosphatidylinosital biphosphate protein [Morus alba var. multicaulis]
Length=282

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DK WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  218  TGTGINPARSFGAAVIYNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN++KAWDDQWIFWVGPFIGA  AA YHQ++LRA++IKAL SFR
Sbjct  227  TGTGINPARSFGAAVIYNREKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFR  286

Query  182  SN  187
            SN
Sbjct  287  SN  288



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DK WDD WIFWVGPF+GA  AA+YHQ++LRA +IKAL SFR
Sbjct  225  TGTGINPARSFGAAVIYNEDKPWDDHWIFWVGPFVGALIAAIYHQYILRAGAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>gb|ADL16407.1| aquaporin [Dianthus caryophyllus]
 gb|AFC90119.1| pip2 [Dianthus caryophyllus]
Length=285

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN  K WDDQWIFWVGPFIGA AAA YHQ++LRA++IKAL SFR
Sbjct  221  TGTGINPARSFGAAVIYNNKKIWDDQWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFR  280

Query  182  SN  187
            SN
Sbjct  281  SN  282



>ref|XP_008809438.1| PREDICTED: probable aquaporin PIP2-6 [Phoenix dactylifera]
Length=282

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS G AVI+N+DKAWDDQWIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  218  TGTGINPARSLGPAVIFNQDKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>gb|AEF32110.1| aquaporin PIP2 [Hedychium coronarium]
Length=282

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS G AVIYN+DKAWDDQWIFWVGP +GA AAA YHQ++LRA++IKAL SFR
Sbjct  218  TGTGINPARSLGPAVIYNQDKAWDDQWIFWVGPLVGALAAAAYHQYILRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>gb|KCW55551.1| hypothetical protein EUGRSUZ_I01429 [Eucalyptus grandis]
Length=281

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN  K WDDQWIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNGKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_009600501.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
 tpg|DAA64680.1| TPA_exp: aquaporin PIP2 6a [Nicotiana tabacum]
Length=283

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+K WDDQWIFWVGPF+GA  AA+Y+QFVLRA ++KAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPFVGALIAAIYYQFVLRAGAVKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDD WIFWVGPFIGA  AA+YHQ+VLRA+++KAL SFR
Sbjct  221  TGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFR  280

Query  182  SN  187
            S+
Sbjct  281  SS  282



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   114 bits (284),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDD WIFWVGPFIGA  AA+YHQ+VLRA+++KAL SFR
Sbjct  221  TGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFR  280

Query  182  SN  187
            S+
Sbjct  281  SS  282



>gb|ABL76066.1| aquaporin 2 [Bruguiera gymnorhiza]
Length=280

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N DK WDDQWIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIHNNDKIWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>gb|AAL33586.1|AF440272_1 aquaporin [Nicotiana tabacum]
Length=284

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPAR+FGAAVIYN +K WDDQWIFWVGPF+GA  AAVYHQ++LR S+IKAL SFR
Sbjct  220  TGTGINPARTFGAAVIYNTEKIWDDQWIFWVGPFVGALVAAVYHQYILRGSAIKALGSFR  279

Query  182  SN  187
            SN
Sbjct  280  SN  281



>ref|XP_010107654.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXC16565.1| Aquaporin PIP2-7 [Morus notabilis]
Length=282

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DK WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  218  TGTGINPARSFGAAVIYNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+KAWDDQWIFWVGPFIGA  AA+YHQ+VLRAS+ KAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRASAAKALGSFR  283

Query  182  SN  187
            S+
Sbjct  284  SS  285



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDD WIFWVGPFIGA  AA+YHQ+VLRA+++KAL SFR
Sbjct  221  TGTGINPARSFGAAVIYNKDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFR  280

Query  182  SN  187
            S+
Sbjct  281  SS  282



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGP IGA  AA YHQ++LRA ++KAL SFR
Sbjct  226  TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYILRAGAVKALGSFR  285

Query  182  SN  187
            SN
Sbjct  286  SN  287



>gb|AFO63679.1| plasma intrinsic protein 2 [Eriobotrya japonica]
Length=281

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DK WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_009400343.1| PREDICTED: probable aquaporin PIP2-6 [Musa acuminata subsp. malaccensis]
Length=282

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN+DK WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  218  TGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>ref|XP_002532756.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF29633.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=283

 Score =   113 bits (283),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN+DKAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  219  TGTGINPARSLGAAVIYNQDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>emb|CDX88767.1| BnaA03g08820D [Brassica napus]
Length=260

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN++KAWDDQWIFWVGP IGA AAA+YHQFVLRA+ IK+L SFR
Sbjct  198  TGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFR  257

Query  182  SN  187
            S+
Sbjct  258  SS  259



>gb|EAY92738.1| hypothetical protein OsI_14490 [Oryza sativa Indica Group]
Length=141

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN+ KAWDD WIFW GPFIGA AAA YHQ++LRA++IKAL SFR
Sbjct  77   TGTGINPARSIGAAVIYNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKALGSFR  136

Query  182  SN  187
            SN
Sbjct  137  SN  138



>ref|XP_007218772.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
 gb|EMJ19971.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
Length=287

 Score =   114 bits (284),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNK+KAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  223  TGTGINPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>emb|CBI16313.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD W+FWVGPFIGA  AA YHQ++LRA++IKAL SFR
Sbjct  134  TGTGINPARSFGAAVIYNNDKAWDDHWMFWVGPFIGAAIAAFYHQYILRAAAIKALGSFR  193

Query  182  SN  187
            SN
Sbjct  194  SN  195



>ref|XP_009105909.1| PREDICTED: aquaporin PIP2-7 [Brassica rapa]
 emb|CDY52648.1| BnaAnng11630D [Brassica napus]
Length=281

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA+++KALASFR
Sbjct  217  TGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFR  276

Query  182  SN  187
            S+
Sbjct  277  SS  278



>ref|XP_009389186.1| PREDICTED: probable aquaporin PIP2-6 [Musa acuminata subsp. malaccensis]
Length=281

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN+DK WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSLGAAVIYNQDKPWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>emb|CDY31523.1| BnaA10g13480D [Brassica napus]
Length=260

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN++KAWDDQWIFWVGP IGA AAA+YHQFVLRA+ IK+L SFR
Sbjct  198  TGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFR  257

Query  182  SN  187
            S+
Sbjct  258  SS  259



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN++KAWDDQWIFWVGP IGA AAA+YHQFVLRA+ IK+L SFR
Sbjct  223  TGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFR  282

Query  182  SN  187
            S+
Sbjct  283  SS  284



>emb|CDX76314.1| BnaA08g10860D [Brassica napus]
Length=281

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA+++KALASFR
Sbjct  217  TGTGINPARSFGAAVIYNHEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFR  276

Query  182  SN  187
            S+
Sbjct  277  SS  278



>emb|CDY17511.1| BnaC03g65520D [Brassica napus]
Length=281

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA+++KALASFR
Sbjct  217  TGTGINPARSFGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAVKALASFR  276

Query  182  SN  187
            S+
Sbjct  277  SS  278



>gb|EYU34445.1| hypothetical protein MIMGU_mgv1a011350mg [Erythranthe guttata]
Length=284

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY KDKAWDDQWIFWVGPFIGA  AA+YHQ++LRA ++KAL SFR
Sbjct  220  TGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAVKALGSFR  279

Query  182  SN  187
            S+
Sbjct  280  SS  281



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFW+GPFIGA  AA YHQ++LRA +IKAL SFR
Sbjct  219  TGTGINPARSLGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFW+GPFIGA  AA YHQ++LRA +IKAL SFR
Sbjct  219  TGTGINPARSLGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>gb|KCW51592.1| hypothetical protein EUGRSUZ_J01087 [Eucalyptus grandis]
Length=383

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  321  TGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  380

Query  182  SN  187
            SN
Sbjct  381  SN  382



>dbj|BAD90701.1| plasma membrane intrinsic protein 2;5 [Mimosa pudica]
Length=281

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN  KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNGKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN++KAWDDQWIFWVGP IGA AAA+YHQFVLRA+ IK+L SFR
Sbjct  221  TGTGINPARSFGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFR  280

Query  182  SN  187
            S+
Sbjct  281  SS  282



>ref|XP_008236033.1| PREDICTED: aquaporin PIP2-7 [Prunus mume]
Length=281

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N  KAWDDQWIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIFNNKKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_006412152.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
 gb|ESQ53605.1| hypothetical protein EUTSA_v10025940mg [Eutrema salsugineum]
Length=281

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN  KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNKKAWDDHWIFWVGPFLGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>gb|ACB71281.1| plasma membrane intrinsic protein [Tamarix hispida]
Length=281

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DK WD+ WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNDKVWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>gb|ACU87557.1| PIP protein [Gossypium hirsutum]
Length=280

 Score =   113 bits (282),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN +KAWDDQWIFWVGPFIGA AAA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAIAAAAYHQYILRATAIKALKSFR  275

Query  182  SN  187
            S+
Sbjct  276  SS  277



>gb|AAF65845.1|AF255795_1 aquaporin 1 [Allium cepa]
Length=291

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGA  AA YHQ+VLRA ++KAL SF 
Sbjct  229  TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRAGAVKALGSFG  288

Query  182  SN  187
            SN
Sbjct  289  SN  290



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY+K+KAWDDQWIFWVGPFIGA  A  YHQFVLRA ++KAL SFR
Sbjct  224  TGTGINPARSFGAAVIYDKEKAWDDQWIFWVGPFIGAAIATAYHQFVLRAGAVKALGSFR  283

Query  182  SN  187
            SN
Sbjct  284  SN  285



>ref|XP_004487111.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=287

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFG AVIYN DKAWDDQWI+WVGPFIGA  AA YHQF+LRA++IKAL SFR
Sbjct  225  TGTGINPARSFGPAVIYNNDKAWDDQWIYWVGPFIGAAIAAFYHQFILRATAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK KAWDDQWIFWVGPFIGA  AA YHQ++LRA +IKAL SFR
Sbjct  226  TGTGINPARSFGAAVIYNKSKAWDDQWIFWVGPFIGAAIAAGYHQYILRAGAIKALGSFR  285

Query  182  SN  187
            SN
Sbjct  286  SN  287



>ref|XP_008377729.1| PREDICTED: probable aquaporin PIP2-8 [Malus domestica]
Length=281

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DK WDD WIFWVGPF+GA AAA YHQ++LRA+++KAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNDKIWDDHWIFWVGPFVGALAAAAYHQYILRAAALKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_002306187.1| membrane intrinsic family protein [Populus trichocarpa]
 gb|ABK95359.1| unknown [Populus trichocarpa]
 gb|EEE86698.1| membrane intrinsic family protein [Populus trichocarpa]
Length=279

 Score =   113 bits (282),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N +KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  215  TGTGINPARSFGAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  274

Query  182  SN  187
            SN
Sbjct  275  SN  276



>ref|XP_009619670.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=283

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  221  TGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  280

Query  182  SN  187
            SN
Sbjct  281  SN  282



>ref|XP_007200557.1| hypothetical protein PRUPE_ppa009691mg [Prunus persica]
 gb|EMJ01756.1| hypothetical protein PRUPE_ppa009691mg [Prunus persica]
Length=281

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFG AVI+N +KAWDDQWIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGPAVIFNNEKAWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDDQWIFW+GPFIGA  AA YHQ++LRA +IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNXDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPFIGA  AA+YHQ++LRA ++KAL SFR
Sbjct  223  TGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>ref|XP_011089904.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin PIP2-7-like [Sesamum 
indicum]
Length=278

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD WIFWVGPFIGA  AA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNDDKAWDDHWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>sp|P42767.1|PIP1_ATRCA RecName: Full=Aquaporin PIP-type [Atriplex canescens]
 gb|AAA86991.1| aquaporin [Atriplex canescens]
Length=282

 Score =   113 bits (282),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK + WDD WIFWVGPF+GA AAA YHQ+VLRA++IKAL SFR
Sbjct  218  TGTGINPARSFGAAVIYNKKRVWDDHWIFWVGPFVGALAAAAYHQYVLRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>ref|XP_011046666.1| PREDICTED: probable aquaporin PIP2-8 [Populus euphratica]
Length=279

 Score =   112 bits (281),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N +KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  215  TGTGINPARSFGAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  274

Query  182  SN  187
            SN
Sbjct  275  SN  276



>gb|AAF61463.1|AF139814_1 plasma membrane intrinsic protein 1 [Triticum aestivum]
Length=290

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFWVGP IGA  AA YHQ++LRA +IKAL SFR
Sbjct  228  TGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIKALGSFR  287

Query  182  SN  187
            SN
Sbjct  288  SN  289



>dbj|BAG06231.1| plasma membrane intrinsic protein [Hordeum vulgare]
 dbj|BAK01580.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQWIFWVGP IGA  AA YHQ++LRA +IKAL SFR
Sbjct  228  TGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIKALGSFR  287

Query  182  SN  187
            SN
Sbjct  288  SN  289



>ref|XP_007046620.1| Plasma membrane intrinsic protein 3 isoform 1 [Theobroma cacao]
 gb|EOX90777.1| Plasma membrane intrinsic protein 3 isoform 1 [Theobroma cacao]
Length=280

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIY+ +KAWDDQWIFWVGPFIGA AAA YHQF+LRA++IKAL SFR
Sbjct  216  TGTGINPARSLGAAVIYDNEKAWDDQWIFWVGPFIGALAAAAYHQFILRATAIKALKSFR  275

Query  182  SN  187
            S+
Sbjct  276  SS  277



>emb|CAH60721.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=279

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N +KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  215  TGTGINPARSFGAAVIFNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  274

Query  182  SN  187
            SN
Sbjct  275  SN  276



>ref|XP_008382110.1| PREDICTED: probable aquaporin PIP2-8 [Malus domestica]
Length=281

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +K WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNEKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_006495474.1| PREDICTED: aquaporin PIP2-2-like, partial [Citrus sinensis]
Length=87

 Score =   107 bits (268),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFG AVIYNKDKAWDDQWIFWVGPFIGA  AA YHQF+LRAS+ KAL S R
Sbjct  23   TGTGINPARSFGPAVIYNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAAKALGSRR  82

Query  182  SN  187
            S+
Sbjct  83   SS  84



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   112 bits (281),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  221  TGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  280

Query  182  SN  187
            SN
Sbjct  281  SN  282



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWDD WIFWVGPFIGA  AA+YHQ+VLRA+++KAL SFR
Sbjct  221  TGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFR  280

Query  182  SN  187
            S+
Sbjct  281  SS  282



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  221  TGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  280

Query  182  SN  187
            SN
Sbjct  281  SN  282



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWDD WIFWVGPFIGA  AA+YHQ+VLRA+++KAL SFR
Sbjct  221  TGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFR  280

Query  182  SN  187
            S+
Sbjct  281  SS  282



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY K+KAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  229  TGTGINPARSFGAAVIYGKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  288

Query  182  SN  187
            SN
Sbjct  289  SN  290



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWDD WIFWVGPFIGA  AA+YHQ+VLRA+++KAL SFR
Sbjct  221  TGTGINPARSFGAAVIYNEDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFR  280

Query  182  SN  187
            S+
Sbjct  281  SS  282



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY KDKAWDDQWIFWVGP IGA  AA+YHQ++LRA ++KAL SFR
Sbjct  223  TGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPLIGAAIAALYHQYILRAGAVKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>ref|XP_007041804.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
 gb|EOX97635.1| Plasma membrane intrinsic protein 2,8 isoform 1 [Theobroma cacao]
Length=278

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN +KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  214  TGTGINPARSIGAAVIYNNEKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2-like [Fragaria vesca subsp. vesca]
Length=281

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWDD W+FW+GPFIGA  AA YHQFVLRA +IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNQDKAWDDHWMFWLGPFIGAAIAAFYHQFVLRAGAIKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>gb|ABC70536.1| aquaporin protein [Vitis pseudoreticulata]
Length=159

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN +KAWDDQWIFWVGPFIGA  AA YHQF+LRA +IKAL SFR
Sbjct  95   TGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFR  154

Query  182  SN  187
            S 
Sbjct  155  ST  156



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N +KAWDD WIFWVGPFIGA  AA+YHQFVLRA +IKAL SFR
Sbjct  220  TGTGINPARSFGAAVIFNNEKAWDDHWIFWVGPFIGAAIAAIYHQFVLRAGAIKALGSFR  279

Query  182  SN  187
            SN
Sbjct  280  SN  281



>ref|XP_009355655.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DK WD+ WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNDKIWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDD WIFWVGPF GA  AA+YHQ++LRA++IKAL SFR
Sbjct  223  TGTGINPARSLGAAVIYNKDKAWDDHWIFWVGPFTGAALAALYHQYILRAAAIKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>ref|XP_008233329.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=287

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNK KAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  223  TGTGINPARSLGAAVIYNKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>emb|CDX71032.1| BnaC03g11160D [Brassica napus]
Length=260

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDDQWIFWVGP IGA AAA+YHQFVLRA+ IK+L SFR
Sbjct  198  TGTGINPARSFGAAVIYNHEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFR  257

Query  182  S  184
            S
Sbjct  258  S  258



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDK WDDQWIFWVGP +GA  AA YHQ++LRA++IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFR  283

Query  182  SN  187
            SN
Sbjct  284  SN  285



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN +KAWDDQWIFWVGPFIGA  AA YHQF+LRA +IKAL SFR
Sbjct  221  TGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFR  280

Query  182  SN  187
            SN
Sbjct  281  SN  282



>ref|XP_004290727.1| PREDICTED: aquaporin PIP2-7-like [Fragaria vesca subsp. vesca]
Length=281

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +K WD+ WIFWVGPFIGA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNEKVWDEHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWDDQWIFWVGPFIGA  AA YHQ++LRA+++KAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNQDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAVKALGSFR  283

Query  182  SN  187
            S 
Sbjct  284  ST  285



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDK WDDQWIFWVGP +GA  AA YHQ++LRA++IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFR  283

Query  182  SN  187
            SN
Sbjct  284  SN  285



>gb|AHG32323.1| PIP2-2 [Pisum sativum]
Length=287

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFG AVI+N DKAWDDQWI+WVGPFIGA  AA+YHQ++LR S+IKAL SFR
Sbjct  225  TGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>gb|EYU40445.1| hypothetical protein MIMGU_mgv1a011413mg [Erythranthe guttata]
Length=282

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N  K WDDQWIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  218  TGTGINPARSFGAAVIFNNGKVWDDQWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>gb|ADJ57599.1| plasma membrane intrinsic protein PIP2;1 [Fragaria chiloensis]
Length=284

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWDD W+FW+GPFIGA  AA YHQFVLRA +IKAL SFR
Sbjct  222  TGTGINPARSFGAAVIYNQDKAWDDHWMFWLGPFIGAAIAAFYHQFVLRAGAIKALGSFR  281

Query  182  SN  187
            SN
Sbjct  282  SN  283



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN DKAWDDQWIFWVGPF+GA  AA YHQF+LRA ++KAL SFR
Sbjct  221  TGTGINPARSLGAAVIYNHDKAWDDQWIFWVGPFLGAAIAAFYHQFILRAGAVKALGSFR  280

Query  182  SN  187
            SN
Sbjct  281  SN  282



>gb|AAG02208.1|AF290201_1 plasma membrane intrinsic protein PIP2 [Solanum chacoense]
Length=283

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY  +K WDDQWIFWVGP +GA AAA+YHQFVLRA ++KAL SFR
Sbjct  219  TGTGINPARSFGAAVIYGHEKIWDDQWIFWVGPMVGAMAAAIYHQFVLRAGAVKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>gb|AEY75254.1| aquaporin [Atriplex canescens]
Length=282

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN  K WDD WIFWVGPF+GA AAA YHQ+VLRA++IKAL SFR
Sbjct  218  TGTGINPARSFGAAVIYNNKKVWDDHWIFWVGPFVGALAAAAYHQYVLRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDDQWIFWVGPFIGA  AA YHQ++LRA +IKAL SFR
Sbjct  219  TGTGINPARSFGAAVIYNNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAIKALGSFR  278

Query  182  SN  187
            S 
Sbjct  279  ST  280



>ref|XP_006436425.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
 ref|XP_006485687.1| PREDICTED: probable aquaporin PIP2-5-like [Citrus sinensis]
 gb|ESR49665.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
Length=287

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQW+FWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  223  TGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  282

Query  182  SN  187
            S 
Sbjct  283  SQ  284



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+ KAWDD WIFWVGPF+GA  AA YHQF+LRA++IKAL SFR
Sbjct  223  TGTGINPARSFGAAVIYNQKKAWDDHWIFWVGPFVGAVIAAFYHQFILRAAAIKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>ref|XP_006360898.1| PREDICTED: aquaporin PIP2-7-like [Solanum tuberosum]
Length=283

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY  +K WDDQWIFWVGP +GA AAA+YHQFVLRA ++KAL SFR
Sbjct  219  TGTGINPARSFGAAVIYGNEKIWDDQWIFWVGPMVGAMAAAIYHQFVLRAGAVKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>ref|XP_008447947.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=280

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN++K W+D WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNREKPWNDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>ref|XP_010266027.1| PREDICTED: aquaporin PIP2-7-like [Nelumbo nucifera]
Length=280

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N++K WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIFNREKIWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>gb|ACV66986.1| plasma membrane aquaporin 2 [Hevea brasiliensis]
Length=278

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD  IFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  214  TGTGINPARSFGAAVIYNNDKAWDDHRIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|NP_001274376.1| aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33481.1| plasma intrinsic protein 2-5 [Cucumis sativus]
 gb|KGN43259.1| hypothetical protein Csa_7G014450 [Cucumis sativus]
Length=280

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN++K W+D WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYNREKPWNDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN++KAWDDQWIFWVGP IGA AAA+YHQFVLRA+ IK+L SFR
Sbjct  223  TGTGINPARSLGAAVIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFR  282

Query  182  SN  187
            S+
Sbjct  283  SS  284



>ref|XP_010516059.1| PREDICTED: probable aquaporin PIP2-8 [Camelina sativa]
Length=278

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN  K+WDD WIFWVGPF+GA AA  YHQ++LRA++IKALASFR
Sbjct  214  TGTGINPARSFGAAVIYNDKKSWDDHWIFWVGPFVGALAARAYHQYILRAAAIKALASFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|XP_002866389.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42648.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDDQWIFWVGP IGA AAA YHQF+LRA++IKAL SFR
Sbjct  223  TGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALGSFR  282

Query  182  S  184
            S
Sbjct  283  S  283



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
Length=285

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DK WDD WIFWVGPFIGA  AA+YHQF+LRA+++KAL SFR
Sbjct  221  TGTGINPARSFGAAVIYNQDKPWDDHWIFWVGPFIGAAIAAIYHQFILRAAAVKALGSFR  280

Query  182  SN  187
            S+
Sbjct  281  SS  282



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+KAWDD WIFWVGPFIGA  AA+YHQF+LRA+++K+L SFR
Sbjct  221  TGTGINPARSFGAAVIYNKEKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVKSLGSFR  280

Query  182  SN  187
            S+
Sbjct  281  SS  282



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY  DKAWDDQWIFWVGPF+GA  AA+YHQ++LRA +IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIYGADKAWDDQWIFWVGPFVGAAIAALYHQYILRAGAIKALGSFR  283

Query  182  SN  187
            SN
Sbjct  284  SN  285



>gb|KDO44716.1| hypothetical protein CISIN_1g0196812mg [Citrus sinensis]
Length=337

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDKAWDDQW+FWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  273  TGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  332

Query  182  SN  187
            S 
Sbjct  333  SQ  334



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN DKAWDD W+FWVGPFIGA  AA YHQ++LRA++IKAL SFR
Sbjct  218  TGTGINPARSFGAAVIYNNDKAWDDHWMFWVGPFIGAAIAAFYHQYILRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>ref|XP_003591907.1| Aquaporin PIP [Medicago truncatula]
 gb|AES62158.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=221

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS G+AVIYNKDK WDD WIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  157  TGTGINPARSLGSAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  216

Query  182  SN  187
            SN
Sbjct  217  SN  218



>emb|CAA04654.1| major intrinsic protein PIPC [Craterostigma plantagineum]
Length=198

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N  KAWDD WIFWVGPF+GA AAA+YHQ++LRA + KAL SFR
Sbjct  134  TGTGINPARSFGAAVIFNNGKAWDDHWIFWVGPFLGALAAAIYHQYILRAQAAKALGSFR  193

Query  182  SN  187
            SN
Sbjct  194  SN  195



>gb|AFH36336.1| aquaporin PIP2;1 [Quercus petraea]
Length=278

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +K WD+ WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  214  TGTGINPARSFGAAVIYNNEKVWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFG AVI+N DKAWDDQWI+WVGPF+GA  AA+YHQ++LR S+IKAL SFR
Sbjct  225  TGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+NKDK WDDQWIFWVGPFIGA  AA+YHQ VLRA ++KAL SFR
Sbjct  220  TGTGINPARSFGAAVIFNKDKPWDDQWIFWVGPFIGAAIAAIYHQVVLRAGAVKALGSFR  279

Query  182  SN  187
            S+
Sbjct  280  SS  281



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFG AVI+N DKAWDDQWI+WVGPF+GA  AA+YHQ++LR S+IKAL SFR
Sbjct  225  TGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+K WDDQWIFWVGPFIGA  AA YHQF+LRA +IKAL SFR
Sbjct  221  TGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFR  280

Query  182  SN  187
            S+
Sbjct  281  SS  282



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+NKDK WDDQWIFWVGPFIGA  AA+YHQ VLRA ++KAL SFR
Sbjct  220  TGTGINPARSFGAAVIFNKDKPWDDQWIFWVGPFIGAAIAAIYHQVVLRAGAVKALGSFR  279

Query  182  SN  187
            S+
Sbjct  280  SS  281



>gb|ACR56614.1| plasma intrinsic protein 2;4 [Juglans regia]
Length=280

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY+ DK WD+ WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSFGAAVIYDNDKVWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  275

Query  182  SN  187
            SN
Sbjct  276  SN  277



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFG AVI+N DKAWDDQWI+WVGPF+GA  AA+YHQ++LR S+IKAL SFR
Sbjct  225  TGTGINPARSFGPAVIFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>ref|XP_003522619.2| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=322

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN  K WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  258  TGTGINPARSFGAAVIYNNGKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  317

Query  182  SN  187
            SN
Sbjct  318  SN  319



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNK+KAWDDQWIFWVGPFIGA  AA YHQF+LRA + KAL SFR
Sbjct  221  TGTGINPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFR  280

Query  182  SN  187
            SN
Sbjct  281  SN  282



>emb|CBI31462.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN +KAWDDQWIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  134  TGTGINPARSLGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  193

Query  182  SN  187
            S 
Sbjct  194  ST  195



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNK+KAWDDQWIFWVGPFIGA  AA YHQF+LRA + KAL SFR
Sbjct  221  TGTGINPARSLGAAVIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFR  280

Query  182  SN  187
            SN
Sbjct  281  SN  282



>gb|ABE68718.1| putative aquaporin [Arachis hypogaea]
Length=85

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N+DK WDD WIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  21   TGTGINPARSFGAAVIFNQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  80

Query  182  SN  187
            S+
Sbjct  81   SD  82



>ref|XP_009376943.1| PREDICTED: probable aquaporin PIP2-8 [Pyrus x bretschneideri]
Length=281

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +K WDD WIFWVGPF+GA  AA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYNNEKVWDDHWIFWVGPFVGALGAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>gb|AFB83067.1| plasma intrinsic protein PIP2.1 [Helianthemum almeriense]
Length=279

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N  K+WDD WIFWVGPFIGA AAA YHQ++LRA++IKAL SFR
Sbjct  215  TGTGINPARSFGAAVIFNNQKSWDDHWIFWVGPFIGALAAAAYHQYILRAAAIKALGSFR  274

Query  182  SN  187
            SN
Sbjct  275  SN  276



>ref|XP_004143245.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+NKDK WDDQWIFWVGPFIGA  AA+YHQ VLRA ++KAL SFR
Sbjct  220  TGTGINPARSFGAAVIFNKDKPWDDQWIFWVGPFIGAAIAAIYHQVVLRAGAVKALGSFR  279

Query  182  SN  187
            S+
Sbjct  280  SS  281



>ref|XP_011094668.1| PREDICTED: aquaporin PIP2-4-like [Sesamum indicum]
Length=281

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY KDKAWDDQWIFWVGPFIGA  AA+YHQ++LRA + KAL SFR
Sbjct  218  TGTGINPARSFGAAVIYGKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAAKALGSFR  277

Query  182  SN  187
            S+
Sbjct  278  SS  279



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+K WDDQWIFWVGP IGA  AA YHQ++LRA++IKAL SFR
Sbjct  223  TGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPIIGAAVAAFYHQYILRAAAIKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDDQWIFWVGPFIGA  AA+YHQFVLRA + KAL SFR
Sbjct  223  TGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLRAQAAKALGSFR  282

Query  182  SN  187
            S+
Sbjct  283  SS  284



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+K WDDQWIFWVGP IGA  AA YHQ++LRA++IKAL SFR
Sbjct  223  TGTGINPARSFGAAVIYNKEKIWDDQWIFWVGPIIGAAVAAFYHQYILRAAAIKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>ref|NP_001233846.1| putative PIP-type aquaporin [Solanum lycopersicum]
 gb|ADP23920.1| putative PIP-type aquaporin [Solanum lycopersicum]
Length=283

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY  +K WDDQWIFWVGP +GA AAA+YHQF+LRA ++KAL SFR
Sbjct  219  TGTGINPARSFGAAVIYGNEKIWDDQWIFWVGPMVGAMAAAIYHQFILRAGAVKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS G AVIYN DKAWDDQWIFWVGPFIGA  AA YHQ++LRA +IKAL SFR
Sbjct  223  TGTGINPARSLGPAVIYNNDKAWDDQWIFWVGPFIGAAIAAAYHQYILRAGAIKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>emb|CAC82712.1| major intrinsic protein 1 [Populus tremula x Populus tremuloides]
 emb|CAH60722.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+KAWDD WIFWVGPFIGA  AA+YHQF+LRA+++K+L SFR
Sbjct  221  TGTGINPARSFGAAVIYNKEKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVKSLGSFR  280

Query  182  SN  187
            S+
Sbjct  281  SS  282



>dbj|BAO18631.1| plasmamembrane intrinsic protein 2;9 [Solanum lycopersicum]
Length=283

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY  +K WDDQWIFWVGP +GA AAA+YHQF+LRA ++KAL SFR
Sbjct  219  TGTGINPARSFGAAVIYGNEKIWDDQWIFWVGPMVGAMAAAIYHQFILRAGAVKALGSFR  278

Query  182  SN  187
            SN
Sbjct  279  SN  280



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N DKAWDDQWIFWVGPF+GA  AA YHQF+LRA++IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIFNNDKAWDDQWIFWVGPFVGAAIAAFYHQFILRAAAIKALGSFR  283

Query  182  SN  187
            S+
Sbjct  284  SH  285



>ref|NP_001234625.1| aquaporin [Solanum lycopersicum]
 gb|ADU34070.1| aquaporin [Solanum lycopersicum]
 dbj|BAO18627.1| plasmamembrane intrinsic protein 2;4 [Solanum lycopersicum]
Length=280

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N DKAWD+ WIFWVGPFIGAF AA YHQFVLRA +IKAL SFR
Sbjct  218  TGTGINPARSFGAAVIFNGDKAWDEHWIFWVGPFIGAFIAAFYHQFVLRAGAIKALGSFR  277

Query  182  SN  187
            S 
Sbjct  278  ST  279



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+ KAWDD WIFWVGPF+GA  AA YHQF+LRA++IKAL SFR
Sbjct  225  TGTGINPARSFGAAVIYNQKKAWDDHWIFWVGPFVGAAIAAFYHQFILRAAAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>dbj|BAD90697.1| plasma membrane intrinsic protein 2;1 [Mimosa pudica]
Length=287

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN  KAWDD WIFWVGP IGA AAA+YHQ++LRA++IKAL SFR
Sbjct  225  TGTGINPARSFGAAVIYNGSKAWDDHWIFWVGPAIGALAAAIYHQYILRAAAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>ref|XP_010107541.1| Aquaporin PIP2-2 [Morus notabilis]
 gb|EXC16223.1| Aquaporin PIP2-2 [Morus notabilis]
Length=286

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDK WDD WIFWVGPFIGA  AA+YHQ++LRA+++KAL SFR
Sbjct  222  TGTGINPARSFGAAVIYNKDKPWDDHWIFWVGPFIGAAIAALYHQYILRAAAVKALGSFR  281

Query  182  SN  187
            S+
Sbjct  282  SS  283



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDK WDD WIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  223  TGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAV+YNK+KAWDDQWIFWVGPFIGA  AA YHQ VLRA++IKAL SFR
Sbjct  225  TGTGINPARSFGAAVMYNKEKAWDDQWIFWVGPFIGAAIAAFYHQHVLRAAAIKALGSFR  284

Query  182  SN  187
            S+
Sbjct  285  SS  286



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNK+KAWDDQWIFWVGPFIGA  A  YHQ+VLRAS+ KAL SFR
Sbjct  226  TGTGINPARSFGAAVIYNKEKAWDDQWIFWVGPFIGAAIAEAYHQYVLRASAAKALGSFR  285

Query  182  SN  187
            S 
Sbjct  286  SG  287



>ref|XP_007137341.1| hypothetical protein PHAVU_009G118900g [Phaseolus vulgaris]
 gb|ESW09335.1| hypothetical protein PHAVU_009G118900g [Phaseolus vulgaris]
Length=278

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN  K WDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  214  TGTGINPARSFGAAVIYNDAKVWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  273

Query  182  SN  187
            SN
Sbjct  274  SN  275



>ref|XP_010690355.1| PREDICTED: aquaporin PIP-type [Beta vulgaris subsp. vulgaris]
Length=281

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N  KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIFNDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/61 (85%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN +KAWDDQWIFWVGPFIGA  AA+YHQFVLRA + KAL SFR
Sbjct  223  TGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLRAQAAKALGSFR  282

Query  182  S  184
            S
Sbjct  283  S  283



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DKAWDDQWIFWVGPFIGA  AA YHQ+VLRAS+ KAL S+R
Sbjct  226  TGTGINPARSFGAAVIYNEDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRASAGKALGSYR  285

Query  182  SN  187
            S 
Sbjct  286  SG  287



>gb|AAB67869.1| plasma membrane major intrinsic protein 2 [Beta vulgaris]
Length=281

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N  KAWDD WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIFNDKKAWDDHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DK WDDQWIFWVGP +GA  AA YHQ++LRA++IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFR  283

Query  182  SN  187
            SN
Sbjct  284  SN  285



>gb|ACR56615.1| plasma intrinsic protein 2;5 [Juglans regia]
Length=281

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIY+ DK WD+ WIFWVGPF+GA AAA YHQ++LRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIYDNDKIWDEHWIFWVGPFVGALAAAAYHQYILRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>dbj|BAD90698.1| plasma membrane intrinsic protein 2;2 [Mimosa pudica]
Length=286

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYNKDK WDD WIFWVGP IGA  AA+YHQ +LRA++IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNKDKIWDDHWIFWVGPAIGAAVAAIYHQHILRATAIKALGSFR  283

Query  182  SN  187
            SN
Sbjct  284  SN  285



>gb|KHG19287.1| Aquaporin PIP2-7 -like protein [Gossypium arboreum]
Length=280

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN +KAWDDQWIFW GP IGAFAAA YHQ++LRA++IKAL SFR
Sbjct  216  TGTGINPARSLGAAVIYNNEKAWDDQWIFWAGPCIGAFAAAAYHQYILRATAIKALKSFR  275

Query  182  SN  187
            S+
Sbjct  276  SS  277



>ref|NP_001052292.1| Os04g0233400 [Oryza sativa Japonica Group]
 sp|Q7XLR1.2|PIP26_ORYSJ RecName: Full=Probable aquaporin PIP2-6; AltName: Full=OsPIP2;6; 
AltName: Full=Plasma membrane intrinsic protein 2-6 [Oryza 
sativa Japonica Group]
 emb|CAE05002.2| OSJNBb0093G06.10 [Oryza sativa Japonica Group]
 dbj|BAF14206.1| Os04g0233400 [Oryza sativa Japonica Group]
 gb|EAY92739.1| hypothetical protein OsI_14491 [Oryza sativa Indica Group]
 dbj|BAG87850.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87963.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95414.1| unnamed protein product [Oryza sativa Japonica Group]
Length=282

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYN+ KAWDD WIFW GPFIGA AAA YHQ++LRA++IKAL SFR
Sbjct  218  TGTGINPARSIGAAVIYNQKKAWDDHWIFWAGPFIGALAAAAYHQYILRAAAIKALGSFR  277

Query  182  SN  187
            SN
Sbjct  278  SN  279



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVIYN+DK WDDQWIFWVGP +GA  AA YHQ++LRA++IKAL SFR
Sbjct  224  TGTGINPARSFGAAVIYNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFR  283

Query  182  SN  187
            SN
Sbjct  284  SN  285



>pdb|1Z98|A Chain A, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In A Closed Conformation
 pdb|1Z98|M Chain M, Crystal Structure Of The Spinach Aquaporin Sopip2;1 
In A Closed Conformation
 pdb|4IA4|A Chain A, Structure Of The Spinach Aquaporin Sopip2;1 At Ph 6
 pdb|4IA4|B Chain B, Structure Of The Spinach Aquaporin Sopip2;1 At Ph 6
 pdb|4IA4|C Chain C, Structure Of The Spinach Aquaporin Sopip2;1 At Ph 6
 pdb|4IA4|D Chain D, Structure Of The Spinach Aquaporin Sopip2;1 At Ph 6
 pdb|4JC6|A Chain A, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|B Chain B, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|C Chain C, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|D Chain D, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|H Chain H, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|J Chain J, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|L Chain L, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 pdb|4JC6|N Chain N, Mercury Activation Of The Plant Aquaporin Sopip2;1 - 
Structural And Functional Characterization
 gb|AAA99274.2| aquaporin [Spinacia oleracea]
Length=281

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFGAAVI+N +K WDDQWIFWVGPFIGA  AA YHQ+VLRA++IKAL SFR
Sbjct  217  TGTGINPARSFGAAVIFNSNKVWDDQWIFWVGPFIGAAVAAAYHQYVLRAAAIKALGSFR  276

Query  182  SN  187
            SN
Sbjct  277  SN  278



>ref|XP_003597235.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES67486.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFG AVI+N +KAWDDQWI+WVGPFIGA  AA+YHQ++LR S+IKAL SFR
Sbjct  225  TGTGINPARSFGPAVIFNNEKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARS GAAVIYNKDK WDD WIFWVGPFIGA  AA YHQF+LRA ++KAL SFR
Sbjct  223  TGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFR  282

Query  182  SN  187
            SN
Sbjct  283  SN  284



>gb|ACM50914.1| aquaporin [Medicago falcata]
Length=287

 Score =   110 bits (276),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  2    TGTGINPARSFGAAVIYNKDKAWDDQWIFWVGPFIGAFAAAVYHQFVLRASSIKALASFR  181
            TGTGINPARSFG AVI+N +KAWDDQWI+WVGPFIGA  AA+YHQ++LR S+IKAL SFR
Sbjct  225  TGTGINPARSFGPAVIFNNEKAWDDQWIYWVGPFIGAAVAAIYHQYILRGSAIKALGSFR  284

Query  182  SN  187
            SN
Sbjct  285  SN  286



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519518671360