BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1021_g1_i1 len=304 path=[25:0-303]

Length=304
                                                                      Score     E

gb|AEA40455.1|  aquaporin                                               191   1e-59   
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   196   1e-59   
gb|ABC70536.1|  aquaporin protein                                       191   2e-59   Vitis pseudoreticulata
ref|XP_011089904.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    194   2e-59   
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         194   3e-59   
gb|ACY82361.1|  putative plasma membrane intrinsic protein family...    190   3e-59   
gb|KHG00060.1|  putative aquaporin PIP2-2                               194   3e-59   
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             194   4e-59   Populus trichocarpa [western balsam poplar]
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              194   5e-59   
gb|ACY82362.1|  putative plasma membrane intrinsic protein family...    189   7e-59   
gb|ACN76545.1|  putative plasma membrane intrinsic protein PIP fa...    189   9e-59   Pachira quinata
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   193   1e-58   
gb|ABB13430.2|  plasma membrane intrinsic protein                       193   1e-58   Olea europaea
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         193   1e-58   Ricinus communis
ref|XP_003625627.1|  Aquaporin PIP2-1                                   193   1e-58   
emb|CBI31462.3|  unnamed protein product                                190   1e-58   
gb|AFK33316.1|  unknown                                                 192   2e-58   
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               192   2e-58   
gb|ACJ85211.1|  unknown                                                 192   2e-58   Medicago truncatula
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   192   2e-58   
gb|KHN32779.1|  Aquaporin PIP2-2                                        191   2e-58   
emb|CAE53873.1|  putative aquaporin                                     187   3e-58   Ricinus communis
gb|AHH02389.1|  aquaporin PIP2-2                                        187   4e-58   
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                     191   4e-58   
gb|ABC69040.1|  aquaporin PIP2-1                                        191   5e-58   Rhododendron catawbiense [Catawba rosebay]
gb|ACN76551.1|  putative plasma membrane intrinsic protein PIP fa...    187   6e-58   Cedrela odorata
ref|NP_001289999.1|  aquaporin PIP2-1                                   191   6e-58   
gb|ACN76548.1|  putative plasma membrane intrinsic protein PIP fa...    187   7e-58   Carapa guianensis [crabwood]
gb|AAW55294.1|  aquaporin 2                                             188   7e-58   Aegiceras corniculatum
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   191   7e-58   
gb|ACN76550.1|  putative plasma membrane intrinsic protein PIP fa...    186   7e-58   Cedrela odorata
gb|ABU94631.1|  putative aquaporin PIP2;3                               191   8e-58   Phaseolus vulgaris [French bean]
gb|KHG08488.1|  putative aquaporin PIP2-2                               191   8e-58   
ref|NP_001240039.1|  uncharacterized protein LOC100782155               191   8e-58   
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               191   8e-58   
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               191   8e-58   
gb|ACU20229.1|  unknown                                                 191   8e-58   Glycine max [soybeans]
ref|NP_001059545.1|  Os07g0448800                                       191   9e-58   Oryza sativa Japonica Group [Japonica rice]
gb|AIK66515.1|  putative aquaporin                                      191   9e-58   
gb|AIA83106.1|  putative aquaporin PIP2                                 191   1e-57   
gb|KHN00691.1|  Aquaporin PIP2-2                                        190   1e-57   
emb|CBI16313.3|  unnamed protein product                                187   1e-57   
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             190   1e-57   
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               191   1e-57   Beta vulgaris subsp. vulgaris [Swiss chard]
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          190   1e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             189   1e-57   
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             190   1e-57   
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   189   1e-57   
gb|ACZ06859.1|  plasma membrane intrinsic protein                       190   1e-57   
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   190   1e-57   
gb|ACX37450.1|  plasma membrane intrinsic protein                       190   1e-57   Hevea brasiliensis [Para rubber tree]
emb|CAN75442.1|  hypothetical protein VITISV_019657                     190   1e-57   Vitis vinifera
gb|ABH09326.1|  putative aquaporin                                      190   1e-57   Vitis vinifera
gb|AAV69744.1|  aquaporin                                               190   1e-57   Vitis vinifera
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     190   1e-57   Vitis cinerea var. helleri x Vitis rupestris
gb|AFH36337.1|  aquaporin PIP2;2                                        190   1e-57   
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         190   2e-57   
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   190   2e-57   
tpg|DAA33865.1|  TPA: aquaporin PIP2;10                                 189   2e-57   
gb|AEC45513.1|  plasma membrane intrinsic protein                       189   2e-57   
gb|ABB88840.1|  aquaporin                                               189   2e-57   Stevia rebaudiana
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             190   2e-57   
gb|AAB18227.1|  MipC                                                    189   2e-57   Mesembryanthemum crystallinum
gb|ACU87558.1|  PIP protein                                             189   2e-57   
gb|ACG32567.1|  aquaporin PIP2.1                                        189   2e-57   Zea mays [maize]
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          189   2e-57   Sorghum bicolor [broomcorn]
gb|AGD98714.1|  aquaporin protein 11                                    189   3e-57   
gb|KHG29841.1|  putative aquaporin PIP2-2                               189   3e-57   
emb|CDY09192.1|  BnaA02g06180D                                          188   3e-57   
gb|AAC17529.1|  aquaporin 2                                             189   3e-57   Samanea saman [cow-tamarind]
gb|ACG39551.1|  aquaporin PIP2.1                                        189   3e-57   Zea mays [maize]
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             189   3e-57   
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        189   3e-57   
ref|NP_001105024.1|  aquaporin PIP2-1                                   189   4e-57   Zea mays [maize]
emb|CDX88767.1|  BnaA03g08820D                                          188   4e-57   
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   189   4e-57   
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               189   4e-57   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                190   4e-57   
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               189   4e-57   
ref|NP_001267922.1|  aquaporin-like                                     189   5e-57   
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               189   5e-57   
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               189   5e-57   
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  189   5e-57   Pyrus communis
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         189   5e-57   
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   189   5e-57   
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 189   6e-57   
gb|ACU24483.1|  unknown                                                 188   6e-57   Glycine max [soybeans]
dbj|BAA82258.1|  water channel protein                                  185   6e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             188   6e-57   
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               188   6e-57   
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               188   7e-57   
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         188   7e-57   Ricinus communis
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               188   8e-57   
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                188   8e-57   
gb|AGD98708.1|  aquaporin protein 5                                     188   9e-57   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   188   9e-57   Allium cepa
gb|AFQ23186.1|  aquaporin PIP2;1                                        188   9e-57   
ref|NP_001105638.1|  aquaporin PIP2-2                                   188   9e-57   Zea mays [maize]
gb|ACF79873.1|  unknown                                                 188   1e-56   Zea mays [maize]
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          188   1e-56   
ref|NP_001268056.1|  aquaporin PIP2                                     187   1e-56   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  188   1e-56   Mimosa pudica [sensitive-plant]
ref|XP_006428787.1|  hypothetical protein CICLE_v10012633mg             186   1e-56   
gb|AAG44948.1|  putative PIP                                            184   1e-56   Nicotiana glauca [glaucous tobacco]
gb|ACV70051.1|  aquaporin PIP2;1                                        186   1e-56   Quercus macrocarpa [burr oak]
gb|AEQ29857.1|  aquaporin PIP2                                          187   1e-56   
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        187   1e-56   
gb|AIA83104.1|  putative aquaporin PIP2                                 188   1e-56   
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     187   1e-56   
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             187   1e-56   
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        187   1e-56   
gb|AAO86707.1|  aquaporin                                               187   1e-56   Zea mays [maize]
gb|ACV70049.1|  aquaporin PIP2;1                                        186   1e-56   Quercus macrocarpa [burr oak]
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   187   1e-56   
gb|AEA40499.1|  aquaporin PIP2-3                                        183   1e-56   
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          187   1e-56   
gb|AAV80229.1|  aquaporin 2                                             187   1e-56   Aegiceras corniculatum
gb|AEY75244.1|  plasma membrane intrinsic protein                       187   2e-56   
dbj|BAF32042.1|  putative aquaporin                                     187   2e-56   Cryptomeria japonica
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   187   2e-56   
emb|CDY70391.1|  BnaC03g72010D                                          183   2e-56   
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   187   2e-56   
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   187   2e-56   
gb|EAZ23886.1|  hypothetical protein OsJ_07605                          187   2e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               187   2e-56   
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        187   2e-56   
gb|EAY86778.1|  hypothetical protein OsI_08158                          187   2e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               187   2e-56   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        187   2e-56   
ref|NP_001047491.1|  Os02g0629200                                       187   2e-56   Oryza sativa Japonica Group [Japonica rice]
gb|AIG92831.1|  aquaporin PIP2                                          187   2e-56   
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                187   2e-56   Populus trichocarpa x Populus deltoides
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             187   2e-56   
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        187   2e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AHG32324.1|  PIP2-3                                                  187   2e-56   
gb|ACV70047.1|  aquaporin PIP2;1                                        185   2e-56   Quercus macrocarpa [burr oak]
gb|AHY28661.1|  aquaporin, membrane intrinsic protein                   181   2e-56   
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                187   2e-56   
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  187   2e-56   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        187   3e-56   Petunia x hybrida [garden petunia]
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               187   3e-56   
dbj|BAG68661.1|  plasma membrane intrinsic protein                      187   3e-56   Tulipa gesneriana
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   187   3e-56   
ref|NP_001274381.1|  aquaporin PIP2-7-like                              187   3e-56   
ref|XP_002879778.1|  PIP2_6/PIP2E                                       187   3e-56   
ref|NP_181254.1|  aquaporin PIP2-2                                      187   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAL16974.1|AF367458_1  membrane intrinsic protein                    183   3e-56   Prunus persica
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   186   3e-56   
dbj|BAG06231.1|  plasma membrane intrinsic protein                      187   3e-56   Hordeum vulgare [barley]
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          187   3e-56   
emb|CDY31523.1|  BnaA10g13480D                                          186   3e-56   
gb|ADG03686.1|  aquaporin                                               187   3e-56   
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 186   3e-56   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             187   4e-56   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  186   4e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDX71032.1|  BnaC03g11160D                                          186   4e-56   
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             187   4e-56   
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                186   4e-56   
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             186   4e-56   
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   186   4e-56   
ref|XP_002879655.1|  aquaporin                                          186   4e-56   
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               186   5e-56   
ref|XP_006648854.1|  PREDICTED: probable aquaporin PIP2-2-like          185   5e-56   
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   186   5e-56   
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    186   5e-56   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               186   5e-56   
gb|AAD31846.1|AF133530_1  water channel protein MipH                    186   6e-56   Mesembryanthemum crystallinum
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          186   6e-56   Sorghum bicolor [broomcorn]
gb|AAO39008.1|  plasma intrinsic protein 2,2                            186   6e-56   Juglans regia
gb|KFK36606.1|  hypothetical protein AALP_AA4G145300                    186   6e-56   
gb|ABK93567.1|  unknown                                                 186   6e-56   Populus trichocarpa [western balsam poplar]
gb|AGD98707.1|  aquaporin protein 4                                     186   6e-56   
gb|AAO39007.1|  plasma intrinsic protein 2,1                            186   6e-56   Juglans regia
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   186   7e-56   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 186   7e-56   
ref|XP_002316367.1|  putative aquaporin family protein                  186   7e-56   Populus trichocarpa [western balsam poplar]
ref|NP_200874.1|  putative aquaporin PIP2-4                             186   7e-56   Arabidopsis thaliana [mouse-ear cress]
gb|ACV70050.1|  aquaporin PIP2;1                                        184   7e-56   Quercus macrocarpa [burr oak]
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   186   7e-56   
gb|AGR83939.1|  aquaporin PIP2-2                                        183   7e-56   
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               186   8e-56   
gb|ABK23750.1|  unknown                                                 186   8e-56   Picea sitchensis
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   186   8e-56   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  185   8e-56   Mimosa pudica [sensitive-plant]
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   186   8e-56   
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   186   9e-56   
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             186   9e-56   
gb|ACV70048.1|  aquaporin PIP2;1                                        184   9e-56   Quercus macrocarpa [burr oak]
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   186   9e-56   
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  186   9e-56   Mimosa pudica [sensitive-plant]
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        185   1e-55   
ref|XP_003591906.1|  Aquaporin PIP                                      182   1e-55   
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   185   1e-55   
emb|CDY53629.1|  BnaC09g53920D                                          184   1e-55   
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        185   1e-55   
gb|AAK71313.1|AF388171_1  plasma membrane intrinsic protein 2           180   1e-55   Triticum monococcum subsp. aegilopoides [wild einkorn]
ref|XP_010553324.1|  PREDICTED: aquaporin PIP2-2                        182   1e-55   
ref|XP_010042277.1|  PREDICTED: aquaporin PIP2-1-like                   184   1e-55   
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  185   1e-55   
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        185   1e-55   
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               185   1e-55   
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             185   1e-55   
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             185   1e-55   
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             185   1e-55   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               185   1e-55   
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               185   2e-55   
emb|CAH60723.1|  putative plasma membrane intrinsic protein             185   2e-55   Populus tremula x Populus tremuloides
gb|AAW80918.1|  putative plasma membrane intrinsic protein              185   2e-55   Astragalus penduliflorus
gb|AEA40497.1|  aquaporin PIP2-1                                        181   2e-55   
gb|ACR56613.1|  plasma intrinsic protein 2;3                            185   2e-55   Juglans regia
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   185   2e-55   
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             185   2e-55   
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          185   2e-55   
gb|AAC16545.1|  aquaporin                                               185   2e-55   Oryza sativa Japonica Group [Japonica rice]
gb|AEQ20672.1|  PIP2;1                                                  185   2e-55   
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             185   2e-55   
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        185   2e-55   
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   185   2e-55   
gb|ACN76554.1|  putative plasma membrane intrinsic protein PIP fa...    180   2e-55   Ceiba pentandra [kapoktree]
emb|CDP04351.1|  unnamed protein product                                182   2e-55   
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   184   2e-55   
gb|ACV70052.1|  aquaporin PIP2;1                                        183   2e-55   Quercus macrocarpa [burr oak]
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   184   2e-55   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   184   2e-55   
emb|CAE53876.1|  putative aquaporin                                     180   2e-55   Ricinus communis
ref|XP_010325989.1|  PREDICTED: aquaporin PIP2-1-like                   184   2e-55   
gb|ABK60195.2|  PIP2 protein                                            184   2e-55   Gossypium hirsutum [American cotton]
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           184   2e-55   Raphanus sativus
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               184   2e-55   
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   184   2e-55   
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        184   2e-55   
dbj|BAA23744.1|  HvPIP2;1                                               184   2e-55   Hordeum vulgare [barley]
emb|CDX91340.1|  BnaC04g08100D                                          184   2e-55   
ref|XP_003591907.1|  Aquaporin PIP                                      182   2e-55   
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   184   2e-55   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   184   2e-55   
ref|NP_001289823.1|  aquaporin PIP2-1-like                              184   2e-55   
ref|NP_001280185.1|  aquaporin PIP2-2                                   184   2e-55   
emb|CAH60724.1|  putative plasma membrane intrinsic protein             184   2e-55   Populus tremula x Populus tremuloides
emb|CDP06739.1|  unnamed protein product                                184   2e-55   
gb|AGG39693.1|  aquaporin protein AQU15                                 184   2e-55   
dbj|BAE02729.1|  PIP aquaporin                                          184   2e-55   Hordeum vulgare [barley]
ref|NP_001234625.1|  aquaporin                                          184   2e-55   
ref|NP_001288933.1|  probable aquaporin PIP2-6                          184   2e-55   
emb|CDY46759.1|  BnaA03g17030D                                          184   3e-55   
gb|AEO13898.1|  aquaporin 7                                             184   3e-55   
emb|CDY14415.1|  BnaC03g21800D                                          184   3e-55   
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   184   3e-55   
gb|AAL16976.1|AF367460_1  membrane intrinsic protein                    180   3e-55   Prunus persica
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   184   3e-55   
ref|NP_001105026.1|  aquaporin PIP2-4                                   184   3e-55   Zea mays [maize]
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                        184   3e-55   
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   184   3e-55   
gb|KHN05685.1|  Aquaporin PIP2-7                                        184   3e-55   
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          184   3e-55   
ref|XP_010098191.1|  Aquaporin PIP2-7                                   184   3e-55   
gb|ADK25057.1|  plasma membrane intrinsic protein                       184   3e-55   
ref|NP_001105025.1|  aquaporin PIP2-3                                   184   3e-55   Zea mays [maize]
ref|NP_001240223.1|  prolactin-inducible protein                        184   3e-55   
gb|KHN38765.1|  Aquaporin PIP2-7                                        184   3e-55   
ref|NP_001105616.1|  aquaporin PIP2-5                                   184   3e-55   Zea mays [maize]
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             184   3e-55   
gb|ABO69705.2|  aquaporin PIP2                                          184   3e-55   Prunus humilis
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   184   3e-55   
emb|CBI37861.3|  unnamed protein product                                181   4e-55   
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   184   4e-55   
gb|ABX83874.1|  plasma membrane intrinsic protein                       184   4e-55   Rhododendron catawbiense [Catawba rosebay]
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   184   4e-55   
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           184   4e-55   Raphanus sativus
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   184   4e-55   
gb|KHN02341.1|  Putative aquaporin PIP2-1                               181   5e-55   
gb|ACG33001.1|  aquaporin PIP2.2                                        184   5e-55   Zea mays [maize]
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             184   5e-55   
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               184   5e-55   
gb|EMS63344.1|  Aquaporin PIP2-5                                        180   5e-55   
gb|ABK22504.1|  unknown                                                 183   5e-55   Picea sitchensis
gb|ACY82360.1|  putative plasma membrane intrinsic protein family...    179   6e-55   
emb|CDX91341.1|  BnaC04g08090D                                          183   6e-55   
gb|ABK24624.1|  unknown                                                 183   6e-55   Picea sitchensis
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        183   7e-55   
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             183   7e-55   
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   183   7e-55   
ref|XP_006657663.1|  PREDICTED: aquaporin PIP2-5-like                   180   7e-55   
gb|AFK47442.1|  unknown                                                 183   8e-55   
emb|CAA04654.1|  major intrinsic protein PIPC                           180   8e-55   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               183   9e-55   
emb|CAB45651.1|  putative plasma membrane intrinsic protein             183   9e-55   
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840          183   9e-55   
emb|CAB61749.1|  putative water channel protein                         181   9e-55   
gb|ABK24173.1|  unknown                                                 181   9e-55   
ref|NP_001275065.1|  major intrinsic protein 2                          183   9e-55   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    183   1e-54   
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          183   1e-54   
emb|CAB46351.1|  major intrinsic protein 2                              182   1e-54   
gb|AGD98705.1|  aquaporin                                               182   1e-54   
gb|AAC32107.1|  probable aquaporin                                      182   1e-54   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   182   1e-54   
gb|AHA84284.1|  prolactin-inducible protein                             182   1e-54   
gb|AAX92685.1|  probable aquaporin                                      179   1e-54   
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2-like                   182   1e-54   
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                182   1e-54   
ref|XP_003591905.1|  Aquaporin PIP                                      182   1e-54   
dbj|BAF32141.1|  putative aquaporin                                     182   1e-54   
gb|ABK21046.1|  unknown                                                 182   1e-54   
emb|CCI55668.1|  EaPIP2,1                                               182   1e-54   
gb|AFK47400.1|  unknown                                                 182   1e-54   
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              182   1e-54   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               182   2e-54   
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               182   2e-54   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          182   2e-54   
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       182   2e-54   
gb|ACV70054.1|  aquaporin PIP2;3                                        180   2e-54   
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   182   2e-54   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   182   2e-54   
ref|NP_001105639.1|  aquaporin PIP2-7                                   182   2e-54   
gb|AAG44947.1|AF290620_1  putative PIP2                                 182   2e-54   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             182   2e-54   
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               182   2e-54   
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   182   2e-54   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   182   2e-54   
emb|CDP07111.1|  unnamed protein product                                182   2e-54   
gb|ABK22173.1|  unknown                                                 182   2e-54   
gb|ACV70055.1|  aquaporin PIP2;3                                        179   2e-54   
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        182   2e-54   
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        182   2e-54   
gb|AEA40498.1|  aquaporin PIP2-2                                        177   2e-54   
dbj|BAF33069.1|  aquaporin                                              182   2e-54   
dbj|BAE06148.1|  PIP aquaporin isoform                                  182   2e-54   
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         182   2e-54   
gb|EMS51072.1|  Aquaporin PIP2-5                                        182   2e-54   
gb|ACU19125.1|  unknown                                                 182   3e-54   
gb|ACV70056.1|  aquaporin PIP2;3                                        179   3e-54   
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        182   3e-54   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             181   3e-54   
gb|ABK24156.1|  unknown                                                 181   3e-54   
gb|ACN76557.1|  putative plasma membrane intrinsic protein PIP fa...    177   3e-54   
ref|XP_003606383.1|  Aquaporin PIP2-7                                   181   3e-54   
gb|ABH09327.1|  putative aquaporin                                      181   3e-54   
ref|NP_001267957.1|  aquaporin PIP2;2                                   181   3e-54   
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                181   3e-54   
emb|CDY56697.1|  BnaCnng31040D                                          181   4e-54   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     181   4e-54   
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        181   4e-54   
gb|AGD98712.1|  aquaporin protein 9                                     181   4e-54   
gb|ACJ85173.1|  unknown                                                 181   4e-54   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   181   4e-54   
gb|ACN40330.1|  unknown                                                 181   5e-54   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    181   5e-54   
gb|AEA40454.1|  aquaporin PIP                                           176   5e-54   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        181   5e-54   
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             181   5e-54   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             181   5e-54   
gb|AAA68701.1|  similar to mipB gene product in Mesembryanthemum ...    180   5e-54   
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          181   5e-54   
gb|AHG32323.1|  PIP2-2                                                  181   5e-54   
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   181   5e-54   
gb|AFH36336.1|  aquaporin PIP2;1                                        181   6e-54   
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             181   6e-54   
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             181   6e-54   
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        181   6e-54   
emb|CDQ12456.1|  plasma membrane intrinsic protein 2;1                  177   6e-54   
ref|NP_190910.1|  aquaporin PIP2-1                                      181   7e-54   
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   181   7e-54   
gb|EAZ03714.1|  hypothetical protein OsI_25847                          181   7e-54   
ref|NP_001237286.1|  PIP2,2                                             181   7e-54   
gb|ABU94630.1|  putative aquaporin PIP2;2                               181   7e-54   
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         181   7e-54   
gb|ACU87555.1|  PIP protein                                             180   7e-54   
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        181   7e-54   
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             181   7e-54   
gb|KFK36804.1|  hypothetical protein AALP_AA4G173500                    181   7e-54   
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    181   8e-54   
ref|XP_009600501.1|  PREDICTED: aquaporin PIP2-7-like                   180   8e-54   
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    180   8e-54   
ref|XP_009803627.1|  PREDICTED: aquaporin PIP2-7-like                   180   8e-54   
ref|NP_181255.1|  aquaporin PIP2-3                                      180   8e-54   
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 180   8e-54   
ref|XP_009782764.1|  PREDICTED: aquaporin PIP2-7                        180   9e-54   
gb|ACU21481.1|  unknown                                                 180   9e-54   
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    180   9e-54   
gb|AFB82643.1|  aquaporin                                               180   9e-54   
gb|ABI96814.1|  plasma membrane intrinsic protein                       180   9e-54   
ref|XP_009615212.1|  PREDICTED: aquaporin PIP2-7                        180   9e-54   
gb|AAB18228.1|  MipE                                                    180   9e-54   
gb|ACY82358.1|  putative plasma membrane intrinsic protein family...    176   1e-53   
gb|KDO68093.1|  hypothetical protein CISIN_1g023370mg                   178   1e-53   
ref|NP_001053335.1|  Os04g0521100                                       180   1e-53   
gb|AAL33586.1|AF440272_1  aquaporin                                     180   1e-53   
ref|NP_001274308.1|  aquaporin PIP2-1-like                              180   1e-53   
gb|ACB71281.1|  plasma membrane intrinsic protein                       180   1e-53   
ref|XP_002312952.1|  hypothetical protein POPTR_0009s13890g             180   1e-53   
emb|CDY13298.1|  BnaC06g14590D                                          180   1e-53   
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         180   1e-53   
gb|ABK22146.1|  unknown                                                 179   1e-53   
gb|ACN76552.1|  putative plasma membrane intrinsic protein PIP fa...    175   2e-53   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  181   2e-53   
pdb|2B5F|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    180   2e-53   
ref|XP_010107541.1|  Aquaporin PIP2-2                                   179   2e-53   
pdb|1Z98|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    179   2e-53   
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                179   2e-53   
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   179   2e-53   
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8               179   2e-53   
emb|CAE53877.1|  putative aquaporin                                     175   2e-53   
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    179   2e-53   
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                   179   2e-53   
gb|AHB33479.1|  plasma intrinsic protein 2-3                            179   2e-53   
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   179   2e-53   
ref|NP_191042.1|  putative aquaporin PIP2-5                             179   2e-53   
ref|XP_011045923.1|  PREDICTED: probable aquaporin PIP2-8               179   3e-53   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     182   3e-53   
ref|NP_001235204.1|  Pip1 protein                                       179   3e-53   
gb|ACN76546.1|  putative plasma membrane intrinsic protein PIP fa...    174   3e-53   
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               179   3e-53   
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   179   3e-53   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               179   3e-53   
gb|ABL76066.1|  aquaporin 2                                             179   3e-53   
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein     179   3e-53   
pdb|3CN6|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    179   4e-53   
ref|XP_006291621.1|  hypothetical protein CARUB_v10017773mg             178   4e-53   
ref|NP_001289846.1|  probable aquaporin PIP2-1                          179   4e-53   
gb|ACV66986.1|  plasma membrane aquaporin 2                             178   4e-53   
pdb|3CLL|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    179   4e-53   
gb|AGR83940.1|  aquaporin PIP2-5                                        176   4e-53   
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                   179   4e-53   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    178   4e-53   
gb|ACU87556.1|  PIP protein                                             178   4e-53   
ref|NP_001233846.1|  putative PIP-type aquaporin                        179   4e-53   
pdb|3CN5|A  Chain A, Crystal Structure Of The Spinach Aquaporin S...    179   4e-53   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                   178   4e-53   
ref|NP_001059542.1|  Os07g0448100                                       178   5e-53   
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        178   5e-53   
gb|EAZ03711.1|  hypothetical protein OsI_25843                          178   5e-53   
gb|ABI96813.1|  plasma membrane intrinsic protein                       178   5e-53   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               178   5e-53   
gb|ACV70053.1|  aquaporin PIP2;2                                        176   6e-53   
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               178   6e-53   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   178   7e-53   
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                         177   7e-53   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   178   8e-53   
ref|XP_003521392.1|  PREDICTED: aquaporin PIP2-7-like                   178   8e-53   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             178   8e-53   
gb|ACV70057.1|  aquaporin PIP2;3                                        176   8e-53   
gb|KDO68091.1|  hypothetical protein CISIN_1g023370mg                   177   8e-53   
gb|AAU43629.1|  putative aquaporin PIP-type                             174   8e-53   
gb|AAS65964.1|  aquaporin PIP 2                                         177   9e-53   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               177   9e-53   
gb|ACB87734.1|  aquaporin                                               177   9e-53   
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6               177   9e-53   
emb|CDY17511.1|  BnaC03g65520D                                          177   9e-53   
ref|XP_001762521.1|  predicted protein                                  177   9e-53   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             177   1e-52   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             177   1e-52   
gb|ACU14125.1|  unknown                                                 177   1e-52   
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    177   1e-52   
emb|CDX76314.1|  BnaA08g10860D                                          177   1e-52   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        177   1e-52   
emb|CDP21564.1|  unnamed protein product                                177   1e-52   
gb|AAG30607.1|AF314656_1  aquaporin                                     177   1e-52   
ref|XP_009108681.1|  PREDICTED: aquaporin PIP2-7-like                   177   1e-52   
ref|XP_003563179.1|  PREDICTED: aquaporin PIP2-6                        177   1e-52   
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                   177   1e-52   
gb|EEE67096.1|  hypothetical protein OsJ_24086                          174   1e-52   
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          177   2e-52   
ref|XP_001753248.1|  predicted protein                                  177   2e-52   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               177   2e-52   
gb|KHN33668.1|  Aquaporin PIP2-7                                        176   2e-52   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        177   2e-52   
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               177   2e-52   
ref|XP_010507447.1|  PREDICTED: probable aquaporin PIP2-5               178   2e-52   
ref|NP_001059543.1|  Os07g0448200                                       175   2e-52   
gb|AFH36338.1|  aquaporin PIP2;3                                        177   2e-52   
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   177   2e-52   
ref|XP_003522619.2|  PREDICTED: aquaporin PIP2-7                        178   2e-52   
gb|ACB42440.1|  aquaporin PIP2;3                                        176   2e-52   
tpg|DAA33864.1|  TPA: aquaporin PIP2;4                                  176   2e-52   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          177   2e-52   
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             177   2e-52   
gb|AAY22203.1|  putative aquaporin                                      176   3e-52   
gb|ACN76549.1|  putative plasma membrane intrinsic protein PIP fa...    172   3e-52   
gb|AAB67869.1|  plasma membrane major intrinsic protein 2               176   3e-52   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          176   3e-52   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  176   3e-52   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          176   3e-52   
gb|KEH39328.1|  major intrinsic protein (MIP) family transporter        176   3e-52   
tpg|DAA60476.1|  TPA: plasma membrane intrinsic protein2                173   3e-52   
gb|EPS68613.1|  hypothetical protein M569_06155                         176   4e-52   
gb|KFK36762.1|  hypothetical protein AALP_AA4G166800                    176   4e-52   
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               176   4e-52   
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8               176   4e-52   
emb|CDX73446.1|  BnaC08g25570D                                          176   4e-52   
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   176   4e-52   
ref|XP_008456476.1|  PREDICTED: probable aquaporin PIP2-5               176   4e-52   
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                     177   4e-52   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     178   5e-52   
gb|ABD16385.1|  putative aquaporin                                      170   5e-52   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             176   5e-52   
gb|ABK60196.1|  PIP2 protein                                            176   5e-52   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     176   5e-52   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     176   5e-52   
gb|AAL49751.1|AF452013_1  aquaporin-like protein                        175   5e-52   



>gb|AEA40455.1| aquaporin [Gerbera jamesonii]
Length=147

 Score =   191 bits (485),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICGVGLVKAFQ +Y+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  44   MIAQCLGAICGVGLVKAFQSSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  103

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  104  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  144



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   196 bits (497),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/101 (93%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+NRYGGGAN+L  GYNKGTGLGAEIIGTFVLVYTVFAA
Sbjct  130  MVAQCLGAICGCGLVKAFQKSYYNRYGGGANVLASGYNKGTGLGAEIIGTFVLVYTVFAA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  230



>gb|ABC70536.1| aquaporin protein [Vitis pseudoreticulata]
Length=159

 Score =   191 bits (484),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY+NRYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  1    MVAQCLGAICGVGLVKAFQSAYYNRYGGGANELSAGYSKGTGLGAEIIGTFVLVYTVFSA  60

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  61   TDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  101



>ref|XP_011089904.1| PREDICTED: LOW QUALITY PROTEIN: aquaporin PIP2-7-like [Sesamum 
indicum]
Length=278

 Score =   194 bits (494),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+Y+NRYGGGAN L  GYNKG GLGAEIIGTFVLVYTVF+A
Sbjct  122  MVAQCLGAICGVGLVKAFQKSYYNRYGGGANELAAGYNKGVGLGAEIIGTFVLVYTVFSA  181

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  222



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   194 bits (494),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/101 (94%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLVKAFQKAY+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  130  MIAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  230



>gb|ACY82361.1| putative plasma membrane intrinsic protein family member 3 [Eperua 
falcata]
Length=161

 Score =   190 bits (483),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQ+AY+NRYGGGAN +QPGYNKGT LGAEIIGTFVLVYTVF+A
Sbjct  36   MVAQCLGAICGTGLVKAFQRAYYNRYGGGANFVQPGYNKGTALGAEIIGTFVLVYTVFSA  95

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAV MVHLATIP+TGTGINP
Sbjct  96   TDPKRSARDSHVPVLAPLPIGFAVXMVHLATIPVTGTGINP  136



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   194 bits (494),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK Y+N YGGGAN LQPG+NKGTGLGAEIIGTFVLVYTVFAA
Sbjct  133  MVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQPGFNKGTGLGAEIIGTFVLVYTVFAA  192

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  193  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  233



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   194 bits (493),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+N YGGGAN LQ GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  128  MVAQCLGAICGCGLVKAFQKSYYNHYGGGANELQEGYNKGTGLGAEIIGTFVLVYTVFSA  187

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  188  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  228



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   194 bits (492),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK Y+N YGGGAN LQPGYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  133  MVAQCLGAICGCGLVKAFQKTYYNTYGGGANELQPGYNKGTGLGAEIIGTFVLVYTVFSA  192

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  193  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  233



>gb|ACY82362.1| putative plasma membrane intrinsic protein family member 4 [Eperua 
falcata]
Length=161

 Score =   189 bits (481),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+N+Y GGANML  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  36   MVAQCLGAICGCGLVKAFQKAYYNKYKGGANMLSXGYSKGTGLGAEIIGTFVLVYTVFSA  95

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVL PLPIGFAVFMVHLATIPITGTGINP
Sbjct  96   TDPKRNARDSHVPVLVPLPIGFAVFMVHLATIPITGTGINP  136



>gb|ACN76545.1| putative plasma membrane intrinsic protein PIP family member 
1 aquaporin [Pachira quinata]
Length=151

 Score =   189 bits (479),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK Y+N YGGGAN LQ G+NKGTGLGAEIIGTFVLVYTVF+A
Sbjct  26   MVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSA  85

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTG NP
Sbjct  86   TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGXNP  126



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score =   193 bits (490),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICGVGLVK+FQKAY+NRYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  127  MIAQCLGAICGVGLVKSFQKAYYNRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   193 bits (490),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+Y+++YGGGAN L PGYNKG GLGAEIIGTFVLVYTVF+A
Sbjct  131  MVAQCLGAICGVGLVKAFQKSYYHKYGGGANELAPGYNKGVGLGAEIIGTFVLVYTVFSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   193 bits (490),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  131  MVAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   193 bits (490),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK Y+NRY GGANML  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>emb|CBI31462.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   190 bits (482),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY++RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  40   MVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSA  99

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  100  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  140



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK Y+NRY GGANML  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+++N YGGGAN LQ GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  128  MVAQCLGAICGCGLVKAFQKSFYNHYGGGANELQEGYNKGTGLGAEIIGTFVLVYTVFSA  187

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  188  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  228



>gb|ACJ85211.1| unknown [Medicago truncatula]
Length=259

 Score =   192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK Y+NRY GGANML  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   192 bits (488),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+ RYGGGAN +QPGY+KGT LGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGCGLVKAFQKAYYTRYGGGANEVQPGYSKGTALGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>gb|KHN32779.1| Aquaporin PIP2-2 [Glycine soja]
Length=239

 Score =   191 bits (484),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQKAY+NRYGGGAN L  GY+ G GLGAEIIGTFVLVYTVF+A
Sbjct  81   MVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSA  140

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  141  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  181



>emb|CAE53873.1| putative aquaporin [Ricinus communis]
Length=151

 Score =   187 bits (476),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M AQCLGAICG GLVKAFQ+AY+NRYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVFAA
Sbjct  25   MAAQCLGAICGCGLVKAFQRAYYNRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFAA  84

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  85   TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  125



>gb|AHH02389.1| aquaporin PIP2-2, partial [Aegiceras corniculatum]
Length=167

 Score =   187 bits (476),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+ +YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  41   MMAQCLGAICGCGLVKAFQKSYYTKYGGGANYLHDGYNKGTGLGAEIIGTFVLVYTVFSA  100

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  101  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  141



>gb|KCW49751.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=258

 Score =   191 bits (484),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA+CG GLVKAFQ+AY+ RYGGGANMLQ GY+KGTGLGAEIIGTFVLVYTV +A
Sbjct  131  MVAQCLGAVCGCGLVKAFQRAYYKRYGGGANMLQAGYSKGTGLGAEIIGTFVLVYTVLSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   191 bits (485),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+YF+RYGGGAN +  GYNKGT LGAEIIGTFVLVYTVF+A
Sbjct  125  MVAQCLGAICGVGLVKAFQKSYFDRYGGGANEVASGYNKGTALGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  185  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  225



>gb|ACN76551.1| putative plasma membrane intrinsic protein PIP family member 
2 aquaporin [Cedrela odorata]
Length=155

 Score =   187 bits (474),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+ RYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  36   MVAQCLGAICGCGLVKAFQKAYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSA  95

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  96   TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  136



>ref|NP_001289999.1| aquaporin PIP2-1 [Beta vulgaris subsp. vulgaris]
 gb|ACT22630.1| plasma membrane intrinsic protein PIP2;2 [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   191 bits (485),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY++RYGGGAN +  GYNKGTGLGAEIIGTFVLVYTVFAA
Sbjct  132  MVAQCLGAICGVGFVKAFQSAYYDRYGGGANQMSHGYNKGTGLGAEIIGTFVLVYTVFAA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>gb|ACN76548.1| putative plasma membrane intrinsic protein PIP family member 
2 aquaporin [Carapa guianensis]
Length=155

 Score =   187 bits (474),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+ RYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  36   MVAQCLGAICGCGLVKAFQKAYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSA  95

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  96   TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  136



>gb|AAW55294.1| aquaporin 2 [Aegiceras corniculatum]
Length=193

 Score =   188 bits (477),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+ +YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  37   MMAQCLGAICGCGLVKAFQKSYYTKYGGGANYLHDGYNKGTGLGAEIIGTFVLVYTVFSA  96

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  97   TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  137



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   191 bits (485),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQKAY+NRYGGGAN L  GY+ G GLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  227



>gb|ACN76550.1| putative plasma membrane intrinsic protein PIP family member 
1 aquaporin [Cedrela odorata]
Length=155

 Score =   186 bits (473),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+ RYGGGAN L  GYN GTGLGAEIIGTFVLVYTVF+A
Sbjct  36   MVAQCLGAICGCGLVKAFQKAYYTRYGGGANELADGYNTGTGLGAEIIGTFVLVYTVFSA  95

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLAT P+TGTGINP
Sbjct  96   TDPKRNARDSHVPVLAPLPIGFAVFMVHLATXPVTGTGINP  136



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   191 bits (484),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+Y+NRYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGVGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   191 bits (484),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK Y+N YGGGAN LQ G+NKGTGLGAEIIGTFVLVYTVF+A
Sbjct  130  MVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQSGFNKGTGLGAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  230



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   191 bits (484),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQKAY+NRYGGGAN L  GY+ G GLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  227



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   191 bits (484),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA+CG GLVKAFQ+AY+ RYGGGANMLQ GY+KGTGLGAEIIGTFVLVYTV +A
Sbjct  131  MVAQCLGAVCGCGLVKAFQRAYYKRYGGGANMLQAGYSKGTGLGAEIIGTFVLVYTVLSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   191 bits (484),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICGVGLVK FQ+AY++RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  132  MIAQCLGAICGVGLVKGFQRAYYDRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   191 bits (484),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQKAY+NRYGGGAN L  GY+ G GLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  227



>ref|NP_001059545.1| Os07g0448800 [Oryza sativa Japonica Group]
 sp|Q8H5N9.1|PIP21_ORYSJ RecName: Full=Probable aquaporin PIP2-1; AltName: Full=OsPIP2;1; 
AltName: Full=Plasma membrane intrinsic protein 2-1; AltName: 
Full=Plasma membrane intrinsic protein 2a; Short=PIP2a 
[Oryza sativa Japonica Group]
 dbj|BAC15868.1| plasma membrane intrinsic protein [Oryza sativa Japonica Group]
 dbj|BAF21459.1| Os07g0448800 [Oryza sativa Japonica Group]
 gb|EAZ03715.1| hypothetical protein OsI_25848 [Oryza sativa Indica Group]
 dbj|BAG96349.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93010.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99732.1| unnamed protein product [Oryza sativa Japonica Group]
Length=290

 Score =   191 bits (484),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQ AYFNRYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  134  IVAQCLGAICGVGLVKAFQSAYFNRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  194  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  234



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   191 bits (484),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY+NRYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGVGLVKAFQSAYYNRYGGGANELATGYSKGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  186  TDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  226



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG G VKAFQK+Y+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  136  MVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  195

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  196  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  236



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQKAY+NRYGGGAN L  GY+ G GLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  227



>emb|CBI16313.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   187 bits (476),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGA+CGVGLVKAFQ + +NRYGGGAN L  GYNKG GLGAEIIGTFVLVYTVF+A
Sbjct  40   MIAQCLGAVCGVGLVKAFQSSLYNRYGGGANELAGGYNKGVGLGAEIIGTFVLVYTVFSA  99

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  100  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  140



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICGVGLVKAFQKAY+NRYGGG N L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  129  MIAQCLGAICGVGLVKAFQKAYYNRYGGGVNELSSGYSKGTGLAAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>gb|AAB67868.1| plasma membrane major intrinsic protein 1 [Beta vulgaris]
Length=288

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY++RYGGGAN +  GYNKGTGLGAEIIGTFVLVYTVFAA
Sbjct  132  MVAQCLGAICGVGFVKAFQSAYYDRYGGGANQMAHGYNKGTGLGAEIIGTFVLVYTVFAA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>gb|EAZ39662.1| hypothetical protein OsJ_24090 [Oryza sativa Japonica Group]
Length=290

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQ AYFNRYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  134  IVAQCLGAICGVGLVKAFQSAYFNRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  194  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  234



>ref|XP_006424577.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|ESR37817.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
Length=264

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG G VKAFQK+Y+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  133  MVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  192

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  193  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  233



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+Y+NRYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGVGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>gb|KDO73275.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=264

 Score =   189 bits (481),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG G VKAFQK+Y+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  133  MVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  192

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  193  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  233



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+YFN+YGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  186  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  226



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+YFN+YGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  186  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  226



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M AQCLGAICG GLVKAFQKAY+NRYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  130  MAAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYSKGTGLGAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  230



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY++RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  186  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  226



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY++RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  186  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  226



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY++RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  186  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  226



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY++RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  186  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  226



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+ + RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGVGLVKAFQKSLYTRYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+YFN+YGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLAAGYSTGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA+CGVGLVKAFQKAY+NRYGGGAN L  GY+ G GLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAMCGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  227



>tpg|DAA33865.1| TPA_inf: aquaporin PIP2;10 [Gossypium hirsutum]
Length=271

 Score =   189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK Y+N YGGGAN LQ G+NKGTGLGAEIIGTFVLVYTVF+A
Sbjct  135  MVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSA  194

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  195  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  235



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  130  MVAQCLGAICGCGLVKAFQKAYYNRYGGGANELSDGYNKGTGLGAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TD KRNARDSHVP+LAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  190  TDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINP  230



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ +Y+NRYGGGAN L  GYNKGTGLG EIIGTFVLVYTVF+A
Sbjct  125  MVAQCLGAICGVGLVKAFQSSYYNRYGGGANELADGYNKGTGLGTEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  185  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  225



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG G VKAFQK+Y+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  133  MVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  192

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  193  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  233



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQKAY+ RYGGGAN +  GY KGTGLGAEIIGTFVLVYTVFAA
Sbjct  131  MVAQCLGAICGVGFVKAFQKAYYVRYGGGANEMASGYTKGTGLGAEIIGTFVLVYTVFAA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVK FQK+Y+N YGGGAN LQ G+NKGTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGCGLVKGFQKSYYNTYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  186  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  226



>gb|ACG32567.1| aquaporin PIP2.1 [Zea mays]
Length=290

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQ AYF+RYGGGAN L  GY++GTGLGAEIIGTFVLVYTVF+A
Sbjct  134  IVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  194  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  234



>ref|XP_002461930.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
 gb|EER98451.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
Length=290

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQ AYF+RYGGGAN L  GY++GTGLGAEIIGTFVLVYTVF+A
Sbjct  134  IVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  194  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  234



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   189 bits (481),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQC GAICGVGLVKAFQ+AY++RYGGGAN + PGYNKGT LGAEIIGTFVLVYTVF+A
Sbjct  131  MVAQCSGAICGVGLVKAFQRAYYDRYGGGANEVAPGYNKGTALGAEIIGTFVLVYTVFSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  191  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  231



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   189 bits (481),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK Y+N YGGGAN LQ G+NKGTGLGAEIIGTFVLVYTVF+A
Sbjct  135  MVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGFNKGTGLGAEIIGTFVLVYTVFSA  194

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  195  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  235



>emb|CDY09192.1| BnaA02g06180D [Brassica napus]
Length=259

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  102  IVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLAEGYNKGTGLGAEIIGTFVLVYTVFSA  161

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  162  TDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  202



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQKAY++RYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGVGLVKAFQKAYYSRYGGGANTLSDGYSTGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>gb|ACG39551.1| aquaporin PIP2.1 [Zea mays]
Length=290

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQ AYF+RYGGGAN L  GY++GTGLGAEIIGTFVLVYTVF+A
Sbjct  134  IVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  194  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  234



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQKAY+N+YGGGAN L  GY+ G GLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQKAYYNKYGGGANELSDGYSTGVGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  227



>ref|XP_009413714.1| PREDICTED: aquaporin PIP2-4-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=287

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVK FQ+AYF RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVFAA
Sbjct  131  MVAQCLGAICGVGLVKGFQEAYFVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFAA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>ref|NP_001105024.1| aquaporin PIP2-1 [Zea mays]
 sp|Q84RL7.2|PIP21_MAIZE RecName: Full=Aquaporin PIP2-1; AltName: Full=Plasma membrane 
intrinsic protein 2-1; AltName: Full=ZmPIP2-1; AltName: Full=ZmPIP2;1 
[Zea mays]
 gb|AAK26758.1| plasma membrane integral protein ZmPIP2-1 [Zea mays]
 gb|ACF78965.1| unknown [Zea mays]
 gb|ACF84592.1| unknown [Zea mays]
 gb|ACF86144.1| unknown [Zea mays]
 gb|ACG31774.1| aquaporin PIP2.1 [Zea mays]
 tpg|DAA60473.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=290

 Score =   189 bits (480),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQ AYF+RYGGGAN L  GY++GTGLGAEIIGTFVLVYTVF+A
Sbjct  134  IVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  194  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  234



>emb|CDX88767.1| BnaA03g08820D [Brassica napus]
Length=260

 Score =   188 bits (478),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  104  IVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLADGYNKGTGLGAEIIGTFVLVYTVFSA  163

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  164  TDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  204



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   189 bits (480),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQ AYF+RYGGGAN L  GY++GTGLGAEIIGTFVLVYTVF+A
Sbjct  133  IVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSA  192

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  193  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  233



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVKAFQK+Y+ +YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  125  IIAQCLGAICGVGLVKAFQKSYYMKYGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINP  225



>tpg|DAA60472.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=316

 Score =   190 bits (482),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQ AYF+RYGGGAN L  GY++GTGLGAEIIGTFVLVYTVF+A
Sbjct  134  IVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  194  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  234



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   189 bits (479),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  IVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLADGYNKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY++RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPK++ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  186  TDPKKSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  226



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVKAFQK+Y+ +YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  125  IIAQCLGAICGVGLVKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINP  225



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVK FQKAYF RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVFAA
Sbjct  131  IVAQCLGAICGVGLVKGFQKAYFVRYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFAA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVKAFQK+Y+ +YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  125  IIAQCLGAICGVGLVKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINP  225



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M AQCLGAICG GLVKAFQKAY+ RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MAAQCLGAICGCGLVKAFQKAYYTRYGGGANELADGYSKGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  186  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  226



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ +Y++RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  130  MVAQCLGAICGVGLVKAFQSSYYDRYGGGANSLADGYSKGTGLAAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  230



>tpg|DAA64677.1| TPA_exp: aquaporin PIP2 4a [Nicotiana tabacum]
Length=287

 Score =   189 bits (479),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M++QCLGAICGVGLVKAFQKAYFNRYGGG N++  G+NKG GLGAEIIGTFVLVYTVF+A
Sbjct  131  MVSQCLGAICGVGLVKAFQKAYFNRYGGGVNVMAGGHNKGVGLGAEIIGTFVLVYTVFSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   188 bits (478),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCL AICGVGLVKAFQK+YFN+YGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLSAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  186  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  226



>dbj|BAA82258.1| water channel protein [Oryza sativa Indica Group]
Length=181

 Score =   185 bits (470),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQ AYFNRYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  25   IVAQCLGAICGVGLVKAFQSAYFNRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSA  84

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFA FMV LATIPITGTGINP
Sbjct  85   TDPKRNARDSHVPVLAPLPIGFAWFMVQLATIPITGTGINP  125



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   188 bits (478),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQKAY+ RYGGGAN L  GY+ G GLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQKAYYTRYGGGANELSEGYSTGVGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  227



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   188 bits (478),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+ RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  130  IVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  230



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   188 bits (478),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+ RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  130  IVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  230



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   188 bits (478),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M AQCLGAICG GLVKAFQ+AY+NRYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVFAA
Sbjct  130  MAAQCLGAICGCGLVKAFQRAYYNRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFAA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  230



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   188 bits (477),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+ RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  IVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   188 bits (477),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M AQCLGAICG GLVKAFQK+Y+NRYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  125  MAAQCLGAICGCGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  225



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   188 bits (477),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGV LVKAFQ+AY++RYGGGAN + PGYNKGT LGAEIIGTFVLVYTVF+A
Sbjct  129  IVAQCLGAICGVALVKAFQRAYYDRYGGGANEVAPGYNKGTALGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>gb|AAF65845.1|AF255795_1 aquaporin 1 [Allium cepa]
Length=291

 Score =   188 bits (478),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICGVG VKAFQ AY++RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVFAA
Sbjct  135  MIAQCLGAICGVGFVKAFQSAYYSRYGGGANTLNAGYSKGTGLAAEIIGTFVLVYTVFAA  194

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  195  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  235



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   188 bits (477),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ++Y++RY GGANM+ PGY KG GL AEIIGTFVLVYTVF+A
Sbjct  130  MVAQCLGAICGVGLVKAFQRSYYHRYEGGANMVAPGYTKGVGLSAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  230



>ref|NP_001105638.1| aquaporin PIP2-2 [Zea mays]
 sp|Q9ATM8.1|PIP22_MAIZE RecName: Full=Aquaporin PIP2-2; AltName: Full=Plasma membrane 
intrinsic protein 2-2; AltName: Full=ZmPIP2-2; AltName: Full=ZmPIP2;2 
[Zea mays]
 gb|AAK26759.1| plasma membrane integral protein ZmPIP2-2 [Zea mays]
 gb|ACG39966.1| aquaporin PIP2.1 [Zea mays]
 gb|ACN31255.1| unknown [Zea mays]
 tpg|DAA39706.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=292

 Score =   188 bits (477),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA+CGVGLVKAFQ AYF+RYGGGAN L  GY++G GLGAEI+GTFVLVYTVF+A
Sbjct  136  MVAQCLGAVCGVGLVKAFQSAYFDRYGGGANSLASGYSRGAGLGAEIVGTFVLVYTVFSA  195

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  196  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  236



>gb|ACF79873.1| unknown [Zea mays]
Length=294

 Score =   188 bits (478),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA+CGVGLVKAFQ AYF+RYGGGAN L  GY++G GLGAEI+GTFVLVYTVF+A
Sbjct  138  MVAQCLGAVCGVGLVKAFQSAYFDRYGGGANSLASGYSRGAGLGAEIVGTFVLVYTVFSA  197

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  198  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  238



>ref|XP_006846771.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
 gb|ERN08352.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
Length=283

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVK FQ AY+NRYGGGAN L  GY+KG GLGAEIIGTFVLVYTVF+A
Sbjct  125  MVAQCLGAICGVGLVKGFQSAYYNRYGGGANTLSNGYDKGVGLGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  185  TDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  225



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGA+CGVGLVKAFQ + +NRYGGGAN L  GYNKG GLGAEIIGTFVLVYTVF+A
Sbjct  124  MIAQCLGAVCGVGLVKAFQSSLYNRYGGGANELAGGYNKGVGLGAEIIGTFVLVYTVFSA  183

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  184  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  224



>dbj|BAD90697.1| plasma membrane intrinsic protein 2;1 [Mimosa pudica]
Length=287

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQC GAICG GL KAFQKAY++RYGGG N +QPGY+KGT LGAEIIGTFVLVYTVF+A
Sbjct  131  MVAQCAGAICGTGLAKAFQKAYYDRYGGGVNFVQPGYSKGTALGAEIIGTFVLVYTVFSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  191  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  231



>ref|XP_006428787.1| hypothetical protein CICLE_v10012633mg [Citrus clementina]
 gb|ESR42027.1| hypothetical protein CICLE_v10012633mg [Citrus clementina]
Length=235

 Score =   186 bits (473),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+ RYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>gb|AAG44948.1| putative PIP [Nicotiana glauca]
Length=156

 Score =   184 bits (466),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+ RYGGGAN++ PG+ KG GL AEIIGTFVLVYTVF+A
Sbjct  38   MVAQCLGAICGVGFVKAFQSAYYVRYGGGANVMAPGHTKGVGLAAEIIGTFVLVYTVFSA  97

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  98   TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  138



>gb|ACV70051.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=223

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLVKAFQ+AY++R+GGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  112  MIAQCLGAICGCGLVKAFQRAYYSRFGGGANELALGYSKGTGLAAEIIGTFVLVYTVFSA  171

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  172  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  212



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQK+Y+ +YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  125  IVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINP  225



>ref|XP_008463943.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=283

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQC GAICG GLVKAFQ AY+ RY GGANML  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MLAQCAGAICGCGLVKAFQSAYYVRYNGGANMLSDGYNKGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG G VKAFQK+Y+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  134  MVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPI GTGINP
Sbjct  194  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPIIGTGINP  234



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/101 (91%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICGVGLVK FQKA++ RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVFAA
Sbjct  132  MIAQCLGAICGVGLVKGFQKAFYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFAA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+ RYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQK+Y+ +YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  125  IVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINP  225



>gb|AAO86707.1| aquaporin [Zea mays]
Length=290

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQ AYF+RYGGGAN L  GY++GTG GAEIIGTFVLVYTVF+A
Sbjct  134  IVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGFGAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  194  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  234



>gb|ACV70049.1| aquaporin PIP2;1 [Quercus macrocarpa]
Length=224

 Score =   186 bits (471),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLVKAFQ+AY++R+GGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  113  MIAQCLGAICGCGLVKAFQRAYYSRFGGGANELALGYSKGTGLAAEIIGTFVLVYTVFSA  172

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  173  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  213



>ref|XP_006481455.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+ RYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>gb|AEA40499.1| aquaporin PIP2-3 [Brassica oleracea var. italica]
Length=155

 Score =   183 bits (465),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+ RYGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  34   MVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSA  93

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  94   TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  134



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+NRYGGG N++  G+NKG GLGAEIIGTFVLVYTVF+A
Sbjct  130  MVAQCLGAICGVGFVKAFQSAYYNRYGGGVNVMAAGHNKGVGLGAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  230



>gb|AAV80229.1| aquaporin 2 [Aegiceras corniculatum]
Length=284

 Score =   187 bits (476),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+ +YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  128  MMAQCLGAICGCGLVKAFQKSYYTKYGGGANYLHDGYNKGTGLGAEIIGTFVLVYTVFSA  187

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  188  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  228



>gb|AEY75244.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=281

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVKAFQK+Y+ ++GGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  125  IIAQCLGAICGVGLVKAFQKSYYVKFGGGANELSAGYNKGTGLGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINP  225



>dbj|BAF32042.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32043.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32044.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32045.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32046.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32047.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32048.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32049.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32050.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32051.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32052.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32053.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32054.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32055.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32056.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32057.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32058.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32059.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32060.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32061.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32062.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32063.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32064.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32065.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32066.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32067.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32068.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32069.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32070.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32071.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32072.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32073.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32074.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32075.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32076.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32077.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32078.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32079.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32080.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32081.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32082.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32083.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32084.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32085.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32086.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32087.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32088.1| putative aquaporin [Cryptomeria japonica]
 dbj|BAF32089.1| putative aquaporin [Cryptomeria japonica]
Length=275

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK++++ YGGGAN + PGY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  117  MVAQCLGAICGVGLVKAFQKSFYDMYGGGANSVAPGYSKGTGLGAEIIGTFVLVYTVFSA  176

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  177  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  217



>ref|XP_009619670.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=283

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+ +YGGGANML  GY+ GTGLGAEIIGTFVLVYTVFAA
Sbjct  127  MLAQCLGAICGCGLVKAFQKAYYVKYGGGANMLNDGYSTGTGLGAEIIGTFVLVYTVFAA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  187  TDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPVTGTGINP  227



>emb|CDY70391.1| BnaC03g72010D [Brassica napus]
Length=159

 Score =   183 bits (465),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ +Y+ RYGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  1    MVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSA  60

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  61   TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  101



>ref|XP_009615789.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=287

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M++QCLGAICGVGLVKAFQKAY+NRYGGG N++  G+NKG GLGAEIIGTFVLVYTVF+A
Sbjct  131  MVSQCLGAICGVGLVKAFQKAYYNRYGGGVNVMAGGHNKGVGLGAEIIGTFVLVYTVFSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>ref|XP_009786071.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64678.1| TPA_exp: aquaporin PIP2 4b [Nicotiana tabacum]
Length=287

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M++QCLGAICGVGLVKAFQKAY+NRYGGG N++  G+NKG GLGAEIIGTFVLVYTVF+A
Sbjct  131  MVSQCLGAICGVGLVKAFQKAYYNRYGGGVNVMAGGHNKGVGLGAEIIGTFVLVYTVFSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>gb|EAZ23886.1| hypothetical protein OsJ_07605 [Oryza sativa Japonica Group]
Length=280

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVK FQ +Y+ RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  125  IIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  225



>ref|XP_010505564.1| PREDICTED: probable aquaporin PIP2-6 [Camelina sativa]
 ref|XP_010517236.1| PREDICTED: probable aquaporin PIP2-6 [Camelina sativa]
 gb|AEH76329.1| plasma membrane intrinsic protein 2E [Camelina sativa]
Length=290

 Score =   187 bits (476),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA CGVGLVK FQ  YFNRYGGGANML  GYN G G+GAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGATCGVGLVKLFQSTYFNRYGGGANMLSDGYNVGVGVGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGF+VFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINP  229



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICGVGLVK FQ AY+ RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  131  MIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVK FQ +Y+ RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  133  IIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFSA  192

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  193  TDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  233



>ref|XP_003563177.1| PREDICTED: probable aquaporin PIP2-1 [Brachypodium distachyon]
Length=290

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGA+CGVGLVKAFQ AYF RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  134  MIAQCLGAMCGVGLVKAFQSAYFVRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  194  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  234



>ref|XP_009367074.1| PREDICTED: aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=288

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQK+Y+ +YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  132  IVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  192  TDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINP  232



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVK FQ +Y+ RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  133  IIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFSA  192

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  193  TDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  233



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAF K+ +NRYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFNKSLYNRYGGGANSLADGYNKGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  187  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  227



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+ +YGGGAN L  G++KGTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+ +YGGGAN L  G++KGTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|AAM63463.1| aquaporin (plasma membrane intrinsic protein 2B) [Arabidopsis 
thaliana]
Length=285

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ +Y++RYGGGAN L  GYN GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQ LGAICGVGLVKAFQK+YF RYGGGAN LQPGY+ G GLGAEI+GTFVLVYTVF+A
Sbjct  129  MVAQSLGAICGVGLVKAFQKSYFVRYGGGANFLQPGYSTGVGLGAEIVGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>gb|ACV70047.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=224

 Score =   185 bits (470),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLVKAFQ+AY+++YGGGAN L  GY++GTGL AEIIGTFVLVYTVF+A
Sbjct  113  MIAQCLGAICGCGLVKAFQRAYYSKYGGGANGLSDGYSRGTGLAAEIIGTFVLVYTVFSA  172

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  173  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  213



>gb|AHY28661.1| aquaporin, membrane intrinsic protein, partial [Pinus echinata]
 gb|AHY28663.1| aquaporin, membrane intrinsic protein, partial [Pinus elliottii]
 gb|AHY28664.1| aquaporin, membrane intrinsic protein, partial [Pinus elliottii]
 gb|AHY28665.1| aquaporin, membrane intrinsic protein, partial [Pinus palustris]
 gb|AHY28667.1| aquaporin, membrane intrinsic protein, partial [Pinus taeda]
Length=104

 Score =   181 bits (459),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLVKAFQK Y++RYGGGAN++  GY KG GL AEIIGTFVLVYTVF+A
Sbjct  2    MIAQCLGAICGAGLVKAFQKPYYDRYGGGANVVAHGYTKGVGLAAEIIGTFVLVYTVFSA  61

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  62   TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  102



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 97/101 (96%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQK+++N++GGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGVGFVKAFQKSHYNKFGGGANTLALGYNKGTGLGAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  186  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  226



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score =   187 bits (475),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+ +YGGGAN L  GYN GTGLGAEIIGTFVLVYTVFAA
Sbjct  135  MLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYNTGTGLGAEIIGTFVLVYTVFAA  194

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  195  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  235



>gb|AAL49752.1|AF452014_1 aquaporin-like protein [Petunia x hybrida]
Length=286

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY++RY GGANML  GY+K  GL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSKSVGLSAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+Y+ RYGGGAN L  G++ GTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQKSYYKRYGGGANTLADGFSTGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>dbj|BAG68661.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQKA++ RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVFAA
Sbjct  132  MVAQCLGAICGVGFVKAFQKAFYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFAA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+ +YGGGAN L  GYN GTGLGAEIIGTFVLVYTVFAA
Sbjct  127  MLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYNTGTGLGAEIIGTFVLVYTVFAA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  227



>ref|NP_001274381.1| aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004145740.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 ref|XP_004169567.1| PREDICTED: aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33480.1| plasma intrinsic protein 2-4 [Cucumis sativus]
 gb|KGN46837.1| hypothetical protein Csa_6G140850 [Cucumis sativus]
Length=283

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQC GAICG GLVKAFQ AY+ RY GGANML  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  127  IIAQCAGAICGCGLVKAFQSAYYVRYNGGANMLSDGYNKGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>ref|XP_002879778.1| PIP2_6/PIP2E [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56037.1| PIP2_6/PIP2E [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA CGVGLVK FQ  Y+NRYGGGANML  GYN G G+GAEIIGTFVLVYTVF+A
Sbjct  128  MVAQCLGATCGVGLVKVFQSTYYNRYGGGANMLSEGYNVGVGVGAEIIGTFVLVYTVFSA  187

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGF+VFMVHLATIPITGTGINP
Sbjct  188  TDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINP  228



>ref|NP_181254.1| aquaporin PIP2-2 [Arabidopsis thaliana]
 sp|P43287.2|PIP22_ARATH RecName: Full=Aquaporin PIP2-2; AltName: Full=Plasma membrane 
intrinsic protein 2-2; Short=AtPIP2;2; AltName: Full=Plasma 
membrane intrinsic protein 2b; Short=PIP2b; AltName: Full=TMP2b; 
Contains: RecName: Full=Aquaporin PIP2-2, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAD18142.1| aquaporin (plasma membrane intrinsic protein 2B) [Arabidopsis 
thaliana]
 gb|AEC09362.1| aquaporin PIP2-2 [Arabidopsis thaliana]
Length=285

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ +Y++RYGGGAN L  GYN GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|AAL16974.1|AF367458_1 membrane intrinsic protein [Prunus persica]
Length=165

 Score =   183 bits (464),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQ LGAICGVGLVKAFQK Y+  YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  45   IVAQSLGAICGVGLVKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSA  104

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  105  TDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINP  145



>ref|XP_009593453.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana tomentosiformis]
Length=283

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY++RY GGANML  GY+ G GL AEIIGTFVLVYTVF+A
Sbjct  125  MVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSHGVGLSAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  225



>dbj|BAG06231.1| plasma membrane intrinsic protein [Hordeum vulgare]
 dbj|BAK01580.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA+CGVGLVKAFQ AYF RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  134  MVAQCLGAMCGVGLVKAFQSAYFVRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  194  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  234



>ref|XP_004493972.1| PREDICTED: probable aquaporin PIP2-5-like [Cicer arietinum]
Length=287

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+ QCLGAICGVGLVK FQK+Y+NRY GGANML  GY+KGTGLGAEIIGTF LVYTVF+A
Sbjct  129  MVVQCLGAICGVGLVKGFQKSYYNRYKGGANMLSNGYSKGTGLGAEIIGTFFLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFVVHLATIPITGTGINP  229



>emb|CDY31523.1| BnaA10g13480D [Brassica napus]
Length=260

 Score =   186 bits (471),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+ RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  104  IVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  163

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  164  TDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  204



>gb|ADG03686.1| aquaporin [Hordeum vulgare]
Length=290

 Score =   187 bits (474),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA+CGVGLVKAFQ AYF RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  134  MVAQCLGAMCGVGLVKAFQSAYFVRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  194  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  234



>tpg|DAA64687.1| TPA_exp: aquaporin PIP2 10 [Nicotiana tabacum]
Length=283

 Score =   186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY++RY GGANML  GY+ G GL AEIIGTFVLVYTVF+A
Sbjct  125  MVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSHGVGLSAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  225



>ref|XP_006294722.1| hypothetical protein CARUB_v10023768mg [Capsella rubella]
 gb|EOA27620.1| hypothetical protein CARUB_v10023768mg [Capsella rubella]
Length=290

 Score =   187 bits (474),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA CGVGLVK FQ  Y+NRYGGGANML  GYN G G+GAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGATCGVGLVKVFQSTYYNRYGGGANMLSDGYNVGVGVGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGF+VFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINP  229



>ref|NP_181434.1| plasma membrane intrinsic protein 2E [Arabidopsis thaliana]
 sp|Q9ZV07.1|PIP26_ARATH RecName: Full=Probable aquaporin PIP2-6; AltName: Full=Plasma 
membrane intrinsic protein 2-6; Short=AtPIP2;6; AltName: Full=Plasma 
membrane intrinsic protein 2e; Short=PIP2e; Contains: 
RecName: Full=Probable aquaporin PIP2-6, N-terminally processed 
[Arabidopsis thaliana]
 gb|AAC79629.1| putative aquaporin (water channel protein) [Arabidopsis thaliana]
 gb|AAK74048.1| At2g39010/T7F6.18 [Arabidopsis thaliana]
 gb|AAL06803.1| At2g39010/T7F6.18 [Arabidopsis thaliana]
 gb|AAL09798.1| At2g39010/T7F6.18 [Arabidopsis thaliana]
 gb|AEC09626.1| plasma membrane intrinsic protein 2E [Arabidopsis thaliana]
Length=289

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA CGVGLVK FQ  Y+NRYGGGANML  GYN G G+GAEIIGTFVLVYTVF+A
Sbjct  128  MVAQCLGATCGVGLVKVFQSTYYNRYGGGANMLSDGYNVGVGVGAEIIGTFVLVYTVFSA  187

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGF+VFMVHLATIPITGTGINP
Sbjct  188  TDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINP  228



>emb|CDX71032.1| BnaC03g11160D [Brassica napus]
Length=260

 Score =   186 bits (471),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+ RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  104  IVAQCLGAICGCGLVKAFQSSYYTRYGGGANQLADGYNKGTGLGAEIIGTFVLVYTVFSA  163

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  164  TDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  204



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   187 bits (474),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+ RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  141  IVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  200

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  201  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  241



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+Y+ RYGGGAN L  GYN G GLGAEIIGTFVLVYTVF+A
Sbjct  130  MVAQCLGAICGVGLVKAFQKSYYVRYGGGANTLAHGYNTGVGLGAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  230



>ref|XP_002866389.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42648.1| hypothetical protein ARALYDRAFT_919301 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+ RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  IVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   186 bits (473),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/101 (90%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+ +YGGGAN L  GY+ GTGLGAEIIGTFVLVYTVFAA
Sbjct  135  MLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSSGTGLGAEIIGTFVLVYTVFAA  194

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  195  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  235



>ref|XP_002879655.1| aquaporin [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55914.1| aquaporin [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score =   186 bits (471),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ +Y+ RYGGGAN L  GYN GTGL AEIIGTFVLVYTVF+A
Sbjct  103  MVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSA  162

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  163  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  203



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   186 bits (472),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQ+AY+ RYGGGAN L  GY+KG GLGAEI+GTFVLVYTVF+A
Sbjct  128  MVAQCLGAICGCGLVKAFQRAYYTRYGGGANELADGYSKGVGLGAEIVGTFVLVYTVFSA  187

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  188  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  228



>ref|XP_006648854.1| PREDICTED: probable aquaporin PIP2-2-like [Oryza brachyantha]
Length=262

 Score =   185 bits (470),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVK FQ +Y+ RYGGGAN L  GY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  107  IVAQCLGAICGVGLVKGFQSSYYVRYGGGANELSSGYSKGTGLGAEIIGTFVLVYTVFSA  166

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  167  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  207



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   186 bits (472),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLVK FQKAY+ RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  130  MIAQCLGAICGAGLVKGFQKAYYVRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  190  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  230



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score =   186 bits (472),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+ RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  IVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>ref|XP_010509080.1| PREDICTED: probable aquaporin PIP2-6 [Camelina sativa]
Length=290

 Score =   186 bits (472),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGA CGVGLVK FQ  Y+NRYGGGANML  GYN G G+GAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGATCGVGLVKLFQSTYYNRYGGGANMLSDGYNVGVGVGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGF+VFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINP  229



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+N+YGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  132  MVAQCLGAICGVGFVKAFQSAYYNKYGGGANELSVGYSKGTGLAAEIIGTFVLVYTVFSA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVK FQ AY+ RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  133  IIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSA  192

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  193  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  233



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M AQCLGA+CG GLVKAFQKAY+++YGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  129  MAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>gb|KFK36606.1| hypothetical protein AALP_AA4G145300 [Arabis alpina]
Length=284

 Score =   186 bits (471),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ +Y+ RYGGGAN L  GYN GTGL AEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  186  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  226



>gb|ABK93567.1| unknown [Populus trichocarpa]
Length=285

 Score =   186 bits (471),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+Y+ +YGGGAN L  G++ GTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQKSYYKKYGGGANTLADGFSTGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGV LVKAFQ +Y+  YGGGAN L PGY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   186 bits (472),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M AQCLGA+CG GLVKAFQKAY+++YGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  129  MAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>ref|XP_010516975.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   186 bits (471),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+ RYGGGAN L  GYN GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|KHG20375.1| putative aquaporin PIP2-5 -like protein [Gossypium arboreum]
Length=282

 Score =   186 bits (471),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQ LGAICGVGLVKAFQ AY+NRYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  124  MVAQSLGAICGVGLVKAFQSAYYNRYGGGANTLADGYSTGTGLGAEIIGTFVLVYTVFSA  183

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  184  TDPKRKARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  224



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   186 bits (471),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+Y+ +YGGGAN L  G++ GTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQKSYYKKYGGGANTLADGFSTGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>ref|NP_200874.1| putative aquaporin PIP2-4 [Arabidopsis thaliana]
 sp|Q9FF53.1|PIP24_ARATH RecName: Full=Probable aquaporin PIP2-4; AltName: Full=Plasma 
membrane intrinsic protein 2.4; Short=AtPIP2;4; Contains: RecName: 
Full=Probable aquaporin PIP2-4, N-terminally processed 
[Arabidopsis thaliana]
 dbj|BAB09839.1| water channel protein [Arabidopsis thaliana]
 gb|AAM64801.1| mipC protein-like (aquaporin) [Arabidopsis thaliana]
 dbj|BAF00622.1| mipC protein - like [Arabidopsis thaliana]
 gb|AED97364.1| putative aquaporin PIP2-4 [Arabidopsis thaliana]
Length=291

 Score =   186 bits (471),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG G VKAFQ +Y+ RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  IVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>gb|ACV70050.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=224

 Score =   184 bits (466),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLVKAFQ+AY++R+GGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  113  MIAQCLGAICGCGLVKAFQRAYYSRFGGGANELALGYSKGTGLAAEIIGTFVLVYTVFSA  172

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP TGTGINP
Sbjct  173  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPTTGTGINP  213



>ref|XP_006481459.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   186 bits (471),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+ RYGGGAN L  GY+ G GLGAEIIGTFVLVYTVF+A
Sbjct  129  MVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>gb|AGR83939.1| aquaporin PIP2-2, partial [Brassica napus]
Length=196

 Score =   183 bits (464),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+ RYGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  90   MVAQCLGAICGVGFVKAFQSAYYVRYGGGANPLADGYSTGTGLAAEIIGTFVLVYTVFSA  149

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  150  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  190



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   186 bits (471),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+NRYGGGAN L  GYNKGTGLGAEIIGTFVLVY VFAA
Sbjct  127  IVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLAEGYNKGTGLGAEIIGTFVLVYPVFAA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFA FMVHLATIPITGTGINP
Sbjct  187  TDPKRSARDSHIPVLAPLPIGFAAFMVHLATIPITGTGINP  227



>gb|ABK23750.1| unknown [Picea sitchensis]
Length=282

 Score =   186 bits (471),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLV+AFQK++++RYGGGAN + PGY KG GL AEIIGTFVLVYTVF+A
Sbjct  124  MIAQCLGAICGAGLVEAFQKSFYDRYGGGANFVHPGYTKGVGLAAEIIGTFVLVYTVFSA  183

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  184  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  224



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   186 bits (471),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+  YGGGAN L  G++KGTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>dbj|BAD90700.1| plasma membrane intrinsic protein 2;4 [Mimosa pudica]
Length=281

 Score =   185 bits (470),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQKA++NRYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  123  IVAQCLGAICGCGLVKAFQKAFYNRYGGGANTLSTGYSSGTGLGAEIIGTFVLVYTVFSA  182

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHL TIPITGTGINP
Sbjct  183  TDPKRNARDSHVPVLAPLPIGFAVFMVHLTTIPITGTGINP  223



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   186 bits (471),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+  YGGGAN L  G++KGTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score =   186 bits (471),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVK FQ AY+ RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  134  IVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  194  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  234



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   186 bits (471),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+ +YGGG N L  G++KGTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGCGLVKAFQKSYYTKYGGGVNELATGFSKGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|ACV70048.1| aquaporin PIP2;1, partial [Quercus macrocarpa]
Length=224

 Score =   184 bits (466),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLVKAFQ+AY+++YGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  113  MIAQCLGAICGCGLVKAFQRAYYSKYGGGANGLSDGYSKGTGLAAEIIGTFVLVYTVFSA  172

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATI ITGTGINP
Sbjct  173  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATISITGTGINP  213



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score =   186 bits (471),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVK FQ AYF RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  133  IIAQCLGAICGVGLVKGFQSAYFVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSA  192

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  193  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  233



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   186 bits (471),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQKAY+ +YGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  130  IVAQCLGAICGVGLVKAFQKAYYTKYGGGANTLGDGYSVGTGLGAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  190  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  230



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLVK FQKAY+ RYGGGAN L  GY++GTGL AEIIGTFVLVYTVF+A
Sbjct  132  MIAQCLGAICGAGLVKGFQKAYYVRYGGGANELSSGYSRGTGLAAEIIGTFVLVYTVFSA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>ref|XP_003591906.1| Aquaporin PIP [Medicago truncatula]
 gb|AES62157.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=193

 Score =   182 bits (463),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAI GVGLVKAFQ AYF+RYGGGAN L  GY+ G GLGAEI+GTFVLVYTVF+A
Sbjct  63   MVAQCLGAIAGVGLVKAFQSAYFDRYGGGANFLHDGYSTGVGLGAEIVGTFVLVYTVFSA  122

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  123  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  163



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLV+ FQKAY+ RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  132  MIAQCLGAICGAGLVRGFQKAYYVRYGGGANELSSGYSKGTGLAAEIIGTFVLVYTVFSA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>emb|CDY53629.1| BnaC09g53920D [Brassica napus]
Length=259

 Score =   184 bits (468),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQ +Y+ RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  104  IVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  163

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFAVFMVH+ATIPITGTGINP
Sbjct  164  TDPKRSARDSHIPVLAPLPIGFAVFMVHVATIPITGTGINP  204



>ref|XP_003575410.1| PREDICTED: aquaporin PIP2-4 [Brachypodium distachyon]
Length=288

 Score =   185 bits (470),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVK FQ AY+ RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  133  IVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSA  192

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  193  TDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  233



>gb|AAK71313.1|AF388171_1 plasma membrane intrinsic protein 2 [Triticum monococcum subsp. 
aegilopoides]
Length=137

 Score =   180 bits (457),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVK F+ +Y+ RYGGGA+ L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  18   IIAQCLGAICGVGLVKGFRSSYYVRYGGGADELSAGYSKGTGLAAEIIGTFVLVYTVFSA  77

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  78   TDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  118



>ref|XP_010553324.1| PREDICTED: aquaporin PIP2-2 [Tarenaya hassleriana]
Length=198

 Score =   182 bits (462),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVK+FQ   ++RYGGGAN L  GY++GTGL AEIIGTFVLVYTVF+A
Sbjct  40   MVAQCLGAICGVGLVKSFQSGRYDRYGGGANSLADGYSEGTGLAAEIIGTFVLVYTVFSA  99

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  100  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  140



>ref|XP_010042277.1| PREDICTED: aquaporin PIP2-1-like [Eucalyptus grandis]
Length=257

 Score =   184 bits (467),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKA + RYGGGAN L  GY+KG GLGAEIIGTFVLVYTVF+A
Sbjct  101  MVAQCLGAICGCGLVKAFQKARYTRYGGGANELSDGYSKGVGLGAEIIGTFVLVYTVFSA  160

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  161  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  201



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKAY+ +YGGGAN L  GY+ GTGLGAEIIGTFVLVYTVFAA
Sbjct  127  MLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLVYTVFAA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  227



>ref|XP_003580150.1| PREDICTED: aquaporin PIP2-5 [Brachypodium distachyon]
Length=287

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVK FQ AYF RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  130  MVAQCLGAICGVGLVKGFQSAYFVRYGGGANGLSAGYSKGTGLAAEIIGTFVLVYTVFSA  189

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  190  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  230



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MI QCLGAICGVGLVK FQKA+F RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  132  MIGQCLGAICGVGLVKGFQKAFFVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>ref|XP_006410896.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
 gb|ESQ52349.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
Length=284

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ +Y+ RYGGGAN L  GYN GTGL AEIIGTFVLVYTVF+A
Sbjct  126  MVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSA  185

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  186  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  226



>ref|XP_007205689.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
 gb|EMJ06888.1| hypothetical protein PRUPE_ppa009689mg [Prunus persica]
Length=281

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQ LGAICGVGLVKAFQK Y+  YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  125  IVAQSLGAICGVGLVKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINP  225



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG G VKAFQ +Y+ RYGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  IVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>ref|XP_007009830.1| Plasma membrane intrinsic protein 2A [Theobroma cacao]
 gb|EOY18640.1| Plasma membrane intrinsic protein 2A [Theobroma cacao]
Length=281

 Score =   185 bits (469),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQ LGAICGVGLVKAFQK+++NRYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  123  MVAQSLGAICGVGLVKAFQKSFYNRYGGGANTLSDGYSTGTGLGAEIIGTFVLVYTVFSA  182

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  183  TDPKRKARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  223



>ref|XP_010043747.1| PREDICTED: probable aquaporin PIP2-5 [Eucalyptus grandis]
 gb|KCW85738.1| hypothetical protein EUGRSUZ_B02500 [Eucalyptus grandis]
Length=284

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQKA + RYGGGAN L  GY+KG GLGAEIIGTFVLVYTVF+A
Sbjct  128  MVAQCLGAICGCGLVKAFQKARYTRYGGGANELSDGYSKGVGLGAEIIGTFVLVYTVFSA  187

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  188  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  228



>emb|CAH60723.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+Y+ +YGGGAN L  G++ GTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQKSYYKKYGGGANTLADGFSIGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQK+Y+ ++GGGAN L  GYNKGTGL AEIIGTFVLVYTVF+A
Sbjct  125  MVAQCLGAICGVGFVKAFQKSYYVKFGGGANELADGYNKGTGLAAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  185  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  225



>gb|AEA40497.1| aquaporin PIP2-1 [Brassica oleracea var. italica]
Length=155

 Score =   181 bits (458),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ +Y+ RYGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  34   MVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSA  93

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  94   TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  134



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVK FQK ++N+ GGGAN L PGYNKG GLGAEIIGTFVLVYTVF+A
Sbjct  128  MVAQCLGAICGVGLVKGFQKTHYNQNGGGANELAPGYNKGVGLGAEIIGTFVLVYTVFSA  187

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  188  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  228



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVK FQ AY+ RYGGGAN++ PG+ KG GL AEIIGTFVLVYTVF+A
Sbjct  131  MVAQCLGAICGVGLVKGFQSAYYVRYGGGANVMAPGHTKGVGLAAEIIGTFVLVYTVFSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>ref|XP_002881493.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57752.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ +Y+ RYGGGAN L  GYN GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M AQCLGAICG GLVKAFQK+Y+N+YGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|AAC16545.1| aquaporin [Oryza sativa]
Length=290

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLV AF  AYFNRYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  134  IVAQCLGAICGVGLVNAFPNAYFNRYGGGANTLAAGYSKGTGLAAEIIGTFVLVYTVFSA  193

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  194  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  234



>gb|AEQ20672.1| PIP2;1 [Karelinia caspia]
Length=284

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK Y+ +YGGGAN L  GY+ GTGLGAEI+GTFVLVYTVF+A
Sbjct  128  MVAQCLGAICGCGLVKAFQKTYYTKYGGGANELADGYSNGTGLGAEIVGTFVLVYTVFSA  187

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  188  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  228



>ref|XP_006294744.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
 gb|EOA27642.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
Length=285

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ +Y+ RYGGGAN L  GYN GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>ref|XP_010505293.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
 ref|XP_010509372.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
Length=285

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ +Y+ RYGGGAN L  GYN GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   185 bits (469),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+ RYGGGAN++ PG+ KG GL AEIIGTFVLVYTVF+A
Sbjct  131  MVAQCLGAICGVGFVKAFQSAYYVRYGGGANVMAPGHTKGVGLAAEIIGTFVLVYTVFSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  191  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  231



>gb|ACN76554.1| putative plasma membrane intrinsic protein PIP family member 
2 aquaporin [Ceiba pentandra]
Length=145

 Score =   180 bits (457),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M AQCLGAICG GLVKAFQK+Y+ +YGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  26   MAAQCLGAICGCGLVKAFQKSYYXQYGGGANSLAEGYSTGTGLAAEIIGTFVLVYTVFSA  85

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  86   TDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  126



>emb|CDP04351.1| unnamed protein product [Coffea canephora]
Length=199

 Score =   182 bits (461),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/101 (84%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQC+GAICGVGLVKAFQ++Y+  YGGGAN LQ GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  40   MVAQCVGAICGVGLVKAFQRSYYVTYGGGANQLQDGYSTGTGLAAEIIGTFVLVYTVFSA  99

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVP+LAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  100  TDPKRSARDSHVPILAPLPIGFAVFMVHLATIPVTGTGINP  140



>ref|XP_010325988.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=269

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQKAY+ +YGGGAN L  GY+ GTGLGAEIIGTFVLVYTVFAA
Sbjct  113  IVAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLVYTVFAA  172

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  173  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  213



>gb|ACV70052.1| aquaporin PIP2;1 [Quercus macrocarpa]
Length=224

 Score =   183 bits (464),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLVKAFQ+AY++R+GGGAN L   Y+KGTGL AEIIGTFVLVYTVF+A
Sbjct  113  MIAQCLGAICGCGLVKAFQRAYYSRFGGGANELALRYSKGTGLAAEIIGTFVLVYTVFSA  172

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  173  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  213



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGAICG GLVKAFQK+Y+ RYGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  129  MIAQCLGAICGCGLVKAFQKSYYVRYGGGANELATGYSTGTGLAAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  189  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  229



>ref|XP_004496281.1| PREDICTED: aquaporin PIP2-1-like [Cicer arietinum]
Length=287

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGVGLVKAFQ AYF+RYGGGAN L  GY+ G GLGAEI+GTFVLVYTVF+A
Sbjct  129  IVAQCLGAICGVGLVKAFQSAYFDRYGGGANFLHDGYSTGVGLGAEIVGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>emb|CAE53876.1| putative aquaporin [Ricinus communis]
Length=151

 Score =   180 bits (457),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ +++ RYGGGAN L   Y+ G GLGAEIIGTFVLVYTVF+A
Sbjct  25   MVAQCLGAICGVGLVKAFQSSHYKRYGGGANTLDDNYSTGVGLGAEIIGTFVLVYTVFSA  84

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  85   TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  125



>ref|XP_010325989.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=259

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQKAY+ +YGGGAN L  GY+ GTGLGAEIIGTFVLVYTVFAA
Sbjct  113  IVAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLVYTVFAA  172

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  173  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  213



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M AQCLGAICG GLVKAFQK+Y+N+YGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+ RYGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 96/101 (95%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQK+Y+ +Y GGAN+L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGLVKAFQKSYYTKYQGGANILADGYSTGTGLGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>ref|XP_009133124.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
 gb|AAD39374.1|AF118383_1 plasma membrane intrinsic protein 2 [Brassica napus]
 emb|CDY46758.1| BnaA03g17020D [Brassica napus]
Length=283

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+ RYGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+ RYGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVK FQ +Y+ RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  132  IIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>emb|CDX91340.1| BnaC04g08100D [Brassica napus]
Length=285

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+ RYGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>ref|XP_003591907.1| Aquaporin PIP [Medicago truncatula]
 gb|AES62158.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=221

 Score =   182 bits (463),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAI GVGLVKAFQ AYF+RYGGGAN L  GY+ G GLGAEI+GTFVLVYTVF+A
Sbjct  63   MVAQCLGAIAGVGLVKAFQSAYFDRYGGGANFLHDGYSTGVGLGAEIVGTFVLVYTVFSA  122

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  123  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  163



>ref|XP_006367014.1| PREDICTED: aquaporin PIP2-1-like, partial [Solanum tuberosum]
Length=279

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVK FQKAY+ +YGGGANML  GY+ GTGLGAEIIGTFVLVYTVFAA
Sbjct  123  IVAQCLGAICGCGLVKCFQKAYYVKYGGGANMLNDGYSTGTGLGAEIIGTFVLVYTVFAA  182

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  183  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  223



>ref|XP_009772697.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana sylvestris]
Length=283

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVGLVKAFQ AY++RY GGANML   Y+ G GL AEIIGTFVLVYTVF+A
Sbjct  125  MVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDDYSHGVGLSAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  225



>ref|NP_001289823.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18626.1| plasmamembrane intrinsic protein 2;1 [Solanum lycopersicum]
Length=279

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICG GLVKAFQKAY+ +YGGGAN L  GY+ GTGLGAEIIGTFVLVYTVFAA
Sbjct  123  IVAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLVYTVFAA  182

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  183  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  223



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/101 (89%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQ LGAICGVGLVKAFQK Y+  YGGGAN L  GYNKGTGLGAEIIGTFVLVYTVF+A
Sbjct  125  IIAQSLGAICGVGLVKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGTFVLVYTVFSA  184

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  185  TDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINP  225



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQK+Y+ +YGGGAN L  G++KGT LGAEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGCGLVKAFQKSYYTKYGGGANGLASGFSKGTALGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICG GLVKAFQ+AY+ RYGGGAN L  GY+ GTGLGAEIIGTFVLVYTVF+A
Sbjct  131  MVAQCLGAICGCGLVKAFQRAYYVRYGGGANGLSDGYSTGTGLGAEIIGTFVLVYTVFSA  190

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  191  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  231



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGAICGV LVKAFQ +Y+  YGGGAN L PGY+KGTGLGAEIIGTFVLVYTVF+A
Sbjct  129  IVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSKGTGLGAEIIGTFVLVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  189  TDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  229



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVK FQ +Y+ RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  132  IIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>ref|NP_001234625.1| aquaporin [Solanum lycopersicum]
 gb|ADU34070.1| aquaporin [Solanum lycopersicum]
 dbj|BAO18627.1| plasmamembrane intrinsic protein 2;4 [Solanum lycopersicum]
Length=280

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+NRYGGG N++  G++KG GLGAEIIGTFVLVYTVF+A
Sbjct  124  MVAQCLGAICGVGFVKAFQSAYYNRYGGGVNVMAGGHSKGVGLGAEIIGTFVLVYTVFSA  183

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINP
Sbjct  184  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINP  224



>ref|NP_001288933.1| probable aquaporin PIP2-6 [Brassica rapa]
 gb|ABL97985.1| water channel protein [Brassica rapa]
 emb|CDY07681.1| BnaA03g18300D [Brassica napus]
Length=288

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGA CGVGLVK FQK Y+NRYGGGAN+L  GYN G G+GAEIIGTFVLVYTVF+A
Sbjct  127  IVAQCLGATCGVGLVKVFQKTYYNRYGGGANVLADGYNVGVGVGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGF+VFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINP  227



>emb|CDY46759.1| BnaA03g17030D [Brassica napus]
Length=285

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+ RYGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            +IAQCLGAICGVGLVK FQ +Y+ RYGGGAN L  GY+KGTGL AEIIGTFVLVYTVF+A
Sbjct  132  IIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSA  191

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  192  TDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINP  232



>emb|CDY14415.1| BnaC03g21800D [Brassica napus]
Length=288

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            ++AQCLGA CGVGLVK FQK Y+NRYGGGAN+L  GYN G G+GAEIIGTFVLVYTVF+A
Sbjct  127  IVAQCLGATCGVGLVKVFQKTYYNRYGGGANVLADGYNVGVGVGAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSH+PVLAPLPIGF+VFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHIPVLAPLPIGFSVFMVHLATIPITGTGINP  227



>ref|XP_009133125.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
Length=285

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQCLGAICGVG VKAFQ AY+ RYGGGAN L  GY+ GTGL AEIIGTFVLVYTVF+A
Sbjct  127  MVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSA  186

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP
Sbjct  187  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  227



>gb|AAL16976.1|AF367460_1 membrane intrinsic protein [Prunus persica]
Length=165

 Score =   180 bits (457),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            M+AQ LGAICGVGLVKAFQ AYF +YGGGAN L  GY++GTGL AEIIGTFVLVYTVF+A
Sbjct  45   MVAQSLGAICGVGLVKAFQNAYFTKYGGGANGLADGYSQGTGLAAEIIGTFVLVYTVFSA  104

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINP
Sbjct  105  TDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINP  145



>ref|XP_008446888.1| PREDICTED: aquaporin PIP2-1-like [Cucumis melo]
Length=287

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/101 (86%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +2

Query  2    MIAQCLGAICGVGLVKAFQKAYFNRYGGGANMLQPGYNKGTGLGAEIIGTFVLVYTVFAA  181
            MIAQCLGA+CG GLVKAFQK+Y+N+YGGGAN L  GY+KGTGLGAEI+GTF+LVYTVF+A
Sbjct  129  MIAQCLGAVCGAGLVKAFQKSYYNKYGGGANQLAHGYSKGTGLGAEIVGTFILVYTVFSA  188

Query  182  TDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINP  304
            TD KRNARDSHVPVLAPLPIGFAVFMVHLATIPITGT INP
Sbjct  189  TDSKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTSINP  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517403453504