BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10194_g1_i1 len=1468 path=[1:0-775 777:776-1467]

Length=1468
                                                                      Score     E

ref|XP_009600090.1|  PREDICTED: uncharacterized protein LOC104095632    280   1e-86   
ref|XP_009766294.1|  PREDICTED: protein NLP2                            276   3e-85   
ref|XP_004251823.1|  PREDICTED: protein NLP7                            246   1e-73   
ref|XP_006350003.1|  PREDICTED: uncharacterized protein LOC102590780    243   1e-72   
emb|CDP06158.1|  unnamed protein product                                223   7e-65   
ref|XP_010241340.1|  PREDICTED: uncharacterized protein LOC104585...    195   1e-54   
ref|XP_010241339.1|  PREDICTED: uncharacterized protein LOC104585...    191   5e-53   
ref|XP_006437156.1|  hypothetical protein CICLE_v10032332mg             190   1e-52   
gb|KDO60981.1|  hypothetical protein CISIN_1g023462mg                   187   2e-51   
gb|EYU30285.1|  hypothetical protein MIMGU_mgv1a010586mg                182   4e-49   
gb|EYU30286.1|  hypothetical protein MIMGU_mgv1a010586mg                180   1e-48   
ref|XP_010657121.1|  PREDICTED: protein NLP3                            177   9e-48   
ref|XP_011026245.1|  PREDICTED: uncharacterized protein LOC105126913    169   1e-44   
gb|ABK96557.1|  unknown                                                 167   3e-44   Populus trichocarpa x Populus deltoides
ref|XP_002300875.1|  hypothetical protein POPTR_0002s05980g             166   1e-43   Populus trichocarpa [western balsam poplar]
ref|XP_008784393.1|  PREDICTED: uncharacterized protein LOC103703346    166   3e-43   
ref|XP_007048879.1|  Uncharacterized protein isoform 2                  164   4e-43   
gb|KHG11867.1|  Protein NLP2                                            163   1e-42   
ref|XP_007048878.1|  Uncharacterized protein isoform 1                  163   1e-42   
ref|XP_010916090.1|  PREDICTED: uncharacterized protein LOC105041...    159   2e-40   
ref|XP_011082903.1|  PREDICTED: uncharacterized protein LOC105165548    156   5e-39   
ref|XP_010904856.1|  PREDICTED: uncharacterized protein LOC105032179    151   9e-38   
ref|XP_010673598.1|  PREDICTED: protein NLP9                            147   1e-36   
ref|XP_010916091.1|  PREDICTED: uncharacterized protein LOC105041...    146   5e-36   
gb|KDO60982.1|  hypothetical protein CISIN_1g023462mg                   142   3e-35   
ref|XP_009421485.1|  PREDICTED: uncharacterized protein LOC104001033    142   9e-35   
ref|XP_006857943.1|  hypothetical protein AMTR_s00069p00159620          139   9e-34   
emb|CDM82463.1|  unnamed protein product                                129   4e-30   
dbj|BAK02178.1|  predicted protein                                      125   9e-29   
ref|NP_001140342.1|  uncharacterized protein LOC100272390               123   3e-28   Zea mays [maize]
ref|XP_002454862.1|  hypothetical protein SORBIDRAFT_03g000260          123   3e-28   Sorghum bicolor [broomcorn]
ref|XP_004967322.1|  PREDICTED: uncharacterized protein LOC101771632    122   5e-28   
ref|XP_010230688.1|  PREDICTED: uncharacterized protein LOC104582530    122   6e-28   
ref|XP_004986052.1|  PREDICTED: uncharacterized protein LOC101760145    121   8e-28   
dbj|BAB40070.1|  unknown protein                                        117   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042575.1|  Os01g0246500                                       117   4e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009377316.1|  PREDICTED: uncharacterized protein LOC103965934    114   5e-26   
ref|XP_008229431.1|  PREDICTED: uncharacterized protein LOC103328797    113   8e-26   
ref|XP_007215066.1|  hypothetical protein PRUPE_ppa012313mg             113   9e-26   
ref|XP_006643988.1|  PREDICTED: protein NLP2-like                       115   1e-25   
ref|XP_008366561.1|  PREDICTED: uncharacterized protein LOC103430202    112   2e-25   
ref|XP_004303879.1|  PREDICTED: uncharacterized protein LOC101310432    103   4e-22   
ref|XP_004303880.1|  PREDICTED: uncharacterized protein LOC101310720    102   6e-22   
emb|CAN71458.1|  hypothetical protein VITISV_007604                     102   8e-21   Vitis vinifera
ref|XP_004499986.1|  PREDICTED: uncharacterized protein LOC101501187  97.1    8e-20   
ref|XP_003599832.1|  hypothetical protein MTR_3g047590                92.4    4e-18   
ref|XP_007146340.1|  hypothetical protein PHAVU_006G032200g           89.4    5e-17   
ref|XP_010102141.1|  hypothetical protein L484_021375                 87.8    9e-17   
gb|KHM99633.1|  hypothetical protein glysoja_006476                   88.2    1e-16   
gb|KHN18087.1|  hypothetical protein glysoja_020860                   86.3    4e-16   
ref|NP_001237234.1|  uncharacterized protein LOC100305825             84.7    2e-15   
gb|ACU23660.1|  unknown                                               84.0    3e-15   Glycine max [soybeans]
gb|EPS61740.1|  hypothetical protein M569_13055                       80.9    1e-14   
gb|EEE54228.1|  hypothetical protein OsJ_01090                        82.4    9e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70306.1|  hypothetical protein OsI_01152                        82.0    1e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_010558869.1|  PREDICTED: uncharacterized protein LOC104827393  77.8    1e-13   
ref|XP_010522076.1|  PREDICTED: uncharacterized protein LOC104800828  78.6    2e-13   
gb|EMT19303.1|  hypothetical protein F775_29714                       80.9    2e-13   
ref|XP_010053713.1|  PREDICTED: uncharacterized protein LOC104442101  77.4    7e-13   
gb|EPS61739.1|  hypothetical protein M569_13054                       74.7    1e-12   
gb|AAM66040.1|  unknown                                               75.1    2e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305857.1|  hypothetical protein CARUB_v10010938mg           74.3    4e-12   
ref|XP_006417910.1|  hypothetical protein EUTSA_v10009066mg           73.9    5e-12   
ref|NP_563767.1|  uncharacterized protein                             73.6    7e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889607.1|  hypothetical protein ARALYDRAFT_887853           71.6    3e-11   
ref|XP_008224437.1|  PREDICTED: uncharacterized protein LOC103324172  69.3    1e-10   
ref|XP_009118534.1|  PREDICTED: uncharacterized protein LOC103843549  68.2    4e-10   
ref|XP_008782173.1|  PREDICTED: uncharacterized protein LOC103701776  70.1    5e-10   
emb|CDY06215.1|  BnaA09g49880D                                        72.4    6e-10   
emb|CDY09971.1|  BnaC08g44800D                                        72.0    7e-10   
gb|KCW89745.1|  hypothetical protein EUGRSUZ_A02009                   67.4    8e-10   
ref|XP_010457777.1|  PREDICTED: uncharacterized protein LOC104739201  66.2    2e-09   
gb|KCW89736.1|  hypothetical protein EUGRSUZ_A01996                   65.5    4e-09   
ref|XP_004354403.1|  RWP-RK domain-containing protein                 68.2    7e-09   
gb|ETM03614.1|  hypothetical protein L917_00190                       67.4    1e-08   
gb|ETK97221.1|  hypothetical protein L915_00204                       67.4    1e-08   
gb|ETO86206.1|  hypothetical protein F444_00232                       67.4    1e-08   
gb|ETM56891.1|  hypothetical protein L914_00208                       67.4    1e-08   
gb|ETI57473.1|  hypothetical protein F443_00237                       67.4    1e-08   
ref|XP_008889809.1|  hypothetical protein PPTG_00191                  67.4    1e-08   
ref|XP_641205.1|  RWP-RK domain-containing protein                    67.8    1e-08   Dictyostelium discoideum AX4
gb|EFA82378.1|  RWP-RK domain-containing protein                      67.0    1e-08   Heterostelium album PN500
gb|ETP55204.1|  hypothetical protein F442_00221                       67.0    1e-08   
dbj|GAM24412.1|  hypothetical protein SAMD00019534_075870             66.2    2e-08   
ref|XP_002502534.1|  predicted protein                                64.3    8e-08   Micromonas commoda
ref|XP_003057382.1|  predicted protein                                64.3    8e-08   
gb|EMS61885.1|  hypothetical protein TRIUR3_23546                     63.5    9e-08   
dbj|GAM22434.1|  hypothetical protein SAMD00019534_056090             62.8    4e-07   
ref|XP_010486206.1|  PREDICTED: uncharacterized protein LOC104764379  59.3    5e-07   
ref|XP_005717816.1|  unnamed protein product                          62.4    7e-07   
gb|EFA76212.1|  RWP-RK domain-containing protein                      61.6    7e-07   Heterostelium album PN500
ref|XP_007514864.1|  predicted protein                                62.0    7e-07   
emb|CCI45050.1|  unnamed protein product                              60.1    7e-07   
gb|ETP28319.1|  hypothetical protein F442_22389                       61.6    1e-06   
ref|XP_008914339.1|  hypothetical protein PPTG_18030                  61.6    1e-06   
gb|ETM33281.1|  hypothetical protein L914_19468                       61.6    1e-06   
gb|ETP02806.1|  hypothetical protein F441_20141                       61.2    1e-06   
gb|ETK73336.1|  hypothetical protein L915_19697                       61.2    1e-06   
gb|ETI33004.1|  hypothetical protein F443_20250                       61.2    1e-06   
gb|ETL26802.1|  hypothetical protein L916_19581                       61.2    1e-06   
ref|XP_002900056.1|  conserved hypothetical protein                   61.2    1e-06   
ref|XP_009525604.1|  hypothetical protein PHYSODRAFT_350997           60.8    1e-06   
ref|XP_002998004.1|  RWP-RK domain-containing protein, putative       58.5    1e-06   
gb|KFK25847.1|  hypothetical protein AALP_AA8G169800                  60.8    1e-06   
ref|XP_004357755.1|  RWP-RK domain-containing protein                 60.8    1e-06   
dbj|GAM17518.1|  hypothetical protein SAMD00019534_006930             60.1    2e-06   
ref|XP_008222900.1|  PREDICTED: uncharacterized protein LOC103322753  57.8    2e-06   
ref|XP_005817959.1|  hypothetical protein GUITHDRAFT_83535            56.2    2e-06   
ref|XP_004341064.1|  RWPRK domain containing protein                  60.5    2e-06   
ref|XP_005826185.1|  hypothetical protein GUITHDRAFT_49500            55.8    2e-06   
emb|CCA16609.1|  conserved hypothetical protein                       58.2    2e-06   
emb|CCI46796.1|  unnamed protein product                              57.8    3e-06   
ref|XP_003287352.1|  hypothetical protein DICPUDRAFT_78210            59.7    3e-06   
ref|XP_008872070.1|  hypothetical protein H310_08186                  59.7    3e-06   
ref|XP_006646856.1|  PREDICTED: protein NLP3-like                     58.5    4e-06   
ref|XP_002971900.1|  hypothetical protein SELMODRAFT_73105            55.1    4e-06   
ref|XP_009532818.1|  hypothetical protein PHYSODRAFT_317537           57.4    4e-06   
ref|XP_010912806.1|  PREDICTED: uncharacterized protein LOC105038636  58.5    6e-06   
ref|XP_002983687.1|  hypothetical protein SELMODRAFT_118783           54.7    7e-06   
ref|XP_010550265.1|  PREDICTED: uncharacterized protein LOC104821164  56.2    8e-06   
gb|ETI55129.1|  hypothetical protein F443_02170                       57.8    8e-06   
gb|ETM01445.1|  hypothetical protein L917_01976                       57.8    8e-06   
ref|XP_008915876.1|  hypothetical protein PPTG_19247                  57.8    9e-06   
gb|ETP24933.1|  hypothetical protein F441_02143                       57.8    9e-06   
gb|ETL48350.1|  hypothetical protein L916_02040                       57.4    9e-06   
ref|XP_011088847.1|  PREDICTED: uncharacterized protein LOC105169981  57.8    9e-06   
gb|ETK94964.1|  hypothetical protein L915_02069                       57.4    1e-05   
gb|KGN47592.1|  hypothetical protein Csa_6G362990                     55.5    1e-05   
ref|XP_002681944.1|  RWP-RK domain-containing protein                 58.5    1e-05   Naegleria gruberi strain NEG-M
ref|XP_009532829.1|  hypothetical protein PHYSODRAFT_517628           56.6    1e-05   
ref|NP_001170066.1|  uncharacterized protein LOC100383982             57.8    1e-05   Zea mays [maize]
ref|XP_643997.1|  RWP-RK domain-containing protein                    57.8    1e-05   Dictyostelium discoideum AX4
ref|XP_002997995.1|  RWP-RK domain-containing protein, putative       56.2    1e-05   
ref|XP_008913705.1|  hypothetical protein PPTG_17267                  57.8    1e-05   
gb|ETP03474.1|  hypothetical protein F441_19545                       57.8    1e-05   
gb|ETP31666.1|  hypothetical protein F442_19489                       57.8    1e-05   
ref|XP_005854508.1|  rwp-rk domain-containing protein                 57.8    1e-05   
gb|ETI30088.1|  hypothetical protein F443_22790                       57.8    2e-05   
ref|XP_010492488.1|  PREDICTED: uncharacterized protein LOC104769...  57.4    2e-05   
gb|ETM33860.1|  hypothetical protein L914_18945                       57.8    2e-05   
gb|ETO62413.1|  hypothetical protein F444_19674                       57.4    2e-05   
gb|ETL27412.1|  hypothetical protein L916_19037                       57.4    2e-05   
gb|ETK73979.1|  hypothetical protein L915_19144                       57.4    2e-05   
ref|XP_008791759.1|  PREDICTED: uncharacterized protein LOC103708...  57.0    2e-05   
gb|EAZ21661.1|  hypothetical protein OsJ_05294                        57.8    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005822947.1|  hypothetical protein GUITHDRAFT_79210            53.5    2e-05   
ref|XP_008644135.1|  PREDICTED: uncharacterized protein LOC100383...  57.8    2e-05   
ref|XP_010558556.1|  PREDICTED: protein NLP1 isoform X1               57.4    2e-05   
gb|EWM22148.1|  rwp-rk domain-containing protein                      57.8    2e-05   
ref|XP_010526297.1|  PREDICTED: protein NLP8 isoform X1               57.8    2e-05   
ref|XP_005834700.1|  hypothetical protein GUITHDRAFT_69311            54.3    2e-05   
gb|AFW70061.1|  hypothetical protein ZEAMMB73_669675                  57.8    2e-05   
ref|XP_010526304.1|  PREDICTED: protein NLP8 isoform X2               57.8    2e-05   
emb|CEF97977.1|  RWP-RK domain                                        56.2    2e-05   
ref|XP_005826590.1|  hypothetical protein GUITHDRAFT_76281            53.9    2e-05   
gb|EAY84388.1|  hypothetical protein OsI_05764                        57.4    2e-05   Oryza sativa Indica Group [Indian rice]
emb|CCA22055.1|  conserved hypothetical protein                       57.0    2e-05   
ref|XP_008791760.1|  PREDICTED: uncharacterized protein LOC103708...  56.6    2e-05   
emb|CCI10645.1|  unnamed protein product                              57.0    2e-05   
ref|XP_002900317.1|  conserved hypothetical protein                   57.0    2e-05   
ref|XP_005824557.1|  hypothetical protein GUITHDRAFT_77999            53.5    2e-05   
ref|XP_009532398.1|  hypothetical protein PHYSODRAFT_517686           57.0    2e-05   
ref|XP_001753386.1|  predicted protein                                57.0    3e-05   
gb|ABD96880.1|  hypothetical protein                                  53.5    3e-05   Tarenaya spinosa
ref|XP_002453272.1|  hypothetical protein SORBIDRAFT_04g002940        57.0    3e-05   Sorghum bicolor [broomcorn]
gb|AAV64234.1|  unknown                                               57.0    3e-05   Zea mays [maize]
ref|XP_005821369.1|  hypothetical protein GUITHDRAFT_80613            52.8    3e-05   
ref|XP_001417754.1|  predicted protein                                56.2    3e-05   Ostreococcus lucimarinus CCE9901
ref|XP_010453763.1|  PREDICTED: uncharacterized protein LOC104735633  56.6    3e-05   
emb|CCA24539.1|  conserved hypothetical protein                       56.6    3e-05   
ref|XP_008611230.1|  hypothetical protein SDRG_07188                  56.2    3e-05   
ref|XP_005708254.1|  transcription factor                             56.2    3e-05   
gb|AFW73401.1|  hypothetical protein ZEAMMB73_631978                  55.1    4e-05   
ref|XP_008647199.1|  PREDICTED: protein RKD3-like                     54.7    4e-05   
ref|XP_006652467.1|  PREDICTED: protein NLP2-like                     56.6    4e-05   
ref|XP_010527164.1|  PREDICTED: protein RKD5                          54.7    4e-05   
ref|XP_008787160.1|  PREDICTED: protein RKD1                          53.9    4e-05   
ref|XP_005702485.1|  RWP-RK domain-containing protein                 54.7    4e-05   
ref|XP_010239470.1|  PREDICTED: uncharacterized protein LOC104585158  55.5    4e-05   
ref|NP_001130095.1|  uncharacterized protein LOC100191188             55.8    5e-05   Zea mays [maize]
ref|XP_006382000.1|  hypothetical protein POPTR_0006s23960g           55.1    5e-05   
ref|XP_007219091.1|  hypothetical protein PRUPE_ppa015130mg           53.1    5e-05   
ref|XP_010091956.1|  hypothetical protein L484_003769                 55.8    5e-05   
emb|CCI42666.1|  unnamed protein product                              53.1    5e-05   
gb|EEE61255.1|  hypothetical protein OsJ_15319                        56.2    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005822915.1|  hypothetical protein GUITHDRAFT_79357            52.0    6e-05   
ref|NP_001053196.1|  Os04g0495800                                     56.2    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005824448.1|  hypothetical protein GUITHDRAFT_154973           52.8    6e-05   
sp|Q0JC27.2|NLP2_ORYSJ  RecName: Full=Protein NLP2; Short=OsNLP2;...  56.2    6e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67387.1|  OSIGBa0159F11.11                                     56.2    6e-05   Oryza sativa [red rice]
ref|XP_008445526.1|  PREDICTED: protein RKD2-like isoform X1          55.5    6e-05   
gb|KFM24743.1|  Protein NLP9                                          52.8    6e-05   
ref|XP_008445527.1|  PREDICTED: uncharacterized protein LOC103488...  55.1    7e-05   
ref|XP_005836965.1|  hypothetical protein GUITHDRAFT_151353           53.9    7e-05   
ref|XP_002446731.1|  hypothetical protein SORBIDRAFT_06g021370        55.8    7e-05   Sorghum bicolor [broomcorn]
dbj|BAJ95517.1|  predicted protein                                    55.8    7e-05   
ref|XP_001784045.1|  predicted protein                                55.5    7e-05   
gb|KGN55364.1|  hypothetical protein Csa_4G646380                     53.1    7e-05   
gb|AAV64196.1|  unknown                                               55.8    7e-05   Zea mays [maize]
ref|XP_008669225.1|  PREDICTED: protein NLP2-like                     55.8    8e-05   
ref|XP_008802620.1|  PREDICTED: protein RKD1-like                     54.7    8e-05   
tpg|DAA37138.1|  TPA: hypothetical protein ZEAMMB73_593515            55.8    8e-05   
ref|XP_008234884.1|  PREDICTED: protein RKD4                          52.4    9e-05   
gb|EYU27184.1|  hypothetical protein MIMGU_mgv1a026577mg              54.3    9e-05   
ref|XP_010240492.1|  PREDICTED: protein NLP2-like                     55.5    9e-05   
ref|XP_005702472.1|  RWP-RK domain-containing protein                 54.3    1e-04   
gb|AFW58707.1|  hypothetical protein ZEAMMB73_961517                  55.5    1e-04   
ref|XP_009540211.1|  hypothetical protein PHYSODRAFT_382362           51.6    1e-04   
ref|XP_008661302.1|  PREDICTED: uncharacterized protein LOC100191...  55.1    1e-04   
ref|XP_008812750.1|  PREDICTED: protein NLP1-like                     55.1    1e-04   
ref|XP_010538845.1|  PREDICTED: protein NLP7-like isoform X2          55.1    1e-04   
gb|KHN23358.1|  Protein RKD4                                          53.1    1e-04   
ref|XP_010538846.1|  PREDICTED: protein NLP7-like isoform X3          55.1    1e-04   
gb|AAD38282.1|AC007789_8  hypothetical protein                        55.1    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010446048.1|  PREDICTED: uncharacterized protein LOC104728818  54.7    1e-04   
ref|XP_004955210.1|  PREDICTED: protein RKD1-like                     52.0    1e-04   
ref|XP_010485077.1|  PREDICTED: uncharacterized protein LOC104763398  54.7    1e-04   
gb|EAZ20046.1|  hypothetical protein OsJ_35645                        54.3    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004955211.1|  PREDICTED: protein RKD3-like                     52.4    1e-04   
gb|KCW89738.1|  hypothetical protein EUGRSUZ_A01998                   51.2    1e-04   
ref|XP_002671084.1|  predicted protein                                54.7    1e-04   Naegleria gruberi strain NEG-M
ref|XP_010939773.1|  PREDICTED: protein RKD1-like                     53.5    1e-04   
ref|XP_009384610.1|  PREDICTED: protein NLP1-like                     54.7    1e-04   
ref|XP_010538844.1|  PREDICTED: protein NLP7-like isoform X1          54.7    1e-04   
ref|XP_010648375.1|  PREDICTED: uncharacterized protein LOC104878986  54.3    2e-04   
ref|XP_002455780.1|  hypothetical protein SORBIDRAFT_03g025130        54.3    2e-04   Sorghum bicolor [broomcorn]
ref|XP_006402676.1|  hypothetical protein EUTSA_v10005779mg           54.7    2e-04   
emb|CDP14498.1|  unnamed protein product                              54.7    2e-04   
gb|EMT25644.1|  hypothetical protein F775_06752                       54.3    2e-04   
dbj|BAK05032.1|  predicted protein                                    51.6    2e-04   
ref|XP_009401874.1|  PREDICTED: protein NLP1-like isoform X2          54.3    2e-04   
dbj|BAF42666.1|  minus dominant protein                               50.4    2e-04   Pleodorina starrii
ref|XP_010918251.1|  PREDICTED: protein NLP1-like isoform X2          54.3    2e-04   
ref|XP_009401873.1|  PREDICTED: protein NLP1-like isoform X1          54.3    2e-04   
ref|XP_010028835.1|  PREDICTED: protein NLP2-like                     54.3    2e-04   
ref|XP_004501440.1|  PREDICTED: hybrid signal transduction histid...  53.9    2e-04   
ref|XP_006664445.1|  PREDICTED: uncharacterized protein LOC102713973  53.5    2e-04   
ref|XP_004301980.1|  PREDICTED: protein NLP5-like                     54.3    2e-04   
ref|XP_008675515.1|  PREDICTED: uncharacterized protein LOC103651621  53.5    2e-04   
ref|XP_009415647.1|  PREDICTED: uncharacterized protein LOC103996450  53.1    3e-04   
gb|EPS64185.1|  hypothetical protein M569_10596                       50.8    3e-04   
ref|XP_009385448.1|  PREDICTED: protein NLP2-like isoform X2          53.9    3e-04   
gb|ABA96321.1|  RWP-RK domain containing protein                      53.5    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ00241.1|  hypothetical protein OsI_22248                        53.5    3e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_008237985.1|  PREDICTED: protein NLP4-like isoform X1          53.9    3e-04   
ref|XP_006656806.1|  PREDICTED: pentatricopeptide repeat-containi...  53.9    3e-04   
ref|XP_007210497.1|  hypothetical protein PRUPE_ppa001086mg           53.9    3e-04   
ref|XP_010912769.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP2...  53.9    3e-04   
ref|XP_009385447.1|  PREDICTED: protein NLP2-like isoform X1          53.9    3e-04   
ref|XP_010918248.1|  PREDICTED: protein NLP1-like isoform X1          53.9    3e-04   
ref|XP_007152252.1|  hypothetical protein PHAVU_004G114100g           53.9    3e-04   
ref|XP_010413675.1|  PREDICTED: protein NLP9-like                     53.9    3e-04   
ref|XP_002322654.2|  hypothetical protein POPTR_0016s04220g           53.9    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008237986.1|  PREDICTED: protein NLP5-like isoform X2          53.5    3e-04   
gb|EEE65377.1|  hypothetical protein OsJ_20684                        53.9    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452555.1|  hypothetical protein SORBIDRAFT_04g028040        52.8    3e-04   Sorghum bicolor [broomcorn]
ref|XP_003533182.2|  PREDICTED: protein NLP7-like                     53.9    3e-04   
ref|XP_010512222.1|  PREDICTED: protein NLP9-like                     53.9    3e-04   
ref|XP_011033170.1|  PREDICTED: protein NLP2-like                     53.9    3e-04   
ref|XP_002876512.1|  predicted protein                                53.5    3e-04   
dbj|BAD37262.1|  pentatricopeptide (PPR) repeat-containing protei...  53.5    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002953858.1|  RWP-RK domain-containing transcription factor    53.9    3e-04   
ref|XP_005818932.1|  hypothetical protein GUITHDRAFT_121879           50.4    3e-04   
gb|EMS47666.1|  Protein NLP2                                          53.5    4e-04   
gb|EMT20012.1|  hypothetical protein F775_15797                       53.5    4e-04   
gb|AAQ62879.1|  At3g59580                                             53.5    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191517.1|  nodule inception protein-like protein 9             53.5    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290578.1|  hypothetical protein CARUB_v10016665mg           53.5    4e-04   
ref|XP_004141337.1|  PREDICTED: protein RKD3-like                     50.1    4e-04   
ref|XP_005825600.1|  hypothetical protein GUITHDRAFT_115168           52.0    4e-04   
gb|KEH43695.1|  plant regulator RWP-RK family protein                 53.1    4e-04   
ref|XP_009104212.1|  PREDICTED: protein NLP9                          53.5    4e-04   
ref|XP_010529654.1|  PREDICTED: protein NLP7-like isoform X2          53.5    4e-04   
ref|XP_006581652.1|  PREDICTED: protein RKD4-like                     52.0    4e-04   
emb|CDX98383.1|  BnaC06g17440D                                        53.5    4e-04   
ref|XP_005821371.1|  hypothetical protein GUITHDRAFT_155769           52.4    4e-04   
ref|XP_010469302.1|  PREDICTED: protein NLP9-like                     53.5    4e-04   
dbj|BAF42661.1|  minus dominant protein                               50.4    4e-04   Pleodorina starrii
ref|XP_009406431.1|  PREDICTED: protein NLP2-like                     53.5    4e-04   
emb|CDX67803.1|  BnaA07g18430D                                        53.1    5e-04   
ref|XP_010529652.1|  PREDICTED: protein NLP7-like isoform X1          53.1    5e-04   
ref|XP_009133611.1|  PREDICTED: protein NLP8-like isoform X3          53.1    5e-04   
ref|XP_008791814.1|  PREDICTED: protein NLP2-like isoform X3          53.1    5e-04   
ref|XP_010448625.1|  PREDICTED: protein NLP7 isoform X3               53.1    5e-04   
ref|XP_009137410.1|  PREDICTED: protein NLP7-like                     53.1    5e-04   
ref|XP_008791815.1|  PREDICTED: protein NLP2-like isoform X4          53.1    5e-04   
emb|CDX79818.1|  BnaA05g03380D                                        53.1    5e-04   
ref|XP_010433823.1|  PREDICTED: protein NLP7-like                     53.1    5e-04   
ref|XP_001770664.1|  predicted protein                                53.1    5e-04   
ref|XP_006413484.1|  hypothetical protein EUTSA_v10024328mg           53.1    5e-04   
ref|XP_010439097.1|  PREDICTED: protein NLP7-like                     53.1    5e-04   
ref|XP_010912370.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP3...  53.1    5e-04   
ref|XP_006282537.1|  hypothetical protein CARUB_v10004076mg           53.1    5e-04   
ref|XP_008791812.1|  PREDICTED: protein NLP2-like isoform X1          53.1    5e-04   
ref|XP_010448623.1|  PREDICTED: protein NLP7 isoform X2               53.1    5e-04   
ref|NP_194133.1|  NIN like protein 7                                  53.1    5e-04   
ref|XP_008791813.1|  PREDICTED: protein NLP2-like isoform X2          53.1    5e-04   
dbj|BAK20037.1|  minus dominance protein                              50.4    5e-04   
gb|AAO64180.1|  unknown protein                                       53.1    5e-04   
emb|CDX83480.1|  BnaA03g20260D                                        53.1    5e-04   
ref|XP_010448622.1|  PREDICTED: protein NLP7 isoform X1               53.1    5e-04   
ref|XP_002869745.1|  RWP-RK domain-containing protein                 53.1    5e-04   
emb|CDY03497.1|  BnaC01g15850D                                        53.1    6e-04   
ref|XP_006413485.1|  hypothetical protein EUTSA_v10024328mg           52.8    6e-04   
ref|XP_009137614.1|  PREDICTED: protein NLP7                          53.1    6e-04   
emb|CDY10982.1|  BnaA03g46410D                                        53.1    6e-04   
ref|XP_001757159.1|  predicted protein                                52.8    6e-04   
emb|CDP12190.1|  unnamed protein product                              53.1    6e-04   
emb|CDY50437.1|  BnaC07g38670D                                        53.1    6e-04   
ref|XP_008777047.1|  PREDICTED: protein NLP3-like                     53.1    6e-04   
emb|CDY66677.1|  BnaA01g35090D                                        53.1    6e-04   
dbj|BAN21753.1|  minus dominance protein                              50.1    6e-04   
ref|XP_010541791.1|  PREDICTED: protein NLP7-like                     52.8    6e-04   
gb|KFK28956.1|  hypothetical protein AALP_AA7G070500                  52.8    6e-04   
ref|XP_010645880.1|  PREDICTED: protein NLP2-like                     52.8    6e-04   
emb|CAN59896.1|  hypothetical protein VITISV_002883                   52.8    6e-04   
gb|ADI46915.1|  MID1m                                                 50.1    6e-04   
ref|XP_011000891.1|  PREDICTED: protein NLP2-like isoform X2          52.8    6e-04   
ref|XP_007039825.1|  Uncharacterized protein TCM_015956               52.0    6e-04   
gb|KEH43696.1|  plant regulator RWP-RK family protein                 52.8    6e-04   
ref|XP_006293639.1|  hypothetical protein CARUB_v10022595mg           52.8    6e-04   
gb|KDO76617.1|  hypothetical protein CISIN_1g0021441mg                52.8    6e-04   
ref|XP_005704517.1|  transcription factor                             52.4    6e-04   
ref|XP_004164569.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP8...  52.8    6e-04   
emb|CDY33637.1|  BnaC08g19370D                                        52.8    7e-04   
ref|XP_010517922.1|  PREDICTED: protein NLP8-like isoform X3          52.8    7e-04   
ref|XP_006606126.1|  PREDICTED: protein NLP7-like isoform X2          52.8    7e-04   
ref|XP_010517916.1|  PREDICTED: protein NLP8-like isoform X1          52.8    7e-04   
ref|XP_010508418.1|  PREDICTED: protein NLP8-like                     52.8    7e-04   
ref|XP_003592270.1|  hypothetical protein MTR_1g100970                52.8    7e-04   
ref|XP_011000890.1|  PREDICTED: protein NLP2-like isoform X1          52.8    7e-04   
ref|XP_010517920.1|  PREDICTED: protein NLP8-like isoform X2          52.8    7e-04   
ref|XP_007143431.1|  hypothetical protein PHAVU_007G071900g           52.8    7e-04   
ref|XP_009415041.1|  PREDICTED: protein NLP2-like isoform X1          52.8    7e-04   
gb|KHN12143.1|  Protein NLP7                                          52.8    7e-04   
ref|XP_006606125.1|  PREDICTED: protein NLP7-like isoform X1          52.8    7e-04   
dbj|BAN21752.1|  minus dominance protein                              49.7    7e-04   
ref|XP_010506231.1|  PREDICTED: protein NLP8                          52.8    7e-04   
gb|KDO76616.1|  hypothetical protein CISIN_1g0021441mg                52.4    8e-04   
ref|XP_003536463.2|  PREDICTED: protein NLP6-like                     52.8    8e-04   
ref|XP_008806288.1|  PREDICTED: protein NLP3                          52.4    8e-04   
emb|CBI37748.3|  unnamed protein product                              52.4    8e-04   
dbj|BAF99249.1|  minus dominance protein                              49.7    8e-04   
dbj|BAN21750.1|  minus dominance protein                              49.7    8e-04   
ref|XP_004954720.1|  PREDICTED: protein NLP3-like                     52.4    8e-04   
ref|NP_195547.1|  nodule inception protein-like protein 3             52.4    8e-04   
ref|XP_004496554.1|  PREDICTED: protein NLP6-like                     52.4    8e-04   
ref|XP_006643969.1|  PREDICTED: protein NLP3-like                     52.4    8e-04   
ref|XP_008454098.1|  PREDICTED: protein NLP9                          52.4    9e-04   
dbj|BAF99248.1|  minus dominance protein                              49.7    9e-04   
emb|CDY26497.1|  BnaC09g41710D                                        52.0    9e-04   
ref|XP_006397520.1|  hypothetical protein EUTSA_v10001299mg           52.4    9e-04   
ref|XP_010536471.1|  PREDICTED: protein NLP4-like                     52.4    9e-04   
gb|EPS66211.1|  hypothetical protein M569_08564                       52.0    9e-04   
emb|CDY17921.1|  BnaC04g02980D                                        52.4    9e-04   
ref|XP_006439289.1|  hypothetical protein CICLE_v10018744mg           52.4    9e-04   
ref|XP_009415043.1|  PREDICTED: protein NLP2-like isoform X2          52.4    0.001   
dbj|BAN21749.1|  minus dominance protein                              49.7    0.001   
gb|EAY73195.1|  hypothetical protein OsI_01067                        52.4    0.001   
ref|XP_010659716.1|  PREDICTED: protein NLP6-like                     52.4    0.001   
ref|XP_002465923.1|  hypothetical protein SORBIDRAFT_01g048290        52.4    0.001   
ref|XP_010267559.1|  PREDICTED: protein NLP7-like isoform X3          52.4    0.001   
emb|CDX69471.1|  BnaA10g18200D                                        51.6    0.001   
ref|XP_010534200.1|  PREDICTED: protein NLP4-like                     52.4    0.001   
ref|XP_009121515.1|  PREDICTED: uncharacterized protein LOC103846356  51.6    0.001   
ref|XP_010107269.1|  Protein NLP7                                     52.4    0.001   
ref|XP_002518861.1|  transcription factor, putative                   52.4    0.001   
ref|XP_004486873.1|  PREDICTED: protein NLP8-like isoform X2          52.4    0.001   
gb|EPS63477.1|  hypothetical protein M569_11304                       52.0    0.001   
ref|XP_004152313.1|  PREDICTED: protein NLP8-like                     52.4    0.001   
ref|XP_010267557.1|  PREDICTED: protein NLP6-like isoform X1          52.4    0.001   
ref|XP_010267558.1|  PREDICTED: protein NLP6-like isoform X2          52.4    0.001   
ref|XP_004231096.1|  PREDICTED: protein NLP2                          52.0    0.001   
ref|XP_011088705.1|  PREDICTED: LOW QUALITY PROTEIN: protein NLP2...  52.4    0.001   
gb|KDO76615.1|  hypothetical protein CISIN_1g0021441mg                52.0    0.001   
ref|XP_007040589.1|  Transcription factor, putative                   52.4    0.001   



>ref|XP_009600090.1| PREDICTED: uncharacterized protein LOC104095632 [Nicotiana tomentosiformis]
Length=288

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/258 (60%), Positives = 195/258 (76%), Gaps = 4/258 (2%)
 Frame = +3

Query  249   TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeik  428
             TDPKS+SFD+VSKLF+LPLSDAA++LGVC SVLKKICYENGLVRWPYRK +SGK IE+IK
Sbjct  23    TDPKSISFDQVSKLFNLPLSDAAESLGVCASVLKKICYENGLVRWPYRKVISGKCIEDIK  82

Query  429   kdaakekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQG  608
             ++A++EKQE+  E PK AGEK +  A+S  S+  GSPLQNK  S+  EMPK+ A SQQQG
Sbjct  83    EEASREKQERSVEFPKAAGEKRDSLASSAISSFPGSPLQNKSISSTMEMPKAGAFSQQQG  142

Query  609   SKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTK-KE  785
             ++ AQ+ S  H    NL KAT+   DEFKYGFPSDGLS ++Y+WWG++S D NED++   
Sbjct  143   TRNAQSGSLPHFRISNLTKATSVSYDEFKYGFPSDGLSTVTYRWWGNKSPDNNEDSQPNN  202

Query  786   GNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLF  965
              NA+ SK+Q+    E+S  KT   +VDS    SL+D+R++A KEGKE LRLGVYR H   
Sbjct  203   DNAKNSKEQAENVAEKSECKT---SVDSMEVSSLTDVRKRAVKEGKEMLRLGVYRGHRAN  259

Query  966   KLDLTKRKVLLQVFKSSY  1019
              LD TKRK+L QVFKS +
Sbjct  260   MLDSTKRKILRQVFKSYF  277



>ref|XP_009766294.1| PREDICTED: protein NLP2 [Nicotiana sylvestris]
Length=288

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 156/258 (60%), Positives = 196/258 (76%), Gaps = 4/258 (2%)
 Frame = +3

Query  249   TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeik  428
             TDPKS+SFD+VSKLF+LPLSDAA++LGVC SVLKKICYENGLVRWPYRK +SGKSIE+IK
Sbjct  23    TDPKSISFDQVSKLFNLPLSDAAESLGVCASVLKKICYENGLVRWPYRKVISGKSIEDIK  82

Query  429   kdaakekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQG  608
             K+A++EKQE+  E PK AGEK +  A+S  S+  GSPLQNK  S+  EM K+ A SQQQG
Sbjct  83    KEASREKQERSVEFPKAAGEKHDSLASSAISSFPGSPLQNKSISSTVEMLKAGAFSQQQG  142

Query  609   SKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTK-KE  785
             ++ AQ+ S  H    NL + T+   DEFKYGFPSDGLS ++Y+WWG++S D NED++  +
Sbjct  143   TRIAQSGSLLHFRVSNLTRGTSVNYDEFKYGFPSDGLSTVTYRWWGNKSPDNNEDSRPND  202

Query  786   GNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLF  965
              NA+ SK+Q+    E+S  KT   +VDS  A SL+D+R++A KEGKE LRLGVYR H   
Sbjct  203   DNAKNSKEQAENVAEKSECKT---SVDSMEASSLTDVRKRAVKEGKEMLRLGVYRGHRAN  259

Query  966   KLDLTKRKVLLQVFKSSY  1019
              LD TKRK+L QVFKS +
Sbjct  260   MLDSTKRKILRQVFKSYF  277



>ref|XP_004251823.1| PREDICTED: protein NLP7 [Solanum lycopersicum]
Length=293

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 150/257 (58%), Positives = 188/257 (73%), Gaps = 5/257 (2%)
 Frame = +3

Query  252   DPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikk  431
             DPKS+SFD+VSKLFSLPLSDAA++LGVC SVLKKICYENGLVRWPYRK  SGKSIE+IKK
Sbjct  30    DPKSVSFDDVSKLFSLPLSDAAESLGVCASVLKKICYENGLVRWPYRKVSSGKSIEDIKK  89

Query  432   daakekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGS  611
             +A +EKQE+  E PK  GEK    A+S  S+  GSPL NK  S+  EMP++   SQQQG+
Sbjct  90    EALREKQERSLEFPKAPGEKNGSLASSAISSFSGSPLPNKSISSTMEMPRAGVFSQQQGT  149

Query  612   KTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTK-KEG  788
             +  Q+ SS H    NL K T+   DEFKYGFPSDGLS  +Y+WWG++S DGN+D+K  + 
Sbjct  150   RNFQSGSSPHFRISNLTKGTSV-YDEFKYGFPSDGLSTATYRWWGNKSPDGNQDSKLNDD  208

Query  789   NAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLFK  968
             NA+ S +Q+    E++  +T   +VDS     L+D+R++AAKEGKE LRLGV+R  S   
Sbjct  209   NAKNSTEQAENVAEKTECQT---SVDSTGTTLLTDVRKRAAKEGKETLRLGVHRRRSAKM  265

Query  969   LDLTKRKVLLQVFKSSY  1019
             LD TKRK+L QVFKS +
Sbjct  266   LDSTKRKILHQVFKSYF  282



>ref|XP_006350003.1| PREDICTED: uncharacterized protein LOC102590780 [Solanum tuberosum]
Length=299

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 190/258 (74%), Gaps = 5/258 (2%)
 Frame = +3

Query  249   TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeik  428
             TDPKS+SFDEVSKLF+LPLSDAA+++GVC SVLKKICYENGLVRWPYRK  SGKSIE+IK
Sbjct  35    TDPKSVSFDEVSKLFNLPLSDAAESVGVCASVLKKICYENGLVRWPYRKVSSGKSIEDIK  94

Query  429   kdaakekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQG  608
             K+A +EKQE+  E PK  GEK    A+S  S+  GSPL +K  S+  EMP++ A SQQQG
Sbjct  95    KEALREKQERSLEFPKAPGEKNGSLASSAISSFSGSPLPSKTISSTMEMPRAGAFSQQQG  154

Query  609   SKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTK-KE  785
             ++  Q+ SS H    NL K T+   DEFKYGFPSDGLS  +Y+WWG++S +GN+D+K  +
Sbjct  155   TRNFQSGSSPHFRISNLTKGTSV-YDEFKYGFPSDGLSTATYRWWGNKSPEGNQDSKLND  213

Query  786   GNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLF  965
              NA+ S +Q+   +E++  +T   +VDS     L+D+R++A KEGKE LRLGVYR  S  
Sbjct  214   DNAKNSTEQAENVVEKTDCQT---SVDSTGTTLLTDVRKRAVKEGKETLRLGVYRGRSAK  270

Query  966   KLDLTKRKVLLQVFKSSY  1019
              LD TKRK+L QVFKS +
Sbjct  271   MLDSTKRKILHQVFKSYF  288



>emb|CDP06158.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   223 bits (569),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 141/273 (52%), Positives = 182/273 (67%), Gaps = 16/273 (6%)
 Frame = +3

Query  258   KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
             KSL+FD+VSK FSLPLSDAADTLGVC SVLKKIC+ENGLVRWP+RKFLSGKSIE+IK+DA
Sbjct  32    KSLTFDQVSKFFSLPLSDAADTLGVCPSVLKKICHENGLVRWPHRKFLSGKSIEQIKEDA  91

Query  438   akekqeqhaeLPKPAGEKPNLSANSTPS--TSKGSPLQNKGSSAAQEMPKSAAASQQQGS  611
             A+ K +Q  E+PK AG+  +  ANST S     G+ LQNK +S+  E+ K+ +  Q QG+
Sbjct  92    ARAKNKQLNEVPKDAGQGSDALANSTVSLLAGTGTELQNKTTSSVAEVSKAQSVMQLQGN  151

Query  612   KTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT-----  776
             K  Q  S   L  +NL K T+   DEFKYGFPS GLS +SYKWWG+ S  G++DT     
Sbjct  152   KNPQIGSPPKLTGLNLTKGTSTNEDEFKYGFPSHGLSTVSYKWWGNSSNSGSKDTPGTAK  211

Query  777   -KKEGN-------AEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEAL  932
              + +GN       A  S   S    ++   +  +S+ DS     LS LR++AA EG +AL
Sbjct  212   DETQGNRKSPVNSANGSTLASRTDGQKCENEARESSTDSPGEGVLSSLRKRAATEGHKAL  271

Query  933   RLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             +LG +R + + +LD TKR VL Q+FKSS P +W
Sbjct  272   KLGAHRRY-VMELDQTKRSVLQQIFKSSLPSEW  303



>ref|XP_010241340.1| PREDICTED: uncharacterized protein LOC104585973 isoform X2 [Nelumbo 
nucifera]
Length=272

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 175/268 (65%), Gaps = 22/268 (8%)
 Frame = +3

Query  258   KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
             +SL+FDEVSKLFSLP+++AA+ LGVC+SVLKKIC +NGL+RWPYRKFLSGKSIEEIKKDA
Sbjct  13    ESLTFDEVSKLFSLPIAEAANILGVCSSVLKKICRDNGLIRWPYRKFLSGKSIEEIKKDA  72

Query  438   akekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKT  617
             A+E+  + A+L K A +K N SA+S  S++ GS LQNK S+          +SQQQGS  
Sbjct  73    ARERNRELAQLSKAARQK-NESASSILSSTFGSQLQNKMSN----------SSQQQGS-G  120

Query  618   AQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNE-DTKKEGNA  794
              Q +  QHL + +L K      DEFKYGFP+DGLS I+ KWWGS S DG E D   +   
Sbjct  121   VQNIRPQHLQNPSLTKGIPDHVDEFKYGFPTDGLSTITVKWWGSSSPDGTEDDVFGDETD  180

Query  795   EESKQQSAVPMEESAVK---------TGKSNVDSFRADSLSDLREQAAKEGKEALRLGVY  947
             +E KQQS    + S +          TG++ +       LS +R++AA+EG+EAL+LG  
Sbjct  181   QEDKQQSPEKADSSCLTTEEKKPDKGTGENEIGPQGTGLLSSVRKRAAQEGREALKLGYC  240

Query  948   REHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             R    +KL   +  +LL+VF SS P  +
Sbjct  241   RNTGAYKLARREEILLLKVFGSSLPNHY  268



>ref|XP_010241339.1| PREDICTED: uncharacterized protein LOC104585973 isoform X1 [Nelumbo 
nucifera]
Length=274

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 175/270 (65%), Gaps = 24/270 (9%)
 Frame = +3

Query  258   KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
             +SL+FDEVSKLFSLP+++AA+ LGVC+SVLKKIC +NGL+RWPYRKFLSGKSIEEIKKDA
Sbjct  13    ESLTFDEVSKLFSLPIAEAANILGVCSSVLKKICRDNGLIRWPYRKFLSGKSIEEIKKDA  72

Query  438   akekqeqhaeLPKPAGEKPNLSANSTPSTS--KGSPLQNKGSSAAQEMPKSAAASQQQGS  611
             A+E+  + A+L K A +K N SA+S  S++   GS LQNK S+          +SQQQGS
Sbjct  73    ARERNRELAQLSKAARQK-NESASSILSSTFFSGSQLQNKMSN----------SSQQQGS  121

Query  612   KTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNE-DTKKEG  788
                Q +  QHL + +L K      DEFKYGFP+DGLS I+ KWWGS S DG E D   + 
Sbjct  122   -GVQNIRPQHLQNPSLTKGIPDHVDEFKYGFPTDGLSTITVKWWGSSSPDGTEDDVFGDE  180

Query  789   NAEESKQQSAVPMEESAVK---------TGKSNVDSFRADSLSDLREQAAKEGKEALRLG  941
               +E KQQS    + S +          TG++ +       LS +R++AA+EG+EAL+LG
Sbjct  181   TDQEDKQQSPEKADSSCLTTEEKKPDKGTGENEIGPQGTGLLSSVRKRAAQEGREALKLG  240

Query  942   VYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
               R    +KL   +  +LL+VF SS P  +
Sbjct  241   YCRNTGAYKLARREEILLLKVFGSSLPNHY  270



>ref|XP_006437156.1| hypothetical protein CICLE_v10032332mg [Citrus clementina]
 ref|XP_006484885.1| PREDICTED: protein NLP3-like [Citrus sinensis]
 gb|ESR50396.1| hypothetical protein CICLE_v10032332mg [Citrus clementina]
Length=282

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 171/268 (64%), Gaps = 27/268 (10%)
 Frame = +3

Query  264   LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaak  443
             LSFD++SK FSLPLSDAA+ LGVC SVLKKIC +NGL RWPYRKFLSGKSIE+IKK AA+
Sbjct  29    LSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKFLSGKSIEDIKKYAAR  88

Query  444   ekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKTAQ  623
             EK ++ AEL K A              S   PL N+ S        S    QQQGSK++ 
Sbjct  89    EKSKELAELSKIA------------RKSGFQPLNNETSKL--HGVASPPNLQQQGSKSSP  134

Query  624   TLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGNA--E  797
                   LL+ NL K   A  DEFK+GFPSDGLS  SYKWWGSRS+DGN+   K+ +   E
Sbjct  135   VGQPHVLLNANLTKGIMA-LDEFKHGFPSDGLSTASYKWWGSRSSDGNDGIHKDESEIDE  193

Query  798   ESKQQSAVPMEESAVK-TG---------KSNVDSFRADSLSDLREQAAKEGKEALRLGVY  947
             E KQ  A   +ESA + TG         +SNVD   +  L+ +R++  +EG+EAL+LGVY
Sbjct  194   EDKQAEAKADKESATQATGNEKSGNGETESNVDPQGSGLLTAVRKRTVEEGQEALKLGVY  253

Query  948   REHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             +++ + +LD  +R +L ++FKSS P +W
Sbjct  254   KKYCVKQLDRKERVLLHRIFKSSLPKEW  281



>gb|KDO60981.1| hypothetical protein CISIN_1g023462mg [Citrus sinensis]
Length=282

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 168/268 (63%), Gaps = 27/268 (10%)
 Frame = +3

Query  264   LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaak  443
             LSFD++SK FSLPLSDAA+ LGVC SVLKKIC +NGL RWPYRKFLSGKSIE+IKK AA+
Sbjct  29    LSFDDISKYFSLPLSDAANHLGVCVSVLKKICRDNGLDRWPYRKFLSGKSIEDIKKYAAR  88

Query  444   ekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKTAQ  623
             EK ++ AEL K A              S   PL N+ S        S    QQQGSK + 
Sbjct  89    EKSKELAELSKIA------------RKSGFQPLSNETSKL--HGVTSPPNLQQQGSKNSP  134

Query  624   TLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGNA--E  797
                   LL+ NL K   A  DEFK+GFPSDGLS  SYKWWG RS+DGN+   K+ +   E
Sbjct  135   VGQPHVLLNANLTKGIMA-LDEFKHGFPSDGLSTASYKWWGGRSSDGNDGIHKDESEIDE  193

Query  798   ESKQQSAVPMEESAVK-TG---------KSNVDSFRADSLSDLREQAAKEGKEALRLGVY  947
             E KQ  A   +ESA + TG         +SNVD   +  L+  R++  +EG+EAL+LGVY
Sbjct  194   EDKQAEAKADKESATQATGNEKSGNGETESNVDPQGSGLLTAARKRTVEEGREALKLGVY  253

Query  948   REHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             +++ + +LD  +R +L ++FKSS P +W
Sbjct  254   KKYCVKQLDRKERVLLHRIFKSSLPKEW  281



>gb|EYU30285.1| hypothetical protein MIMGU_mgv1a010586mg [Erythranthe guttata]
Length=308

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 174/273 (64%), Gaps = 26/273 (10%)
 Frame = +3

Query  258   KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
             KS SFDEVS LFSLPLS AAD+LGVC +VLKK+CY+NGLVRWPYRK LSGKSIEEIKKDA
Sbjct  40    KSPSFDEVSNLFSLPLSYAADSLGVCPTVLKKLCYDNGLVRWPYRKILSGKSIEEIKKDA  99

Query  438   akekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKT  617
             A EK++  AEL K  GE+ N  A S   +  G   Q+  + + QE   +     QQ +K 
Sbjct  100   AIEKEKNLAEL-KVYGERNNSLARSAALSPSGPQPQSTNTISPQE-SSTVRILPQQPNKD  157

Query  618   AQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRS-----------TDG  764
              Q  SSQ +   N     +  SDEFKYGFPSDGLS++SY+WWG++S            D 
Sbjct  158   NQIQSSQIMKIGN-----STISDEFKYGFPSDGLSSVSYRWWGNKSGGENVVDTLQRVDE  212

Query  765   NEDTKK---EGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALR  935
             N D +K   EG  + +   S+  M++  +  GK N +      LS LR++AAK+G +AL+
Sbjct  213   NADERKEQHEGKVDHAANLSS--MDDEVMTQGKKNDEPVGL--LSVLRKKAAKDGLQALK  268

Query  936   LGVYREHSLFK-LDLTKRKVLLQVFKSSYPPQW  1031
             LGVYR +S  K LD TK+ +L+Q+FKSS P +W
Sbjct  269   LGVYRGYSDGKNLDRTKKMMLVQIFKSSLPSEW  301



>gb|EYU30286.1| hypothetical protein MIMGU_mgv1a010586mg [Erythranthe guttata]
Length=301

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 139/273 (51%), Positives = 179/273 (66%), Gaps = 33/273 (12%)
 Frame = +3

Query  258   KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
             KS SFDEVS LFSLPLS AAD+LGVC +VLKK+CY+NGLVRWPYRK LSGKSIEEIKKDA
Sbjct  40    KSPSFDEVSNLFSLPLSYAADSLGVCPTVLKKLCYDNGLVRWPYRKILSGKSIEEIKKDA  99

Query  438   akekqeqhaeLPKPAGEKPN-LSANSTP-STSKGSPLQNKGSSAAQEMPKSAAASQQQGS  611
             A EK++  AEL K  GE+ N L+    P ST+  SP +   SS  + +P       QQ +
Sbjct  100   AIEKEKNLAEL-KVYGERNNSLARGPQPQSTNTISPQE---SSTVRILP-------QQPN  148

Query  612   KTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGN-EDT--KK  782
             K  Q  SSQ +   N     +  SDEFKYGFPSDGLS++SY+WWG++S   N  DT  + 
Sbjct  149   KDNQIQSSQIMKIGN-----STISDEFKYGFPSDGLSSVSYRWWGNKSGGENVVDTLQRV  203

Query  783   EGNAEESKQQ---------SAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALR  935
             + NA+E K+Q         +   M++  +  GK N +      LS LR++AAK+G +AL+
Sbjct  204   DENADERKEQHEGKVDHAANLSSMDDEVMTQGKKNDEPVGL--LSVLRKKAAKDGLQALK  261

Query  936   LGVYREHSLFK-LDLTKRKVLLQVFKSSYPPQW  1031
             LGVYR +S  K LD TK+ +L+Q+FKSS P +W
Sbjct  262   LGVYRGYSDGKNLDRTKKMMLVQIFKSSLPSEW  294



>ref|XP_010657121.1| PREDICTED: protein NLP3 [Vitis vinifera]
 emb|CBI22103.3| unnamed protein product [Vitis vinifera]
Length=291

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 164/276 (59%), Gaps = 18/276 (7%)
 Frame = +3

Query  258   KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
             KSLSFD+VS  FSLP+S+AA+ LGVCTSVLKKIC ENGL RWPYRKF SG S+EEIKK A
Sbjct  11    KSLSFDDVSNCFSLPISEAANALGVCTSVLKKICRENGLQRWPYRKFQSGTSVEEIKKYA  70

Query  438   akekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAAS-----QQ  602
             A+E+ ++ A+L K   +  +   +S  S + GS  QN   S+  +M K   A      QQ
Sbjct  71    ARERNKELAQLSKVDVQGNDALTSSAVSAAFGSQPQNDTKSSLWKMSKLHGAIPPHMLQQ  130

Query  603   QGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKK  782
             QGS+  Q    Q+L + +L K   A  DEFKYGFP+ GL+  S KWWGS S DG E T  
Sbjct  131   QGSRNIQNGRPQNLPNASLSKGIAASLDEFKYGFPTSGLATASNKWWGSSSPDGYEGTIG  190

Query  783   EGNA--EESKQQS-----------AVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGK  923
              G    EE K+QS            +  E++  +  +  +       L+ +R+   +EG+
Sbjct  191   NGVEIDEEDKKQSEQLADNGANLLVMDGEKAENEKEEGTIGPQGTGLLTAVRKTTVEEGR  250

Query  924   EALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             + L++GV R+H + K    +R++LLQ+F SS P QW
Sbjct  251   KILKIGVGRDHGVLKAGKKERRLLLQIFGSSLPSQW  286



>ref|XP_011026245.1| PREDICTED: uncharacterized protein LOC105126913 [Populus euphratica]
Length=274

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 120/273 (44%), Positives = 163/273 (60%), Gaps = 37/273 (14%)
 Frame = +3

Query  267   SFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaake  446
             S++ +SK FSLPLSDAA+ LGVC SVLKKIC ENGL RWPYRK+L+GKSIE+I++ AA+E
Sbjct  16    SWEAISKHFSLPLSDAANNLGVCVSVLKKICRENGLDRWPYRKYLAGKSIEDIRRYAARE  75

Query  447   kqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKTAQT  626
             K +  A+L K A                G   QN  +S   ++       QQQG+K    
Sbjct  76    KIKAIADLAKAA-------------NKSGIQQQNNENSKPHKL-------QQQGTKDV-L  114

Query  627   LSSQHL-LSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGS------RSTD--GNEDTK  779
             +  QH+ L+  L K    G DEFKYGFPSDGLS  + KWWGS      R+TD  G E  +
Sbjct  115   VGRQHITLTSGLAKGLM-GLDEFKYGFPSDGLSTATNKWWGSSLSDTQRATDRAGTETDE  173

Query  780   KEGNAEESKQQ---SAVPMEESAVKTGK---SNVDSFRADSLSDLREQAAKEGKEALRLG  941
              +G+  E K     S V ++E   + GK   + +D      L+ +R++A +EG+EAL+LG
Sbjct  174   DDGHQSEEKADAGTSVVIVDEEKGENGKMESNEIDPQGTGLLTSVRKRAVEEGREALKLG  233

Query  942   VYREHSLFKLDLTKRKVLLQVFKSSYPPQWEQE  1040
             VYR + + KL   +R +LL++F SS P QW Q+
Sbjct  234   VYRAYGVNKLGRKQRALLLRIFGSSLPKQWIQD  266



>gb|ABK96557.1| unknown [Populus trichocarpa x Populus deltoides]
Length=274

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 160/272 (59%), Gaps = 35/272 (13%)
 Frame = +3

Query  267   SFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaake  446
             S++ +SK FSLPLSDAA+ LGVC SVLKKIC ENGL RWPYRK+L+GKSIE+I++ AA+E
Sbjct  16    SWEAISKHFSLPLSDAANNLGVCVSVLKKICRENGLDRWPYRKYLAGKSIEDIRRYAARE  75

Query  447   kqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKTAQT  626
             K +  A+L K A                G   QN  +S   ++       QQQG+K    
Sbjct  76    KIKAIADLAKAA-------------NKSGIQQQNNENSKPHKL-------QQQGTKDVLV  115

Query  627   LSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGS------RSTD--GNEDTKK  782
                  +L+  L K    G DEFKYGFPSDGLS  + KWWGS      R+TD  G E  + 
Sbjct  116   GRQHIMLTPGLAKGLM-GLDEFKYGFPSDGLSTATNKWWGSSLSDTQRATDRAGIETDED  174

Query  783   EGNAEESKQQ---SAVPMEESAVKTGK---SNVDSFRADSLSDLREQAAKEGKEALRLGV  944
             +G+  E K     S V ++E   + GK   + +D      L+ +R++A +EG+EAL+LGV
Sbjct  175   DGHQSEEKVDAGTSVVIVDEEKGENGKMESNEIDPQGTGLLTSVRKRAVEEGREALKLGV  234

Query  945   YREHSLFKLDLTKRKVLLQVFKSSYPPQWEQE  1040
             YR + + KL   +R +LL++F SS P QW Q+
Sbjct  235   YRTYGVNKLGRKQRALLLRIFGSSLPKQWIQD  266



>ref|XP_002300875.1| hypothetical protein POPTR_0002s05980g [Populus trichocarpa]
 gb|EEE80148.1| hypothetical protein POPTR_0002s05980g [Populus trichocarpa]
Length=274

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 120/273 (44%), Positives = 163/273 (60%), Gaps = 37/273 (14%)
 Frame = +3

Query  267   SFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaake  446
             S++ +SK FSLPLSDAA+ LGVC SVLKKIC +NGL RWPYRK+L+GKSIE+I++ AA+E
Sbjct  16    SWEAISKHFSLPLSDAANNLGVCVSVLKKICRDNGLDRWPYRKYLAGKSIEDIRRYAARE  75

Query  447   kqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKTAQT  626
             K +  A+L K A                G   QN  +S   ++       QQQG+K    
Sbjct  76    KIKAIADLAKAA-------------NKSGIQQQNNENSKPHKL-------QQQGTKDV-L  114

Query  627   LSSQHL-LSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGS------RSTD--GNEDTK  779
             +  QH+ L+  L K    G DEFKYGFPSDGLS  + KWWGS      R+TD  G E  +
Sbjct  115   VGRQHITLTPGLAKGLM-GLDEFKYGFPSDGLSTATNKWWGSSLSDTQRATDRAGIETDE  173

Query  780   KEGNAEESKQQ---SAVPMEESAVKTGK---SNVDSFRADSLSDLREQAAKEGKEALRLG  941
              +G   E K     S V ++E   + GK   + +D      L+ +R++AA+EG+EAL+LG
Sbjct  174   DDGRQSEEKVDAGTSVVIVDEEKGENGKMESNEIDPQGTGLLTSVRKRAAEEGREALKLG  233

Query  942   VYREHSLFKLDLTKRKVLLQVFKSSYPPQWEQE  1040
             VYR + + KL   +R +LL++F SS P QW Q+
Sbjct  234   VYRTYGVNKLGRKQRALLLRIFGSSLPKQWIQD  266



>ref|XP_008784393.1| PREDICTED: uncharacterized protein LOC103703346 [Phoenix dactylifera]
Length=322

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 165/282 (59%), Gaps = 31/282 (11%)
 Frame = +3

Query  264   LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaak  443
             LSF+E+SK FSLP+++AA  LGVCTS LK+IC ENG++RWPYRKFL+GK++E+I+KDA +
Sbjct  43    LSFEEISKYFSLPIAEAASNLGVCTSALKRICRENGIIRWPYRKFLAGKTVEDIRKDAER  102

Query  444   ekqeqhaeLPKPAGEK-------PNLSANSTPSTSKGSPLQNKGSSAA-------QEMPK  581
             E+ ++ AELPK A ++       P++S  S+ ST+ G+ +QN+  S         Q +P 
Sbjct  103   ERTKELAELPKIANQRTDVSKVMPSMSVGSS-STTFGNQVQNRAPSVTQGALKLQQGVPM  161

Query  582   SAAASQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTD  761
                  Q QG+K +QT     +    +P       DEFKYGFP++GLS++  +WWGS S +
Sbjct  162   PGHVLQSQGNKFSQTTWPNMIQYRGIPTFM----DEFKYGFPANGLSSVCVRWWGSGSKE  217

Query  762   GNEDTKKEGNA---EESKQQSAVPMEESAVKTGKSNVDSFRAD---------SLSDLREQ  905
               E T  E +    EE+K+   + +E S       + D    D         SL  LR +
Sbjct  218   DTERTLPEESGTIKEENKEPHGLSIETSRQILKDDHPDHSTEDIAAITEASASLCSLRRK  277

Query  906   AAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             A + G E L+ G+ + ++  KL   +R  LLQVFKSS P QW
Sbjct  278   AVECGCETLKGGISKGYTSCKLGKRQRLALLQVFKSSLPDQW  319



>ref|XP_007048879.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOX93036.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=270

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 116/266 (44%), Positives = 162/266 (61%), Gaps = 23/266 (9%)
 Frame = +3

Query  258   KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
             +SLSFD+++  FSLPL DAA TLGVC S LKKIC ENGL RWP+RKFL+GKSIEEIK+ A
Sbjct  15    QSLSFDDIADFFSLPLYDAASTLGVCASALKKICRENGLDRWPHRKFLAGKSIEEIKRHA  74

Query  438   akekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKT  617
             A+E++++  EL      K +   +S P  ++ S LQ  G++A   +       QQQG+K 
Sbjct  75    ARERRKELTELS-----KVHRQGSSQPQNNELSKLQ--GAAALPNL-------QQQGTKN  120

Query  618   AQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEG---  788
              QT  + +    +L    T  SDEFKYGFPSDGLS  + KWWGS  +DG+ED + +G   
Sbjct  121   IQTGQALNFGHRSLMTGMTT-SDEFKYGFPSDGLSIATNKWWGSSKSDGHEDVQVDGAET  179

Query  789   NAEESKQQSAVPME---ESAVKTGK--SNVDSFRADSLSDLREQAAKEGKEALRLGVYRE  953
               E+  Q    P +   E   + GK    +    +  L+ +R++A +EG EAL+LGVY+ 
Sbjct  180   EGEDKHQSVEKPGDMANEKPEENGKLDDGIGPQGSGLLTAVRKRAVEEGGEALKLGVYKG  239

Query  954   HSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             + + KL   +  +LL++FKSS    W
Sbjct  240   YGIKKLGTREASLLLRIFKSSLQKDW  265



>gb|KHG11867.1| Protein NLP2 [Gossypium arboreum]
Length=272

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 116/273 (42%), Positives = 158/273 (58%), Gaps = 36/273 (13%)
 Frame = +3

Query  258   KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
             +SLSFD+++  FSLPL DAA TLGVCTSVLKKIC ENGL RWP+RKFL+GKS+EEIK+ A
Sbjct  16    QSLSFDDIADFFSLPLDDAASTLGVCTSVLKKICRENGLDRWPHRKFLAGKSVEEIKRHA  75

Query  438   akekqeqhaeLPKPAGE--KPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGS  611
             A+E++ + AEL K   +  +P    N  P    GS L N                QQQG 
Sbjct  76    ARERRREIAELSKAHRQSSQPQPQNNEQPKLQGGSALPNL---------------QQQGI  120

Query  612   KTAQT-----LSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT  776
             +  QT      S Q L++        A SDEFK+GFPSDGLS I+ KWWGS  +D NE +
Sbjct  121   RNIQTAQALNFSHQSLMT------GAAMSDEFKFGFPSDGLSVITNKWWGSSKSDCNEVS  174

Query  777   KKEG---NAEESKQQSAVPMEESAVKTGKS-----NVDSFRADSLSDLREQAAKEGKEAL  932
               +G     E+  Q    P + +  K G++      +    +  L+ +R+++ +EG+EAL
Sbjct  175   DADGAETEGEDKHQTIEEPDDMANDKPGQNGKIEDGISRQGSSLLAAVRKRSMEEGREAL  234

Query  933   RLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
              LGVY+   + +    K  +LL++FKSS P  W
Sbjct  235   ELGVYKGRGMKRQGSRKASLLLRIFKSSLPDVW  267



>ref|XP_007048878.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX93035.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=269

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 116/266 (44%), Positives = 161/266 (61%), Gaps = 24/266 (9%)
 Frame = +3

Query  258   KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
             +SLSFD+++  FSLPL DAA TLGVC S LKKIC ENGL RWP+RKFL+GKSIEEIK+ A
Sbjct  15    QSLSFDDIADFFSLPLYDAASTLGVCASALKKICRENGLDRWPHRKFLAGKSIEEIKRHA  74

Query  438   akekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKT  617
             A+E++++  EL K   +       S P  ++ S LQ  G++A   +       QQQG+K 
Sbjct  75    ARERRKELTELSKVHRQ------GSQPQNNELSKLQ--GAAALPNL-------QQQGTKN  119

Query  618   AQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEG---  788
              QT  + +    +L    T  SDEFKYGFPSDGLS  + KWWGS  +DG+ED + +G   
Sbjct  120   IQTGQALNFGHRSLMTGMTT-SDEFKYGFPSDGLSIATNKWWGSSKSDGHEDVQVDGAET  178

Query  789   NAEESKQQSAVPME---ESAVKTGK--SNVDSFRADSLSDLREQAAKEGKEALRLGVYRE  953
               E+  Q    P +   E   + GK    +    +  L+ +R++A +EG EAL+LGVY+ 
Sbjct  179   EGEDKHQSVEKPGDMANEKPEENGKLDDGIGPQGSGLLTAVRKRAVEEGGEALKLGVYKG  238

Query  954   HSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             + + KL   +  +LL++FKSS    W
Sbjct  239   YGIKKLGTREASLLLRIFKSSLQKDW  264



>ref|XP_010916090.1| PREDICTED: uncharacterized protein LOC105041008 isoform X1 [Elaeis 
guineensis]
Length=322

 Score =   159 bits (401),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/281 (39%), Positives = 162/281 (58%), Gaps = 29/281 (10%)
 Frame = +3

Query  264   LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaak  443
             LSF+E+SK FSLP+++AA  LGVCTS LK+IC ENG++RWPYRKFL+GK++E+I+KDA +
Sbjct  41    LSFEEISKYFSLPIAEAASNLGVCTSALKRICRENGIIRWPYRKFLAGKTVEDIRKDAER  100

Query  444   ekqeqhaeLPKPAGEKPNLS------ANSTPSTSKGSPLQNKGSSAA-------QEMPKS  584
             E+ ++  ELPK A ++ ++S      +  + ST+ G+ +QN+  S         Q +P  
Sbjct  101   ERNKELTELPKIANQRTDVSKVMPSTSVGSSSTTYGNQVQNRAPSVTQGALKLQQGVPMP  160

Query  585   AAASQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDG  764
                 Q QG+K +QT     +    +P       DEFKYGFP++GLS++S KWWGS + + 
Sbjct  161   GHVLQSQGNKFSQTNWPNMIQYRGIPTFM----DEFKYGFPANGLSSVSVKWWGSGNKED  216

Query  765   NEDTKKEGNA---EESKQQSAVPMEESAVKTGKSNVDSFRAD---------SLSDLREQA  908
              E    E +    EE+K+   +  E S       + D    D         S   LR +A
Sbjct  217   TERMLPEESGTIKEENKEPHELSNETSNGIVKDDHPDHSTQDVASVTGPTTSFCSLRRKA  276

Query  909   AKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
              + G E L+ G+ + ++ +KL   +R  LLQVFKSS P QW
Sbjct  277   VEHGCETLKGGISKGYTSYKLGKRQRLALLQVFKSSLPDQW  317



>ref|XP_011082903.1| PREDICTED: uncharacterized protein LOC105165548 [Sesamum indicum]
Length=389

 Score =   156 bits (395),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 113/197 (57%), Positives = 141/197 (72%), Gaps = 5/197 (3%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
            KS SF+EVS LFS+PLSDAAD+LGVC SVLKK+CYENGLVRWPYRKFLSGKSIEEIKKDA
Sbjct  37   KSPSFEEVSTLFSVPLSDAADSLGVCPSVLKKVCYENGLVRWPYRKFLSGKSIEEIKKDA  96

Query  438  akekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKT  617
            A EK++Q AEL K AGE+    A+S  S+S G   Q     ++QE   +     QQ +K 
Sbjct  97   AIEKEKQLAEL-KVAGERKETLASSAVSSSLGPRPQITNIGSSQET-STLRMLPQQPTKD  154

Query  618  AQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRS-TDGNEDTKKEG--  788
             QT +S ++ S  + KA +A  DEFKYGFPS GLS++SY+WWGSRS  D + D+++ G  
Sbjct  155  NQTETSLNMHSSTMNKANSATFDEFKYGFPSHGLSSVSYRWWGSRSDNDSSGDSQQTGSE  214

Query  789  NAEESKQQSAVPMEESA  839
            NAEE  QQ  V ++ +A
Sbjct  215  NAEERMQQGKVSVDTAA  231


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  828   EESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVF  1007
             EE+  K  +++ D   A  LS LR++A KEGK+AL+LGVY++H++  LD  K+ VLLQ+F
Sbjct  315   EETEAKKNETHSDPQWAGLLSALRKRANKEGKQALKLGVYKKHNMTTLDRNKKMVLLQIF  374

Query  1008  KSSYPPQW  1031
             KSS    W
Sbjct  375   KSSLLSDW  382



>ref|XP_010904856.1| PREDICTED: uncharacterized protein LOC105032179 [Elaeis guineensis]
Length=317

 Score =   151 bits (381),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 159/282 (56%), Gaps = 32/282 (11%)
 Frame = +3

Query  258   KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
             +  S +E+SK FSLP+++AA  LGVCT VLK+IC ENG+VRWPYRKFL+GK++E+IKKD 
Sbjct  39    RKFSLEEISKYFSLPIAEAASILGVCTRVLKRICRENGIVRWPYRKFLAGKTVEDIKKDT  98

Query  438   akekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQE-------MPKSAAAS  596
              +E+ +   ELPK A ++ ++S     S++ G+ +Q++  S  QE       +P      
Sbjct  99    ERERTKDLTELPKMANQRTDVSRVMPSSSTFGNQVQSRTLSGTQEALKLQRGVPMPGHVL  158

Query  597   QQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT  776
             Q QG+K +       +    +P       DEF  GFP++GLS++S KWWG  S    EDT
Sbjct  159   QSQGNKFSHNNWPNMIQYRGIPTYM----DEFINGFPANGLSSVSIKWWGRSS---KEDT  211

Query  777   KK-------EGNAEESKQQSAVPMEESAVK----------TGKSNVDSFRADSLSDLREQ  905
             +K       +G+ +ES Q S   +    VK          T  S   +  + SL  LR +
Sbjct  212   EKALPEETIKGDNQESCQLSN-EISRHMVKDDHPGGPDHSTEDSAAITEPSSSLCSLRRK  270

Query  906   AAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             A + G++ L+ GV + ++ +KL   +R  L QVFKSS P QW
Sbjct  271   AVECGRKTLKGGVSKGYTTYKLGKRQRLALFQVFKSSLPDQW  312



>ref|XP_010673598.1| PREDICTED: protein NLP9 [Beta vulgaris subsp. vulgaris]
Length=275

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 115/269 (43%), Positives = 171/269 (64%), Gaps = 22/269 (8%)
 Frame = +3

Query  258   KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkda  437
             +S+SF+ VSKLFSLPLS+AAD LGV +SVLKK+C ENGL RWP+RKFL+GK+IEEIKK+A
Sbjct  13    QSVSFEHVSKLFSLPLSEAADILGVSSSVLKKLCNENGLQRWPHRKFLAGKNIEEIKKEA  72

Query  438   akekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKT  617
             A+ K +    +   +    +++  S+ +TS GS +++K   +A EM KS  ++Q+ GSKT
Sbjct  73    AELKSKAVGGISPTS----DVTTASSTTTSPGSHIKDKSPRSALEMSKSQGSTQEPGSKT  128

Query  618   AQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGNAE  797
               T  + H+L+  L   T   SDEFKYGFPS GLS  S +WW S S DGN DTK     E
Sbjct  129   TITWRTHHVLASGLASETNTFSDEFKYGFPSGGLSECSNRWWRS-SFDGN-DTKTSSKIE  186

Query  798   E-SKQQ-----SAVPMEESAVKTGKSNVDSFRAD----------SLSDLREQAAKEGKEA  929
             + +K Q     S++  E++   T +S  D+ + +          SLS +R++A +EGKEA
Sbjct  187   DITKVQADGGISSICEEKANNATRESECDNKQDEVSECDKQNEVSLSAVRKRALEEGKEA  246

Query  930   LRLGVYREHSLFKLDLTKRKVLLQVFKSS  1016
             L+    +++   KL   ++ +L +++++S
Sbjct  247   LKFRALKKYGADKLGNEEKILLRRLYQTS  275



>ref|XP_010916091.1| PREDICTED: uncharacterized protein LOC105041008 isoform X2 [Elaeis 
guineensis]
Length=317

 Score =   146 bits (368),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 105/281 (37%), Positives = 155/281 (55%), Gaps = 34/281 (12%)
 Frame = +3

Query  264   LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaak  443
             LSF+E+SK FSLP+++AA  LGVCTS LK+IC ENG++RWPYRK +      +I+KDA +
Sbjct  41    LSFEEISKYFSLPIAEAASNLGVCTSALKRICRENGIIRWPYRKTVE-----DIRKDAER  95

Query  444   ekqeqhaeLPKPAGEKPNLS------ANSTPSTSKGSPLQNKGSSAA-------QEMPKS  584
             E+ ++  ELPK A ++ ++S      +  + ST+ G+ +QN+  S         Q +P  
Sbjct  96    ERNKELTELPKIANQRTDVSKVMPSTSVGSSSTTYGNQVQNRAPSVTQGALKLQQGVPMP  155

Query  585   AAASQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDG  764
                 Q QG+K +QT     +    +P       DEFKYGFP++GLS++S KWWGS + + 
Sbjct  156   GHVLQSQGNKFSQTNWPNMIQYRGIPTFM----DEFKYGFPANGLSSVSVKWWGSGNKED  211

Query  765   NEDTKKEGNA---EESKQQSAVPMEESAVKTGKSNVDSFRAD---------SLSDLREQA  908
              E    E +    EE+K+   +  E S       + D    D         S   LR +A
Sbjct  212   TERMLPEESGTIKEENKEPHELSNETSNGIVKDDHPDHSTQDVASVTGPTTSFCSLRRKA  271

Query  909   AKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
              + G E L+ G+ + ++ +KL   +R  LLQVFKSS P QW
Sbjct  272   VEHGCETLKGGISKGYTSYKLGKRQRLALLQVFKSSLPDQW  312



>gb|KDO60982.1| hypothetical protein CISIN_1g023462mg [Citrus sinensis]
Length=243

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 144/242 (60%), Gaps = 27/242 (11%)
 Frame = +3

Query  342   VLKKICYENGLVRWPYRKFLSGksieeikkdaakekqeqhaeLPKPAGEKPNLSANSTPS  521
             ++ KIC +NGL RWPYRKFLSGKSIE+IKK AA+EK ++ AEL K A             
Sbjct  16    IISKICRDNGLDRWPYRKFLSGKSIEDIKKYAAREKSKELAELSKIA------------R  63

Query  522   TSKGSPLQNKGSSAAQEMPKSAAASQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYG  701
              S   PL N+ S        S    QQQGSK +       LL+ NL K   A  DEFK+G
Sbjct  64    KSGFQPLSNETSKL--HGVTSPPNLQQQGSKNSPVGQPHVLLNANLTKGIMA-LDEFKHG  120

Query  702   FPSDGLSAISYKWWGSRSTDGNEDTKKEGNA--EESKQQSAVPMEESAVK-TG-------  851
             FPSDGLS  SYKWWG RS+DGN+   K+ +   EE KQ  A   +ESA + TG       
Sbjct  121   FPSDGLSTASYKWWGGRSSDGNDGIHKDESEIDEEDKQAEAKADKESATQATGNEKSGNG  180

Query  852   --KSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPP  1025
               +SNVD   +  L+  R++  +EG+EAL+LGVY+++ + +LD  +R +L ++FKSS P 
Sbjct  181   ETESNVDPQGSGLLTAARKRTVEEGREALKLGVYKKYCVKQLDRKERVLLHRIFKSSLPK  240

Query  1026  QW  1031
             +W
Sbjct  241   EW  242



>ref|XP_009421485.1| PREDICTED: uncharacterized protein LOC104001033 [Musa acuminata 
subsp. malaccensis]
Length=300

 Score =   142 bits (358),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 101/268 (38%), Positives = 155/268 (58%), Gaps = 10/268 (4%)
 Frame = +3

Query  261   SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaa  440
             +L+FDE+SKLFSLP+++AA  LGVCTSVLKKIC + G+VRWPYRK+L+GK++E+I++D A
Sbjct  31    TLTFDEISKLFSLPIAEAAPVLGVCTSVLKKICRDYGIVRWPYRKYLAGKTVEDIRRDIA  90

Query  441   kekqeqhaeLPKP--AGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSK  614
             KE+ ++ A+L K     +  N+ ++   S S  +P   + SS  Q +      SQ QGS+
Sbjct  91    KERSKELADLSKTNQKNDVSNVMSSPVGSLSALTPNPAQESSKMQRVSMPGHVSQLQGSR  150

Query  615   TAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWG-------SRSTDGNED  773
               Q     ++L  N  K      D+FKYGFP +GLS+ S+KWWG        R+  G  +
Sbjct  151   FTQN-GWPNVLHQNQSKNIPTFMDDFKYGFPENGLSSTSFKWWGISRLEETERTVPGEGE  209

Query  774   TKKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYRE  953
             T  E +  +  Q S+   EE       + + +  +  L  LR ++ + G+E+L+ G+   
Sbjct  210   TTTEKDDNQEVQDSSNEGEEPDSGAEDNVIVTKPSALLCSLRRKSVEYGRESLKRGISVA  269

Query  954   HSLFKLDLTKRKVLLQVFKSSYPPQWEQ  1037
                 KL   ++  L QVF SS P +W++
Sbjct  270   GIPNKLTKRQKLTLSQVFGSSLPEEWKE  297



>ref|XP_006857943.1| hypothetical protein AMTR_s00069p00159620 [Amborella trichopoda]
 gb|ERN19410.1| hypothetical protein AMTR_s00069p00159620 [Amborella trichopoda]
Length=300

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 115/299 (38%), Positives = 158/299 (53%), Gaps = 56/299 (19%)
 Frame = +3

Query  261   SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaa  440
             SL+FD+V++ FSLP+++AA  LGVCTSVLKKIC ENG++RWPYRKF +GK++EEIK+DAA
Sbjct  11    SLTFDDVARFFSLPIAEAASLLGVCTSVLKKICRENGVLRWPYRKFQAGKTVEEIKRDAA  70

Query  441   kekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAA------------------  566
             +E+ +   +L K    + ++S +S      G  L   GSS++                  
Sbjct  71    RERSKGFLDLSKSERLQDDVSVDS------GKNLALDGSSSSLISPVLGSQPYNGDIIST  124

Query  567   -------QEMPKSAAASQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSA  725
                    QE+P+    S Q G+K  Q  +  H       K+     DEFKYGFPSDGLS 
Sbjct  125   QDIPKLQQEIPQVVQISPQPGNKILQN-AKHH-------KSVLTYLDEFKYGFPSDGLSC  176

Query  726   ISYKWWGSRSTDG-----NEDTKKEGNAEESKQQSAVPMEES--------AVKTGK----  854
             IS KWW   + DG     N   K   + + S     V  EE+          KT +    
Sbjct  177   ISNKWWVPDNPDGIDGPENSVVKYALSTQNSANGLVVCSEEAQNSGPTICLAKTKRRQDL  236

Query  855   SNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             S+ +   A  LS +RE+  + G+EAL+LG  R +   KL   +R VLL+ F SS P QW
Sbjct  237   SDEELGGAVLLSSIRERNTEYGREALKLGFSRGYDGSKLGGRERVVLLKAFGSSLPSQW  295



>emb|CDM82463.1| unnamed protein product [Triticum aestivum]
Length=296

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 106/279 (38%), Positives = 150/279 (54%), Gaps = 34/279 (12%)
 Frame = +3

Query  243   IKTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksiee  422
             IK    SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK +SG    +
Sbjct  31    IKPTRVSLSYEEISKLFSLPIAEAASILGVCTSVLKRICRTHGIVRWPYRKIVSG--KGD  88

Query  423   ikkdaakekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQ  602
               K+A +EK  Q  EL K A +K   S+ S  ++S G         A Q +PK+     Q
Sbjct  89    DAKNAEREKAMQLLELSKIAKQKAISSSGSLATSSSG---------AFQGVPKA-----Q  134

Query  603   QGSKTAQTLSSQH----LLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRS---TD  761
             QGS  A T   +     L   +  K      D+FKYGFPS GLS  + KWWG+ S   T 
Sbjct  135   QGSAKAGTAIGRQNAPSLSQFSQAKDIPTYMDDFKYGFPSSGLSTETMKWWGTDSHTETA  194

Query  762   GNEDTKKEGNAEESKQQSAVPMEESAVKTG----KSNVDSFRADS-----LSDLREQAAK  914
               +D  +EG+  ES  +++  M +  +  G    +++ D   A +     L  LR +AA 
Sbjct  195   PAKDDNREGS--ESTNEASKGMTDDELDWGADEPEADADGVAAATDPSAQLCSLRRKAAG  252

Query  915   EGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             +G+  L     R   L +L+  ++ VL QVF +S P  W
Sbjct  253   DGRRLLNGDTGRVQQLCRLNKRQKIVLAQVFGASLPEHW  291



>dbj|BAK02178.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   125 bits (315),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 95/280 (34%), Positives = 140/280 (50%), Gaps = 35/280 (13%)
 Frame = +3

Query  243   IKTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksiee  422
             IK    SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK +SGK  + 
Sbjct  79    IKPTRVSLSYEEISKLFSLPIAEAASILGVCTSVLKRICRTHGIVRWPYRKIVSGKGDDV  138

Query  423   ikkdaakekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQ  602
                              K A  +  +        +K   + + GS         A +  Q
Sbjct  139   -----------------KNAEREKAMQLLELSKIAKQKAISSSGSLTTSSGAFQAVSKAQ  181

Query  603   QGS-KTAQTLSSQHLLSV---NLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRS---TD  761
             QGS K    +  Q++ S+   +  K      D+FKYGFPS GLS  + KWW + S   T 
Sbjct  182   QGSAKAGSAIGRQNVPSLSQFSQAKDIPTYMDDFKYGFPSSGLSTETMKWWATDSHTETV  241

Query  762   GNEDTKKEGNAEESKQQSAVPMEESAVKTG----KSNVDSFRADS-----LSDLREQAAK  914
               +D  +EG+  ES  +++  M +  +  G    +++ D   A +     L  LR +AA 
Sbjct  242   AVKDDNREGS--ESTNEASKGMTDDELDWGADEPEADADGMDAATDPSAQLCSLRRKAAG  299

Query  915   EGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQWE  1034
             +G+  L     R   L +L+  ++ VL QVF +S P QW 
Sbjct  300   DGRRLLNGDTGRVQQLCRLNKRQKIVLAQVFGASLPEQWR  339



>ref|NP_001140342.1| uncharacterized protein LOC100272390 [Zea mays]
 gb|ACF83619.1| unknown [Zea mays]
 gb|ADX60138.1| RWP-RK transcription factor [Zea mays]
 tpg|DAA52678.1| TPA: hypothetical protein ZEAMMB73_231209 [Zea mays]
Length=284

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 92/274 (34%), Positives = 137/274 (50%), Gaps = 36/274 (13%)
 Frame = +3

Query  261   SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaa  440
             SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK +SGK+ ++ K    
Sbjct  20    SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRTHGIVRWPYRKLVSGKAGDDTKG---  76

Query  441   kekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKTA  620
                         P  +K N     +    + +P  +  S  +    + AA SQQ  SK  
Sbjct  77    ------------PDSDKANELLEVSKIAKQKAPSASGPSVVSSSTSQGAAKSQQGNSKAG  124

Query  621   QTLSS----QHLLSVNL----PKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT  776
             Q   S    +H  S++L     KA     D+FKYGFPS GLS  + KWWG+ S+D +   
Sbjct  125   QFSVSPPTGKHNASLSLTHSQAKAIPCYMDDFKYGFPSSGLSCETMKWWGT-SSDTDYVP  183

Query  777   KKEGNAEESKQQSAVPME------------ESAVKTGKSNVDSFRADSLSDLREQAAKEG  920
              K+G+ E  +  +  P +            + A       V +  +  L  LR +A  +G
Sbjct  184   TKDGSHEPHESTTHEPSKGMTDDDELDWGADEAEAEADGTVTAEASAQLCSLRRKAVDDG  243

Query  921   KEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYP  1022
             ++ L     R     +L+  ++  L QVF +S P
Sbjct  244   RKLLNGHNRRGQEFSRLNKRQKTALAQVFGASLP  277



>ref|XP_002454862.1| hypothetical protein SORBIDRAFT_03g000260 [Sorghum bicolor]
 gb|EER99981.1| hypothetical protein SORBIDRAFT_03g000260 [Sorghum bicolor]
Length=289

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 98/273 (36%), Positives = 143/273 (52%), Gaps = 31/273 (11%)
 Frame = +3

Query  261   SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaa  440
             SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK +SG    +  K   
Sbjct  20    SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRTHGIVRWPYRKLVSG-KAGDDTKGPD  78

Query  441   kekqeqhaeLPKPAGEKPNLSANSTP-----STSKGSPLQNKGSSAAQEMPKSAAASQQQ  605
             ++K ++  EL K   +K   S+ S P     STS+G+    +GSS A ++  S  A +Q 
Sbjct  79    RDKAKELLELSKIVKQK--ASSASGPSIVSSSTSQGAAKSQQGSSKAGQISVSPPAGKQN  136

Query  606   GSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKE  785
                     +S  L   +  KA  +  D+FKYGFPS GLS  + KWWG+ S+D +    K+
Sbjct  137   --------TSPSLAHGSQAKAIPSYMDDFKYGFPSSGLSCETMKWWGT-SSDTDCVPAKD  187

Query  786   GNAEESKQQSAVP--------------MEESAVKTGKSNVDSFRADSLSDLREQAAKEGK  923
             G+ E     +  P               E  A       V +  +  L  LR +A  +G+
Sbjct  188   GSHEAHDLTTHEPSKGMTDDDELDWGADEAEAEAEADGAVTAEASAQLCSLRRKAVDDGR  247

Query  924   EALRLGVYREHSLFKLDLTKRKVLLQVFKSSYP  1022
             + L  G  R     +L+  ++ VL QVF +S P
Sbjct  248   KLLNGGNRRGQEFSRLNKRQKLVLAQVFGASLP  280



>ref|XP_004967322.1| PREDICTED: uncharacterized protein LOC101771632 [Setaria italica]
Length=279

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 137/274 (50%), Gaps = 39/274 (14%)
 Frame = +3

Query  261   SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaa  440
             SLS++E+SKLFSLP+++AA  LGV TSVLK+IC  +G+VRWPYRK +S K+ ++ K    
Sbjct  16    SLSYEEISKLFSLPIAEAASILGVGTSVLKRICRTHGIVRWPYRKLVSAKTGDDTKGPER  75

Query  441   kekqeqhaeLPKPAGEKPNLS--ANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSK  614
                        + A E P LS  A    S S  SP+ +  +S      + AA SQQ  SK
Sbjct  76    -----------EKAKELPELSKIAKQKASNSSASPIVSSTTS------QGAAKSQQGSSK  118

Query  615   TAQTLSSQHLLSVNLPKATTAGS---------DEFKYGFPSDGLSAISYKWWGSRSTDGN  767
               Q   S    + N+  +   GS         D+FKYGFPS GLS  + KWWG  S+D +
Sbjct  119   AGQVSVSPPAGNQNMSPSLAHGSQAKAIPSYMDDFKYGFPSSGLSCGTMKWWGG-SSDAD  177

Query  768   EDTKKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADS---------LSDLREQAAKEG  920
                 K+G+ E   + S    E+  +  G    ++  AD          L  LR +A  +G
Sbjct  178   CAPTKDGSREAHGEASKGMTEDDELDWGADEAET-EADGAVTAEASAQLCSLRRKAVDDG  236

Query  921   KEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYP  1022
             ++ L     R     +L+  ++  L QVF +S P
Sbjct  237   RKLLNGDTRRGQEFSRLNKRQKLALAQVFGASLP  270



>ref|XP_010230688.1| PREDICTED: uncharacterized protein LOC104582530 [Brachypodium 
distachyon]
Length=282

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 94/269 (35%), Positives = 133/269 (49%), Gaps = 44/269 (16%)
 Frame = +3

Query  261   SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaa  440
             SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK +SGK+ +++K    
Sbjct  41    SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRTHGIVRWPYRKIVSGKTGDDVKNAER  100

Query  441   kekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKTA  620
             ++ +               L   S  +  K SP         Q +PKS     QQGS   
Sbjct  101   EKAK--------------ELLELSKIAKQKASP------GGLQGVPKS-----QQGS---  132

Query  621   QTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGN-AE  797
              T +   L  V+  K      D+FK GFPS GLS  + KWWG+ S       K +   A 
Sbjct  133   -TKAGPSLAHVSQAKDIPTYMDDFKNGFPSSGLSCETMKWWGASSHTETASAKGDSREAP  191

Query  798   ESKQQSAVPMEESAVKTGKSNVDSFRADS-----------LSDLREQAAKEGKEALRLGV  944
             ES  +++  M +  +  G    D   AD+           L  LR +AA +G+  L    
Sbjct  192   ESTNEASKGMTDDELDWG---ADEAEADTDGVVTSEPSAQLCSLRRKAAGDGRRLLNGDT  248

Query  945   YREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
              R     +L+  ++  L QVF +S P QW
Sbjct  249   GRGQGFCRLNKRQKIALAQVFGASLPEQW  277



>ref|XP_004986052.1| PREDICTED: uncharacterized protein LOC101760145 [Setaria italica]
Length=279

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 95/265 (36%), Positives = 142/265 (54%), Gaps = 21/265 (8%)
 Frame = +3

Query  261   SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaa  440
             SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK +SG    +  K   
Sbjct  16    SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSHGIVRWPYRKLVSG-KAGDDTKGPE  74

Query  441   kekqeqhaeLPKPAGEKP---NLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGS  611
             +EK ++  EL K A +K    + S+  + STS+G+    +GSS A ++  S  A +Q  S
Sbjct  75    REKAKELLELSKIAKQKALSPSGSSIVSSSTSQGAAKSQQGSSKAGQVSVSPPAGKQNAS  134

Query  612   KTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGN  791
              +        L   +  KA     D+FKYGFPS GL   + KWWG  S+D + +  K+GN
Sbjct  135   PS--------LAHGSQTKAIPGYMDDFKYGFPSSGLPCETMKWWGG-SSDTDCELTKDGN  185

Query  792   AEESKQQSAVPMEESAVKTGKSN--------VDSFRADSLSDLREQAAKEGKEALRLGVY  947
              E   + S    ++  +  G           V +  +  L  L  +A  +G++ L  G  
Sbjct  186   REAHGEASKGMTDDDELDWGADEGEAEADGAVTAEASGQLCSLTRKAVDDGRKLLNGGTR  245

Query  948   REHSLFKLDLTKRKVLLQVFKSSYP  1022
             R     +L+  ++  L QVF +S P
Sbjct  246   RGREFSRLNKRQKVALAQVFGASLP  270



>dbj|BAB40070.1| unknown protein [Oryza sativa Japonica Group]
Length=310

 Score =   117 bits (294),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 139/276 (50%), Gaps = 35/276 (13%)
 Frame = +3

Query  261   SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaa  440
             SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK +SG    +  K+A 
Sbjct  44    SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSHGIVRWPYRKLVSG-KSGDDTKNAE  102

Query  441   kekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKTA  620
             +EK +   E+ K A +K  LSA+   + S G+              +  A SQQ  SK  
Sbjct  103   REKAKGLLEISKVAKQKA-LSASGLSTVSPGA-------------FQGVAKSQQGSSKAG  148

Query  621   Q--------TLSSQHLLSVNL-PKATTAGSDEFKYGFPSDGLSAISYKWWGSRS-TDGNE  770
             Q         L    +LS     K      D+FKYGFPS GLS  + KWWG+ S T+   
Sbjct  149   QVSPPGKQNVLGGSAILSYGTQTKGIPTYMDDFKYGFPSSGLSLQTMKWWGTDSHTETTP  208

Query  771   DTKKEGNAEESKQQSAVPMEESAVKTG----------KSNVDSFRADSLSDLREQAAKEG  920
                  G A ES  +++  M +  +  G           S + +  +  L  LR +A  +G
Sbjct  209   AKDDNGEAPESANEASKGMTDDELDWGADEAEAEADADSAITTEPSAQLCSLRRKAVDDG  268

Query  921   KEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQ  1028
             ++ L         L +L+  ++  L QVF +S P Q
Sbjct  269   RKLLTGKSCGGLELCRLNKRQKMALAQVFGASLPEQ  304



>ref|NP_001042575.1| Os01g0246500 [Oryza sativa Japonica Group]
 dbj|BAF04489.1| Os01g0246500 [Oryza sativa Japonica Group]
Length=315

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 139/276 (50%), Gaps = 35/276 (13%)
 Frame = +3

Query  261   SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaa  440
             SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK +SG    +  K+A 
Sbjct  49    SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSHGIVRWPYRKLVSG-KSGDDTKNAE  107

Query  441   kekqeqhaeLPKPAGEKPNLSANSTPSTSKGSPLQNKGSSAAQEMPKSAAASQQQGSKTA  620
             +EK +   E+ K A +K  LSA+   + S G+              +  A SQQ  SK  
Sbjct  108   REKAKGLLEISKVAKQKA-LSASGLSTVSPGA-------------FQGVAKSQQGSSKAG  153

Query  621   Q--------TLSSQHLLSVNL-PKATTAGSDEFKYGFPSDGLSAISYKWWGSRS-TDGNE  770
             Q         L    +LS     K      D+FKYGFPS GLS  + KWWG+ S T+   
Sbjct  154   QVSPPGKQNVLGGSAILSYGTQTKGIPTYMDDFKYGFPSSGLSLQTMKWWGTDSHTETTP  213

Query  771   DTKKEGNAEESKQQSAVPMEESAVKTG----------KSNVDSFRADSLSDLREQAAKEG  920
                  G A ES  +++  M +  +  G           S + +  +  L  LR +A  +G
Sbjct  214   AKDDNGEAPESANEASKGMTDDELDWGADEAEAEADADSAITTEPSAQLCSLRRKAVDDG  273

Query  921   KEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQ  1028
             ++ L         L +L+  ++  L QVF +S P Q
Sbjct  274   RKLLTGKSCGGLELCRLNKRQKMALAQVFGASLPEQ  309



>ref|XP_009377316.1| PREDICTED: uncharacterized protein LOC103965934 [Pyrus x bretschneideri]
Length=173

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 95/158 (60%), Gaps = 13/158 (8%)
 Frame = +3

Query  594   SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
             +QQ+GSK  QT  SQ++L+  L K  T   DEFKYGFPSDGLS  S KWWGS S DGNE 
Sbjct  12    AQQKGSKNVQTGHSQNMLTSTLTKGNTT-YDEFKYGFPSDGLSTASNKWWGSNSPDGNEG  70

Query  774   TKKEG-NAEESKQ----------QSAVPMEESAVKTGK-SNVDSFRADSLSDLREQAAKE  917
              + +G   EE K+           S++ ++    ++GK  N+     D L  +R +AA+E
Sbjct  71    LRGKGAKTEEDKKPQSDKLADDNASSIIVDTEKPESGKEENISPQGTDLLVSVRRRAAEE  130

Query  918   GKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
              ++AL LG +R +   KL   +RK+LL++FKSS P QW
Sbjct  131   NQKALELGAFRGYGAKKLGRRERKLLLRIFKSSTPKQW  168



>ref|XP_008229431.1| PREDICTED: uncharacterized protein LOC103328797 [Prunus mume]
Length=174

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 98/161 (61%), Gaps = 13/161 (8%)
 Frame = +3

Query  594   SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
             +QQQGSK  QT   Q++L+++L K  T   DEFK+GFPSDGLS  S KWWGS S DG E 
Sbjct  13    AQQQGSKNVQTGRPQNILTLSLTKGNTT-YDEFKHGFPSDGLSTASNKWWGSNSPDGYES  71

Query  774   TKKEG-NAEESKQQ----------SAVPMEESAVKTGK-SNVDSFRADSLSDLREQAAKE  917
              + +G   +E K+           S+  ++    ++GK  N+ S   D L  +R+++ +E
Sbjct  72    VRGQGAETDEGKKHQSEKLADDGASSTVVDREKCESGKEENISSKGTDLLMAVRKRSLEE  131

Query  918   GKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQWEQE  1040
             G++AL+LGV+R +   KL   +R +LL++FKSS P QW  E
Sbjct  132   GQKALKLGVFRGYGAKKLGRRERALLLRIFKSSTPEQWIHE  172



>ref|XP_007215066.1| hypothetical protein PRUPE_ppa012313mg [Prunus persica]
 gb|EMJ16265.1| hypothetical protein PRUPE_ppa012313mg [Prunus persica]
Length=174

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 98/161 (61%), Gaps = 13/161 (8%)
 Frame = +3

Query  594   SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
             +QQQGSK  QT   Q++L+++L K  T   DEFK+GFPSDGLS  S KWWGS S DG E 
Sbjct  13    AQQQGSKNVQTGRPQNVLTLSLTKGNTT-YDEFKHGFPSDGLSTASNKWWGSNSPDGYES  71

Query  774   TKKEG--NAEESKQQ---------SAVPMEESAVKTGK-SNVDSFRADSLSDLREQAAKE  917
              + EG    E+ K Q         S+  +++   ++GK  N+ +   D L  +R+ + +E
Sbjct  72    VRGEGAETDEDKKHQSEKLADDGASSTVVDKEKCESGKEENISTQGTDLLMAVRKGSLEE  131

Query  918   GKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQWEQE  1040
             G++AL+LGV+R +   KL   +R +LL++FKSS P QW  E
Sbjct  132   GQKALKLGVFRGYGAKKLGRRERALLLRIFKSSTPKQWIHE  172



>ref|XP_006643988.1| PREDICTED: protein NLP2-like [Oryza brachyantha]
Length=296

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 139/267 (52%), Gaps = 21/267 (8%)
 Frame = +3

Query  261   SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSGksieeikkdaa  440
             SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK +SG    +  K A 
Sbjct  35    SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSHGIVRWPYRKLVSG-KSGDDTKSAE  93

Query  441   kekqeqhaeLPKPAGEKPNLSANS----TPSTSKGSPLQNKGSSAAQEMPKSAAASQQQG  608
             +EK ++  E+ + A +K  LSA+     +P T +G     +GSS A ++      +   G
Sbjct  94    REKAKELLEISRLAKQKA-LSASGLSTVSPGTFQGVAKSQQGSSKAGQVSPPGKQNALSG  152

Query  609   SKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKE-  785
             S          L      KA     D+FK+GFPS GLS  + KWWG+ S       K E 
Sbjct  153   SGI--------LAHGTQTKAIPTYMDDFKHGFPSCGLSWETMKWWGTDSHTETTPAKDEN  204

Query  786   GNAEESKQQSAVPMEE------SAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVY  947
             G A ES  +++  M +       A +     + +  +  L  LR +A  +G++ L     
Sbjct  205   GEAPESANEASKGMTDDDELDWGADEAEAEAITTEPSAQLCTLRRKAVDDGRKLLTGKTC  264

Query  948   REHSLFKLDLTKRKVLLQVFKSSYPPQ  1028
                 L +L+  ++  L QVF +S P Q
Sbjct  265   GSLELCRLNKRQKMALAQVFGASLPEQ  291



>ref|XP_008366561.1| PREDICTED: uncharacterized protein LOC103430202 [Malus domestica]
Length=174

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 95/158 (60%), Gaps = 13/158 (8%)
 Frame = +3

Query  594   SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
             +QQ+GSK  Q+  SQ++L+  L K  T   DEFKYGFPSDGLS  S KWWGS S DGNE 
Sbjct  13    AQQKGSKNVQSGHSQNMLTSTLTKGNTT-YDEFKYGFPSDGLSTASNKWWGSNSPDGNEG  71

Query  774   TKKEG-NAEESKQ----------QSAVPMEESAVKTGKS-NVDSFRADSLSDLREQAAKE  917
              + +G   EE K+           S++ ++    ++GK  N+     D L  +R +A +E
Sbjct  72    LRGKGAKTEEDKKPQSDKLADDNASSIMVDTEKPESGKDENISPQGTDLLVSVRRRAVEE  131

Query  918   GKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
              ++AL+LG +R +   KL   +RK+LL++FKSS P QW
Sbjct  132   NQKALKLGAFRGYGAKKLGRRERKLLLRIFKSSTPKQW  169



>ref|XP_004303879.1| PREDICTED: uncharacterized protein LOC101310432 [Fragaria vesca 
subsp. vesca]
Length=167

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 93/158 (59%), Gaps = 15/158 (9%)
 Frame = +3

Query  597   QQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT  776
              QQGSK  QT    +LL+++L K TT   +EFK GFPS+GLS  S +WWGS S D +E  
Sbjct  7     HQQGSKNVQTGRPHNLLTLSLTKGTTL--EEFKSGFPSEGLSTASNRWWGSNSPDCDEGI  64

Query  777   KKEGNA--EESKQQSAVPMEESAV-------KTG----KSNVDSFRADSLSDLREQAAKE  917
               E +   EE+K QS    ++SA        K G    ++N+D    D L  +R++A +E
Sbjct  65    HGEADNADEENKHQSNKLADDSASSITGNQEKCGSEKQENNIDPQGTDLLVAVRKRAVEE  124

Query  918   GKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             GK+A +LGV+R +   KL   +R +LL++F+SS P  W
Sbjct  125   GKKARKLGVFRGYGARKLGRKERTMLLRIFESSLPKDW  162



>ref|XP_004303880.1| PREDICTED: uncharacterized protein LOC101310720 [Fragaria vesca 
subsp. vesca]
Length=174

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 97/170 (57%), Gaps = 17/170 (10%)
 Frame = +3

Query  567   QEMPKSAAAS---QQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYK  737
             Q  P+   AS   QQQGSK  QT    +LL+++L K TT   +E K GFPS+GLS  S +
Sbjct  2     QSKPQGVMASNNLQQQGSKNVQTGRPHNLLTLSLTKGTTL--EELKNGFPSEGLSTASNR  59

Query  738   WWGSRSTDGNEDTKKEGNA--EESKQQS----------AVPMEESAVKTGKSNVDSFRAD  881
             WWGS S D ++  + E     EE+K QS          A   E+   +  ++++D    D
Sbjct  60    WWGSNSLDCDKGIRGEAAKADEENKHQSNKLADGASSIAENKEKCESEKEENSIDPQGTD  119

Query  882   SLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
              L  +R+QA +EGK+AL+LGV+R +   KL   +R +LL++FKSS P  W
Sbjct  120   LLVAVRKQAVEEGKKALKLGVFRGYGAKKLGRKERTLLLRIFKSSLPKDW  169



>emb|CAN71458.1| hypothetical protein VITISV_007604 [Vitis vinifera]
Length=302

 Score =   102 bits (254),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 97/190 (51%), Gaps = 18/190 (9%)
 Frame = +3

Query  516   PSTSKGSPLQNKGSSAAQEMPKSAAAS-----QQQGSKTAQTLSSQHLLSVNLPKATTAG  680
             P    GS  QN   S+  +M K   A      QQQGS+  Q    Q+L + +L K   A 
Sbjct  108   PDCHIGSQPQNDTKSSLWKMSKLHGAIPPHMLQQQGSRNIQNGRPQNLPNASLSKGIAAS  167

Query  681   SDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGNA--EESKQQS-----------AV  821
              DEFKYGFP+ GL+  S KWWGS S DG E T   G    EE K+QS            +
Sbjct  168   LDEFKYGFPTSGLATASNKWWGSSSPDGYEGTIGNGVEIDEEDKKQSEQLADNGANLLVM  227

Query  822   PMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQ  1001
               E++  +  +  +       L+ +R+   +EG++ L++GV R+H + K    +R++LLQ
Sbjct  228   DGEKAENEKEEGTIGPQGTGLLTAVRKTTVEEGRKILKIGVGRDHGVLKAGKKERRLLLQ  287

Query  1002  VFKSSYPPQW  1031
             +F SS P QW
Sbjct  288   IFGSSLPSQW  297



>ref|XP_004499986.1| PREDICTED: uncharacterized protein LOC101501187 [Cicer arietinum]
Length=181

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 86/154 (56%), Gaps = 11/154 (7%)
 Frame = +3

Query  594   SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
             S QQG+K+ +   +Q+L +  L K TT  +DEFKYGFPS+ LS  S KWWG    +   D
Sbjct  31    SHQQGNKSVEIGRTQNLPNTVLAKGTTT-TDEFKYGFPSESLSTTSNKWWGCSDRNDRVD  89

Query  774   TKKEGNAEESKQQ------SAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALR  935
             T    N +E+K Q       AV ME    KT  S      +  L  +R++A +EG+EA +
Sbjct  90    T----NPDETKSQPEESGGEAVKMECETEKTENSEETPEGSSVLRTVRKRAVEEGREAFK  145

Query  936   LGVYREHSLFKLDLTKRKVLLQVFKSSYPPQWEQ  1037
             LGV+R + + KL   ++ +L Q+F SS P  W Q
Sbjct  146   LGVFRGYGVNKLGKREKILLHQIFGSSLPKSWIQ  179



>ref|XP_003599832.1| hypothetical protein MTR_3g047590 [Medicago truncatula]
 gb|AES70083.1| hypothetical protein MTR_3g047590 [Medicago truncatula]
Length=180

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 85/149 (57%), Gaps = 5/149 (3%)
 Frame = +3

Query  594   SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
             S QQG+K+ +++ +Q+L +  L K  T   DEFKYGFPS+ LS IS KWWG   +D   D
Sbjct  31    SHQQGNKSVESVRTQNLPNTVLAKGMTT-LDEFKYGFPSESLSTISNKWWGWGDSDDRTD  89

Query  774   TKKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDL---REQAAKEGKEALRLGV  944
             T ++G  +   ++S    E+   +TGK+         LS L   R++A +EG+E   LGV
Sbjct  90    TNQDG-GKSQPEESGGEAEKKERETGKAESSEETRHGLSLLRSVRKRAVEEGRETFNLGV  148

Query  945   YREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             +R   + KL   ++ +L Q+F SS P  W
Sbjct  149   FRGFGVNKLAKREKILLHQIFGSSLPKSW  177



>ref|XP_007146340.1| hypothetical protein PHAVU_006G032200g [Phaseolus vulgaris]
 gb|ESW18334.1| hypothetical protein PHAVU_006G032200g [Phaseolus vulgaris]
Length=178

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 91/149 (61%), Gaps = 6/149 (4%)
 Frame = +3

Query  594   SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
             SQQQG+K  ++  +Q++++  L KA T   DEFK GFPS+ LSA S KWWG+R  D    
Sbjct  30    SQQQGNKNVESARTQNVVNTGLTKAMTT-MDEFKSGFPSEHLSATSNKWWGNRDHDDCAG  88

Query  774   TKKEGNAEESKQQSAVPMEESAVKTGKS-NVDSFRADS-LSDLREQAAKEGKEALRLGVY  947
             T   G   + K++  V  ++   +T K+ N ++    S L+ +R++A +EG+EAL+LGV+
Sbjct  89    TNASGANSQPKEK--VGEDKLVHETEKTENSETPHGSSLLTAVRKRAVEEGREALKLGVF  146

Query  948   REH-SLFKLDLTKRKVLLQVFKSSYPPQW  1031
             R +  + KL   ++ +L Q+F SS P  W
Sbjct  147   RGYGGVNKLSKREKILLHQIFGSSLPKSW  175



>ref|XP_010102141.1| hypothetical protein L484_021375 [Morus notabilis]
 gb|EXB92391.1| hypothetical protein L484_021375 [Morus notabilis]
Length=150

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 89/162 (55%), Gaps = 24/162 (15%)
 Frame = +3

Query  573   MPKSAAASQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSR  752
             M KS+  +Q+ G KT+ +   Q + +  L K+ T   DEFK GFPS+GLS +S KWWGS 
Sbjct  1     MSKSSH-NQESGGKTSHSGRPQTVTNATLAKSITT-LDEFKSGFPSEGLSTVSNKWWGSG  58

Query  753   STDG---------NEDTKKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQ  905
               DG          E   KE    E+K+++A P  +    TG           L D+R++
Sbjct  59    FPDGYDGDGAIHAAESADKEKERSENKEKNAGPTTQG---TGL----------LMDVRKR  105

Query  906   AAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             A +EG+E+L+LGV R  S  KL   ++ +LL++FKSS P  W
Sbjct  106   AVEEGRESLKLGVVRGFSAKKLGKREKALLLRMFKSSAPQDW  147



>gb|KHM99633.1| hypothetical protein glysoja_006476 [Glycine soja]
Length=181

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 84/155 (54%), Gaps = 16/155 (10%)
 Frame = +3

Query  594   SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
             S Q G+K  ++  +Q++++  L KA +   DEFK GFPS+GLS  S KWWG      N D
Sbjct  31    SHQHGNKNIESGRTQNVVNSGLTKAIST-MDEFKCGFPSEGLSTTSNKWWG------NSD  83

Query  774   TKKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADS---------LSDLREQAAKEGKE  926
                   A  +  +S  P E+   +T K   ++ +A+          L  +R+ A +EG+E
Sbjct  84    RDDRAGANANGAKSHQPEEKVGAETDKMAHETGKAEKSEIPHGSSLLKAVRKSAVEEGRE  143

Query  927   ALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             AL+LGV+R + + KL   ++ +L Q+F SS P  W
Sbjct  144   ALKLGVFRGYGVNKLGKREKTLLHQIFGSSLPRSW  178



>gb|KHN18087.1| hypothetical protein glysoja_020860 [Glycine soja]
Length=167

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 78/147 (53%), Gaps = 14/147 (10%)
 Frame = +3

Query  594   SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
             S  QG+K  ++  +Q+ +S  L KA T   DEFK GFPS GLS  S KWWG    + N D
Sbjct  31    SHPQGNKNVESGRTQNAVSTGLTKAITT-MDEFKCGFPSKGLSTTSNKWWG----NTNRD  85

Query  774   TKKEGNAEESKQ-QSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYR  950
                  NA  +K     V  E S +  G S         L  +R++A +EG+EAL+L V+R
Sbjct  86    DCAGANANGAKMAHETVKAENSEIPRGSS--------LLKAVRKRAVEEGREALKLEVFR  137

Query  951   EHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
              + + KL   ++ +L Q+F SS P  W
Sbjct  138   GYGINKLSKREKTLLHQIFGSSLPRSW  164



>ref|NP_001237234.1| uncharacterized protein LOC100305825 [Glycine max]
 gb|ACU13700.1| unknown [Glycine max]
Length=182

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 83/154 (54%), Gaps = 16/154 (10%)
 Frame = +3

Query  594   SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
             S Q G+K  ++  +Q++++  L KA +   DEFK GFPS+GLS  S KWW      GN D
Sbjct  31    SHQHGNKNIESGRTQNVVNSGLTKAIST-MDEFKCGFPSEGLSTTSNKWW------GNSD  83

Query  774   TKKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADS---------LSDLREQAAKEGKE  926
                   A  +  +S  P E+   +T K   ++ +A+          L  +R+ A +EG+E
Sbjct  84    RDDRAGANANGAKSHQPEEKVGAETDKMAHETGKAEKSEIPHGSSLLKAVRKSAVEEGRE  143

Query  927   ALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQ  1028
             AL+LGV+R + + KL   ++ +L Q+F SS P  
Sbjct  144   ALKLGVFRGYGVNKLGKREKTLLHQIFGSSLPSH  177



>gb|ACU23660.1| unknown [Glycine max]
Length=167

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 80/146 (55%), Gaps = 12/146 (8%)
 Frame = +3

Query  594   SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
             S  QG+K  ++  +Q+ +S  L KA T   DEFK GFPS GLS  S KWWG+  TD ++ 
Sbjct  31    SHPQGNKNVESGRTQNAVSTGLTKAITT-MDEFKCGFPSKGLSTTSNKWWGN--TDRDDC  87

Query  774   TKKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYRE  953
                  N  +   ++ V  E S +  G S         L  +R++A +EG+EAL+L V+R 
Sbjct  88    AGANANGAKMAHET-VKAENSEIPRGSS--------LLKAVRKRAVEEGREALKLEVFRG  138

Query  954   HSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             + + KL   ++ +L Q+F SS P  W
Sbjct  139   YGINKLSKREKTLLPQIFGSSLPRSW  164



>gb|EPS61740.1| hypothetical protein M569_13055, partial [Genlisea aurea]
Length=112

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 65/121 (54%), Gaps = 21/121 (17%)
 Frame = +3

Query  678   GSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGNAEESKQQSAVPMEESAVKTGKS  857
              +D+FKYGFPS+GLS +S KWW +R +D           E  +Q  A   EE A  T   
Sbjct  10    AADQFKYGFPSEGLSTVSNKWWSNRDSD-----------ETKRQVDAGRREEEATTTTP-  57

Query  858   NVDSFRADSLSDLREQAAKEGKEALRLGVYR---EHSLFKLDLTKRKVLLQVFKSSYPPQ  1028
                   A SLS LR++ A E KEAL+ GVYR    +    LD TKR +L  +F S+ P +
Sbjct  58    ------ASSLSSLRKRVAAESKEALKHGVYRGYYNNVKTPLDETKRSILHMIFGSTLPAE  111

Query  1029  W  1031
             W
Sbjct  112   W  112



>gb|EEE54228.1| hypothetical protein OsJ_01090 [Oryza sativa Japonica Group]
Length=360

 Score = 82.4 bits (202),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK L+
Sbjct  44   SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSHGIVRWPYRKLLT  91


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 11/126 (9%)
 Frame = +3

Query  684   DEFKYGFPSDGLSAISYKWWGSRS-TDGNEDTKKEGNAEESKQQSAVPMEESAVKTG---  851
             D+FKYGFPS GLS  + KWWG+ S T+        G A ES  +++  M +  +  G   
Sbjct  229   DDFKYGFPSSGLSLQTMKWWGTDSHTETTPAKDDNGEAPESANEASKGMTDDELDWGADE  288

Query  852   -------KSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFK  1010
                     S + +  +  L  LR +A  +G++ L         L +L+  ++  L QVF 
Sbjct  289   AEAEADADSAITTEPSAQLCSLRRKAVDDGRKLLTGKSCGGLELCRLNKRQKMALAQVFG  348

Query  1011  SSYPPQ  1028
             +S P Q
Sbjct  349   ASLPEQ  354



>gb|EEC70306.1| hypothetical protein OsI_01152 [Oryza sativa Indica Group]
Length=353

 Score = 82.0 bits (201),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK L+
Sbjct  40   SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRSHGIVRWPYRKLLT  87


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 11/126 (9%)
 Frame = +3

Query  684   DEFKYGFPSDGLSAISYKWWGSRS-TDGNEDTKKEGNAEESKQQSAVPMEESAVKTG---  851
             D+FKYGFPS GLS  + KWWG+ S T+        G A ES  +++  M +  +  G   
Sbjct  222   DDFKYGFPSSGLSLQTMKWWGTDSHTETTPAKDDNGEAPESANEASKGMTDDELDWGADE  281

Query  852   -------KSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFK  1010
                     S + +  +  L  LR +A  +G++ L         L +L+  ++  L QVF 
Sbjct  282   AEAEADADSAITTEPSAQLCSLRRKAVDDGRKLLTGKSCGGLELCRLNKRQKMALAQVFG  341

Query  1011  SSYPPQ  1028
             +S P Q
Sbjct  342   ASLPEQ  347



>ref|XP_010558869.1| PREDICTED: uncharacterized protein LOC104827393, partial [Tarenaya 
hassleriana]
Length=123

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 69/118 (58%), Gaps = 3/118 (3%)
 Frame = +3

Query  684   DEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGNAEESKQQSAVPMEESAVKTGKSNV  863
             D  K GFPSDGLS ++YKWWGS S++G  D K  G + E K Q+    ++   + G +  
Sbjct  3     DGLKCGFPSDGLSTVTYKWWGS-SSEGRNDAKDRGESIEGKFQADTNGDDMKQEDGTAGD  61

Query  864   D--SFRADSLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             +  S R DSL  +R++ A+EG+EA +L + R     +L+   + +L QVFKS  P  W
Sbjct  62    EFASVRPDSLVAVRKRVAEEGREADKLCLDRGFGSKELNRRDQALLSQVFKSPLPKDW  119



>ref|XP_010522076.1| PREDICTED: uncharacterized protein LOC104800828 [Tarenaya hassleriana]
 ref|XP_010522077.1| PREDICTED: uncharacterized protein LOC104800828 [Tarenaya hassleriana]
Length=157

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 83/150 (55%), Gaps = 10/150 (7%)
 Frame = +3

Query  597   QQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT  776
             QQ  +K+     S   ++ NL K T A  DEFK GFPSDGLS ++ KWWGS ST G + +
Sbjct  2     QQDRNKSHGLGKSNTWVNSNLAK-TMAALDEFKCGFPSDGLSTVTNKWWGS-STTGKDAS  59

Query  777   KKEGNAEESKQQ----SAVPMEESAVKTGKSNVD----SFRADSLSDLREQAAKEGKEAL  932
             K +  A E   Q        + ++ +K    NV+    S R + L  +R++ A+EG+EA+
Sbjct  60    KDQVEASEGTHQLDTNEDAKIVDNDMKQEDGNVNEEGASERPEPLVAVRKRIAEEGREAV  119

Query  933   RLGVYREHSLFKLDLTKRKVLLQVFKSSYP  1022
             +LG++R     KL    + +L Q+F SS P
Sbjct  120   KLGLHRGFGSKKLKRRDQALLSQIFSSSLP  149



>gb|EMT19303.1| hypothetical protein F775_29714 [Aegilops tauschii]
Length=334

 Score = 80.9 bits (198),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  243  IKTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            IK    SLS++E+SKLFSLP+++AA  LGVCTSVLK+IC  +G+VRWPYRK  S
Sbjct  37   IKPTRVSLSYEEISKLFSLPIAEAASILGVCTSVLKRICRTHGIVRWPYRKVKS  90


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 84/169 (50%), Gaps = 15/169 (9%)
 Frame = +3

Query  561   AAQEMPKSAAASQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKW  740
             A Q +PK+   S + GS   +  ++  L   +  K      D+FKYGFPS GLS  + KW
Sbjct  164   AFQGVPKAQQGSAKAGSAIGRQ-NAPSLSQFSQAKDIPTYMDDFKYGFPSSGLSTETMKW  222

Query  741   WGSRS---TDGNEDTKKEGNAEESKQQSAVPMEESAVKTG----KSNVDSFRADS-----  884
             WG+ S   T   +D  +EG+  ES  +++  M +  +  G    +++ D   A +     
Sbjct  223   WGTDSHTETAPAKDDNREGS--ESTNEASKGMTDDELDWGADEPEADADGVAAATDPSAQ  280

Query  885   LSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             L  LR +AA +G+  L     R   L +L+  ++ VL QVF +S P QW
Sbjct  281   LCFLRRKAAGDGRRLLNGDTGRVQQLCRLNKRQKIVLAQVFGASLPEQW  329



>ref|XP_010053713.1| PREDICTED: uncharacterized protein LOC104442101 [Eucalyptus grandis]
 gb|KCW89731.1| hypothetical protein EUGRSUZ_A01992 [Eucalyptus grandis]
Length=184

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 80/152 (53%), Gaps = 8/152 (5%)
 Frame = +3

Query  597   QQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT  776
             QQ  SK  Q+   Q  +S +L K+ T   DEFK+GFPS+GLS  S KWWGS S    E  
Sbjct  31    QQLESKQGQSGQIQSAISGSLIKSLTV-LDEFKHGFPSNGLSVASNKWWGSGSPGDFEYI  89

Query  777   KKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADS-------LSDLREQAAKEGKEALR  935
                    E + +     ++ +    K+  +   +DS       L+ +R++A +EG+EAL+
Sbjct  90    NATETGRECRPKCDDVADDGSNAEKKAEGEQENSDSTLQGTSLLTAMRKRALEEGREALK  149

Query  936   LGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
             LGV+  H   K+   ++ ++  +F+SS P  W
Sbjct  150   LGVFMSHRAHKIGKKEKSLMRNIFQSSLPKGW  181



>gb|EPS61739.1| hypothetical protein M569_13054, partial [Genlisea aurea]
Length=90

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  255  PKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSG  407
            PK+ +++EV  LFSLPLSDAA++LGV  +VLK +CYENG V WP+RK ++G
Sbjct  10   PKAPTYEEVFALFSLPLSDAAESLGVSPAVLKTVCYENGHVVWPFRKLVAG  60



>gb|AAM66040.1| unknown [Arabidopsis thaliana]
Length=135

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 73/145 (50%), Gaps = 21/145 (14%)
 Frame = +3

Query  597   QQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT  776
             Q  G+K+ +   S    + NL K T A  DEFK+GFPS GL+ +S KWWG     G ED 
Sbjct  6     QHGGNKSGK---SNVWANTNLAK-TVAAVDEFKFGFPSGGLTTVSNKWWGRAEKSGRED-  60

Query  777   KKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREH  956
                G  E ++       +E+              +SL  +R++ A+EG+EA+ LG+++  
Sbjct  61    ---GGGENTENGHVAASDET-------------QNSLVAIRKRIAEEGREAVELGLHQGF  104

Query  957   SLFKLDLTKRKVLLQVFKSSYPPQW  1031
                + D   + +L Q+F S+ P  W
Sbjct  105   GSKRPDKRDQALLFQIFNSAMPKDW  129



>ref|XP_006305857.1| hypothetical protein CARUB_v10010938mg [Capsella rubella]
 gb|EOA38755.1| hypothetical protein CARUB_v10010938mg [Capsella rubella]
Length=138

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 74/147 (50%), Gaps = 19/147 (13%)
 Frame = +3

Query  591   ASQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNE  770
             A Q  G+K+ +   S    + N+ K T A  DEFK GFPS GL+ +S KWWG     G+E
Sbjct  6     AVQHSGNKSGK---SNVWANANMAK-TMAALDEFKSGFPSGGLTTVSNKWWGRPEKGGHE  61

Query  771   DTKKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYR  950
             D   E N E+   +     E              + +SL  +R++ A+EG+EA+ LG ++
Sbjct  62    DGGGE-NTEDGDVKDEAASE--------------KQNSLVAIRKRIAEEGREAIELGQHQ  106

Query  951   EHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
                  K+D   + +L Q+F SS P  W
Sbjct  107   GFGSKKIDKRDQALLFQIFNSSPPKDW  133



>ref|XP_006417910.1| hypothetical protein EUTSA_v10009066mg [Eutrema salsugineum]
 gb|ESQ36263.1| hypothetical protein EUTSA_v10009066mg [Eutrema salsugineum]
Length=137

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 68/128 (53%), Gaps = 16/128 (13%)
 Frame = +3

Query  648   SVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGNAEESKQQSAVPM  827
             + NL K T A  DEFK GFPS+GL+ +S KWWG     G ED   E NAE+   +   P 
Sbjct  21    NTNLAK-TVAALDEFKSGFPSNGLTTVSNKWWGRPGKSGREDG-GEKNAEDGDVKDEAP-  77

Query  828   EESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVF  1007
                          S + +SL  +R++ A++G+EA+ LG+ +     + D   + +L Q+F
Sbjct  78    -------------SVKENSLLAVRKRIAEQGREAVELGLRQGFGSKRPDKRDQDLLSQIF  124

Query  1008  KSSYPPQW  1031
             KSS P  W
Sbjct  125   KSSLPKDW  132



>ref|NP_563767.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001030980.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001077467.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001077468.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL62427.1| unknown protein [Arabidopsis thaliana]
 gb|AAM48040.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH20198.1| AT1G06500 [Arabidopsis thaliana]
 gb|AEE27994.1| uncharacterized protein AT1G06500 [Arabidopsis thaliana]
 gb|AEE27995.1| uncharacterized protein AT1G06500 [Arabidopsis thaliana]
 gb|AEE27996.1| uncharacterized protein AT1G06500 [Arabidopsis thaliana]
 gb|AEE27997.1| uncharacterized protein AT1G06500 [Arabidopsis thaliana]
Length=136

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 72/145 (50%), Gaps = 21/145 (14%)
 Frame = +3

Query  597   QQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT  776
             Q  G+K+ +   S    + NL K T A  DEFK+GFPS GL+ +S KWWG     G ED 
Sbjct  7     QHGGNKSGK---SNVWANTNLAK-TVAAVDEFKFGFPSGGLTTVSNKWWGRAEKGGRED-  61

Query  777   KKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREH  956
                G  E ++       +E+              +SL  +R++ A+EG+EA+ LG+++  
Sbjct  62    ---GGGENTENGHVAACDET-------------QNSLVAIRKRIAEEGREAVELGLHQGF  105

Query  957   SLFKLDLTKRKVLLQVFKSSYPPQW  1031
                +     + +L Q+F S+ P  W
Sbjct  106   GSKRPGKRDQALLFQIFNSAMPKDW  130



>ref|XP_002889607.1| hypothetical protein ARALYDRAFT_887853 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65866.1| hypothetical protein ARALYDRAFT_887853 [Arabidopsis lyrata subsp. 
lyrata]
Length=139

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 74/145 (51%), Gaps = 17/145 (12%)
 Frame = +3

Query  597   QQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT  776
             Q  G+K+ +   S    + NL K T A  DEFK+GFPS GL+ +S KWWG     G +D 
Sbjct  7     QHGGNKSGK---SNVWANTNLAK-TVAALDEFKFGFPSGGLTTVSNKWWGRPEKGGRQDV  62

Query  777   KKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREH  956
                   E ++       +E+A  T          +SL  +R++ A+EG+EA+ LG+++  
Sbjct  63    ----GGENTEYGDGDVKDEAASHT---------QNSLVAIRKRIAEEGREAVELGLHKGF  109

Query  957   SLFKLDLTKRKVLLQVFKSSYPPQW  1031
                + D   + +L Q+F ++ P  W
Sbjct  110   CSKRPDKRDQALLFQIFNAALPKDW  134



>ref|XP_008224437.1| PREDICTED: uncharacterized protein LOC103324172, partial [Prunus 
mume]
Length=123

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +3

Query  594  SQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNED  773
            +QQQGSK  QT   Q++L+++L K  T   DEFK+GFPSDGLS  S KWWGS S DG + 
Sbjct  13   AQQQGSKNVQTGRPQNILTLSLTKGNTT-YDEFKHGFPSDGLSTASNKWWGSNSPDGYKS  71

Query  774  TKKEG--NAEESKQQS  815
               +G    E+ K QS
Sbjct  72   IHGKGAETDEDKKHQS  87



>ref|XP_009118534.1| PREDICTED: uncharacterized protein LOC103843549 [Brassica rapa]
Length=131

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 75/145 (52%), Gaps = 20/145 (14%)
 Frame = +3

Query  597   QQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT  776
             Q  G+K+ ++ ++    + NL K T    DEFK GFPS GL+ +S KWWG+      +D 
Sbjct  2     QHGGNKSGKSSTNVWANNANLAK-TMGALDEFKSGFPSKGLATVSNKWWGTGGQ--RQDV  58

Query  777   KKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREH  956
              ++G          V  EE+A         S +  SL  +R++ A+EG+EAL LGV +  
Sbjct  59    TEDG--------GDVKDEEAA---------SEKQSSLLGIRKRIAEEGREALELGVSQGF  101

Query  957   SLFKLDLTKRKVLLQVFKSSYPPQW  1031
                + D   + +L Q+F SS P +W
Sbjct  102   GSKRPDKRDQHLLSQIFGSSLPKEW  126



>ref|XP_008782173.1| PREDICTED: uncharacterized protein LOC103701776 [Phoenix dactylifera]
Length=283

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 63/129 (49%), Gaps = 13/129 (10%)
 Frame = +3

Query  684   DEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGNAEESKQQSAVPMEESAVKTGKSNV  863
             +EFK GFP+ GLS++S KWWGS S +    T  E   +   Q+S     E +    K+N+
Sbjct  150   EEFKSGFPASGLSSVSIKWWGSSSKEDTGRTLPEETIKGENQESPELSNEISRHMAKANL  209

Query  864   ----DSFRAD---------SLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQV  1004
                 D    D         SL  LR +A + G E L+ G  + ++ +K     R  L QV
Sbjct  210   PDGPDHSTEDSATLTEPSASLCSLRRKAVECGHETLKGGASKGYTTYKWGKRHRLALFQV  269

Query  1005  FKSSYPPQW  1031
             FKSS P QW
Sbjct  270   FKSSLPDQW  278



>emb|CDY06215.1| BnaA09g49880D [Brassica napus]
Length=2084

 Score = 72.4 bits (176),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 47/145 (32%), Positives = 72/145 (50%), Gaps = 20/145 (14%)
 Frame = +3

Query  597   QQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDT  776
             Q  G+K+ ++ ++    + NL K T    DEFK GFPS GL+ +S KWWG   T G    
Sbjct  1955  QHGGNKSGKSSTNVWANNANLAK-TMGALDEFKSGFPSKGLATVSNKWWG---TGGQRQD  2010

Query  777   KKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREH  956
               E   +   +++A                S +  SL  +R++ A+EG+EAL LGV +  
Sbjct  2011  VTEDGGDVKDEEAA----------------SEKQSSLLGIRKRIAEEGREALELGVSQGF  2054

Query  957   SLFKLDLTKRKVLLQVFKSSYPPQW  1031
                + D   + +L Q+F SS P +W
Sbjct  2055  GSKRPDKRDQHLLSQIFGSSLPKEW  2079



>emb|CDY09971.1| BnaC08g44800D [Brassica napus]
Length=2120

 Score = 72.0 bits (175),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 52/153 (34%), Positives = 73/153 (48%), Gaps = 32/153 (21%)
 Frame = +3

Query  597   QQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGS---RSTDG-  764
             Q  G+K+ ++ ++    + +L K T A  DEFK GFPS GL+ +S KWWG+   R   G 
Sbjct  1987  QHGGNKSGKSSTNVWANNASLVK-TMAALDEFKSGFPSKGLATVSNKWWGTSGQRQDAGL  2045

Query  765   ----NEDTKKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEAL  932
                  ED K E  A E KQ                        SL  +R + A+EG+EAL
Sbjct  2046  EIITEEDVKDEEAASEKKQS-----------------------SLLAVRRRIAEEGREAL  2082

Query  933   RLGVYREHSLFKLDLTKRKVLLQVFKSSYPPQW  1031
              LGV +     + D   + +L Q+F SS P +W
Sbjct  2083  ELGVSQGFGSKRPDKRDQHLLSQIFGSSLPKEW  2115



>gb|KCW89745.1| hypothetical protein EUGRSUZ_A02009 [Eucalyptus grandis]
Length=130

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 78/145 (54%), Gaps = 17/145 (12%)
 Frame = +3

Query  573   MPKSAAASQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSR  752
             +P+S   SQQ  SK  Q+   Q ++S +L K + A  DEFKYGFPS+GL   S +WWGS 
Sbjct  3     LPRS---SQQPESKQRQSGQIQSVISGSLIK-SLAVLDEFKYGFPSNGLYVTSNEWWGS-  57

Query  753   STDGNEDTKKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKEAL  932
                        G+ E+ +   A   E    K   S+   + A   + +R++A +EG+EAL
Sbjct  58    -----------GSPEDFEYIDATETETEGEKE-TSDATLWGASLTTAIRKRALEEGREAL  105

Query  933   RLGVYREHSLFKLDLTKRKVLLQVF  1007
             +LGV+  H   K+   ++ V+L +F
Sbjct  106   KLGVFMSHHAHKIGKEEKSVMLNIF  130



>ref|XP_010457777.1| PREDICTED: uncharacterized protein LOC104739201 [Camelina sativa]
 ref|XP_010457778.1| PREDICTED: uncharacterized protein LOC104739201 [Camelina sativa]
 ref|XP_010457779.1| PREDICTED: uncharacterized protein LOC104739201 [Camelina sativa]
Length=128

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 63/128 (49%), Gaps = 21/128 (16%)
 Frame = +3

Query  648   SVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGNAEESKQQSAVPM  827
             + NL K T A  DEFK GFPS GL+ +S KWWG    DG E+  ++   +E+  +     
Sbjct  17    NANLTK-TMAALDEFKSGFPSGGLTTVSNKWWGRPEKDGGEEITEDDVKDEAASE-----  70

Query  828   EESAVKTGKSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVF  1007
                            +  SL  +R++ A+EG+EA+  G+ +     K D     +L Q+F
Sbjct  71    ---------------KQSSLVAIRKRIAEEGREAVEHGLRQGFGSRKPDKRDHALLFQIF  115

Query  1008  KSSYPPQW  1031
             +SS P  W
Sbjct  116   ESSLPKDW  123



>gb|KCW89736.1| hypothetical protein EUGRSUZ_A01996 [Eucalyptus grandis]
Length=130

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 73/147 (50%), Gaps = 21/147 (14%)
 Frame = +3

Query  573   MPKSAAASQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSR  752
             +P+S   SQQ  SK  Q+   Q ++S +L K+     DEFKYGFPS+GLS  S KWWGS 
Sbjct  3     LPRS---SQQLESKQGQSGQIQSVISGSLIKSLVV-LDEFKYGFPSNGLSVTSNKWWGSG  58

Query  753   STDGNE--DTKKEGNAEESKQQSAVPMEESAVKTGKSNVDSFRADSLSDLREQAAKEGKE  926
             S    E  D  +     E +   A+    S   T               +R++A +EG+E
Sbjct  59    SPGDFEYIDATETETEGEKETSDAILWGASLPTT---------------IRKRALEEGRE  103

Query  927   ALRLGVYREHSLFKLDLTKRKVLLQVF  1007
             AL+ GV   H   K+   ++ ++L +F
Sbjct  104   ALKCGVLMSHHAHKIGKEEKSLMLNIF  130



>ref|XP_004354403.1| RWP-RK domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG15661.1| RWP-RK domain-containing protein [Dictyostelium fasciculatum]
Length=492

 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            ++ F+++SK F LP++D A  LG+C ++LKKIC  NG+ RWP+RK  S
Sbjct  9    TIGFEQLSKYFHLPINDVAKELGICATMLKKICRRNGIPRWPHRKIKS  56



>gb|ETM03614.1| hypothetical protein L917_00190 [Phytophthora parasitica]
Length=454

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +++SFD +   F  PL  AAD+ GVCT++LKKIC  NG+  WPYRK 
Sbjct  207  RNISFDMLQPHFERPLQQAADSFGVCTTLLKKICRRNGISNWPYRKI  253



>gb|ETK97221.1| hypothetical protein L915_00204 [Phytophthora parasitica]
 gb|ETL50568.1| hypothetical protein L916_00206 [Phytophthora parasitica]
 gb|ETP27235.1| hypothetical protein F441_00228 [Phytophthora parasitica CJ01A1]
Length=454

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +++SFD +   F  PL  AAD+ GVCT++LKKIC  NG+  WPYRK 
Sbjct  207  RNISFDMLQPHFERPLQQAADSFGVCTTLLKKICRRNGISNWPYRKI  253



>gb|ETO86206.1| hypothetical protein F444_00232 [Phytophthora parasitica P1976]
Length=454

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +++SFD +   F  PL  AAD+ GVCT++LKKIC  NG+  WPYRK 
Sbjct  207  RNISFDMLQPHFERPLQQAADSFGVCTTLLKKICRRNGISNWPYRKI  253



>gb|ETM56891.1| hypothetical protein L914_00208 [Phytophthora parasitica]
Length=454

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +++SFD +   F  PL  AAD+ GVCT++LKKIC  NG+  WPYRK 
Sbjct  207  RNISFDMLQPHFERPLQQAADSFGVCTTLLKKICRRNGISNWPYRKI  253



>gb|ETI57473.1| hypothetical protein F443_00237 [Phytophthora parasitica P1569]
Length=454

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +++SFD +   F  PL  AAD+ GVCT++LKKIC  NG+  WPYRK 
Sbjct  207  RNISFDMLQPHFERPLQQAADSFGVCTTLLKKICRRNGISNWPYRKI  253



>ref|XP_008889809.1| hypothetical protein PPTG_00191 [Phytophthora parasitica INRA-310]
 gb|ETN23632.1| hypothetical protein PPTG_00191 [Phytophthora parasitica INRA-310]
Length=454

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFL  401
            +++SFD +   F  PL  AAD+ GVCT++LKKIC  NG+  WPYRK  
Sbjct  207  RNISFDMLQPHFERPLQQAADSFGVCTTLLKKICRRNGISNWPYRKIC  254



>ref|XP_641205.1| RWP-RK domain-containing protein [Dictyostelium discoideum AX4]
 gb|EAL67224.1| RWP-RK domain-containing protein [Dictyostelium discoideum AX4]
Length=838

 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            ++ F+++SK F LP++D A  LG+C ++LKKIC  NG+ RWP+RK  S
Sbjct  31   TIGFEQLSKYFHLPINDVAKELGICATMLKKICRRNGIPRWPHRKIKS  78



>gb|EFA82378.1| RWP-RK domain-containing protein [Polysphondylium pallidum PN500]
Length=407

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            ++ F+++SK F LP++D A  LG+C ++LKKIC  NG+ RWP+RK  S
Sbjct  6    NIGFEQLSKYFHLPINDVAKELGICATMLKKICRRNGIPRWPHRKIKS  53



>gb|ETP55204.1| hypothetical protein F442_00221 [Phytophthora parasitica P10297]
Length=407

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +++SFD +   F  PL  AAD+ GVCT++LKKIC  NG+  WPYRK 
Sbjct  207  RNISFDMLQPHFERPLQQAADSFGVCTTLLKKICRRNGISNWPYRKI  253



>dbj|GAM24412.1| hypothetical protein SAMD00019534_075870 [Acytostelium subglobosum 
LB1]
Length=377

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            ++ F+ +SK F +P++D A  LG+C ++LKKIC  NG+ RWP+RK  S
Sbjct  6    NIDFNHLSKYFHMPINDVAKELGICATMLKKICRRNGIPRWPHRKIKS  53



>ref|XP_002502534.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63792.1| predicted protein [Micromonas sp. RCC299]
Length=343

 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            KSL+ +E+S  F LP++D A  LG+C +VLK+ C E+G+ RWPYRK 
Sbjct  11   KSLTLEELSANFHLPINDVARKLGLCVTVLKQRCREHGITRWPYRKV  57



>ref|XP_003057382.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59027.1| predicted protein [Micromonas pusilla CCMP1545]
Length=409

 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            KSL+ +E+S  F LP++D A  LG+C +VLK+ C E+G+ RWPYRK 
Sbjct  11   KSLTVEELSANFHLPINDVARKLGLCVTVLKQRCREHGITRWPYRKV  57



>gb|EMS61885.1| hypothetical protein TRIUR3_23546 [Triticum urartu]
Length=302

 Score = 63.5 bits (153),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 67/127 (53%), Gaps = 14/127 (11%)
 Frame = +3

Query  684   DEFKYGFPSDGLSAISYKWWGSRS---TDGNEDTKKEGNAEESKQQSAVPMEESAVKTG-  851
             D+FKYGFPS GLS  + KWWG+ S   T   +D  +EG+  ES  +++  M +  +  G 
Sbjct  172   DDFKYGFPSSGLSTETMKWWGTDSHTETAPAKDDNREGS--ESTNEASKGMTDDELDWGA  229

Query  852   ---KSNVDSFRADS-----LSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVF  1007
                +++ D   A +     L  LR +AA +G+  L     R   L +L+  ++ VL QVF
Sbjct  230   DEPEADADGVAAATDPSAQLCSLRRKAAGDGRRLLNGDTGRVQQLCRLNKRQKIVLAQVF  289

Query  1008  KSSYPPQ  1028
              +S P Q
Sbjct  290   GASLPEQ  296



>dbj|GAM22434.1| hypothetical protein SAMD00019534_056090 [Acytostelium subglobosum 
LB1]
Length=451

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  279  VSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +SK F LP++D A  +GVC +VLKKIC +NG+ RWP+RK 
Sbjct  13   LSKYFHLPINDVAKEIGVCATVLKKICRKNGIPRWPHRKI  52



>ref|XP_010486206.1| PREDICTED: uncharacterized protein LOC104764379 [Camelina sativa]
 ref|XP_010486221.1| PREDICTED: uncharacterized protein LOC104764397 [Camelina sativa]
 ref|XP_010486229.1| PREDICTED: uncharacterized protein LOC104764397 [Camelina sativa]
 ref|XP_010486236.1| PREDICTED: uncharacterized protein LOC104764397 [Camelina sativa]
Length=130

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 61/129 (47%), Gaps = 21/129 (16%)
 Frame = +3

Query  648   SVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSRSTDGNEDTKKEGNAEESKQQSAVPM  827
             + NL K T A  DEFK GFPS  LS +S KWWG     G ED       EE  +   V  
Sbjct  17    NANLTK-TMAALDEFKSGFPSGALSTVSNKWWGRPEKGGRED-----GGEEITEDGDVKD  70

Query  828   EESAVKTGKSNVDSFRADSLSDLREQAAKEGKE-ALRLGVYREHSLFKLDLTKRKVLLQV  1004
             E ++ K            SL  +R++ A+EG+E  LR G   +    K D     +L Q+
Sbjct  71    EAASEKQ----------SSLVAIRKRIAEEGREHGLRQGFGSK----KPDKRDHALLFQI  116

Query  1005  FKSSYPPQW  1031
             F+SS P  W
Sbjct  117   FESSLPKDW  125



>ref|XP_005717816.1| unnamed protein product [Chondrus crispus]
 emb|CDF37947.1| unnamed protein product [Chondrus crispus]
Length=1047

 Score = 62.4 bits (150),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            +SLS+ ++S+ F LP++ AA  LGVC + LKK C  +G+ RWP+RK  S
Sbjct  37   RSLSYQDLSRCFHLPINSAARELGVCVTALKKQCRRHGVPRWPHRKLKS  85



>gb|EFA76212.1| RWP-RK domain-containing protein [Polysphondylium pallidum PN500]
Length=434

 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  279  VSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +SK F LP++D A  +GVC +VLKKIC +NG+ RWP+RK 
Sbjct  12   LSKYFHLPINDVAKEIGVCATVLKKICRKNGIPRWPHRKI  51



>ref|XP_007514864.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15104.1| predicted protein [Bathycoccus prasinos]
Length=654

 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  267  SFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            S D++  +F LP++DAA  LG+C +VLK+ C E G+VRWP+RK 
Sbjct  14   SMDDLRTVFHLPINDAAKKLGLCVTVLKQKCREFGIVRWPFRKV  57



>emb|CCI45050.1| unnamed protein product [Albugo candida]
Length=240

 Score = 60.1 bits (144),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +3

Query  252  DPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            + K  + +E+   F+ P++  A  LGVC +++KKIC +NGLVRWP+R+  S
Sbjct  21   NVKEFTLNELRPYFNKPMTVVAKELGVCITLMKKICRKNGLVRWPHRRIRS  71



>gb|ETP28319.1| hypothetical protein F442_22389 [Phytophthora parasitica P10297]
Length=562

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L+ +E+   F+ P++  A  LGVC +++KKIC  NGLVRWP+R+  S
Sbjct  290  KDLTLNELRPHFNKPMAVVAKELGVCITLMKKICRRNGLVRWPHRRIRS  338



>ref|XP_008914339.1| hypothetical protein PPTG_18030 [Phytophthora parasitica INRA-310]
 gb|ETN00327.1| hypothetical protein PPTG_18030 [Phytophthora parasitica INRA-310]
 gb|ETO61738.1| hypothetical protein F444_20264 [Phytophthora parasitica P1976]
Length=562

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L+ +E+   F+ P++  A  LGVC +++KKIC  NGLVRWP+R+  S
Sbjct  290  KDLTLNELRPHFNKPMAVVAKELGVCITLMKKICRRNGLVRWPHRRIRS  338



>gb|ETM33281.1| hypothetical protein L914_19468 [Phytophthora parasitica]
Length=562

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L+ +E+   F+ P++  A  LGVC +++KKIC  NGLVRWP+R+  S
Sbjct  290  KDLTLNELRPHFNKPMAVVAKELGVCITLMKKICRRNGLVRWPHRRIRS  338



>gb|ETP02806.1| hypothetical protein F441_20141 [Phytophthora parasitica CJ01A1]
Length=562

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L+ +E+   F+ P++  A  LGVC +++KKIC  NGLVRWP+R+  S
Sbjct  290  KDLTLNELRPHFNKPMAVVAKELGVCITLMKKICRRNGLVRWPHRRIRS  338



>gb|ETK73336.1| hypothetical protein L915_19697 [Phytophthora parasitica]
Length=562

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L+ +E+   F+ P++  A  LGVC +++KKIC  NGLVRWP+R+  S
Sbjct  290  KDLTLNELRPHFNKPMAVVAKELGVCITLMKKICRRNGLVRWPHRRIRS  338



>gb|ETI33004.1| hypothetical protein F443_20250 [Phytophthora parasitica P1569]
 gb|ETL80037.1| hypothetical protein L917_19433 [Phytophthora parasitica]
Length=562

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L+ +E+   F+ P++  A  LGVC +++KKIC  NGLVRWP+R+  S
Sbjct  290  KDLTLNELRPHFNKPMAVVAKELGVCITLMKKICRRNGLVRWPHRRIRS  338



>gb|ETL26802.1| hypothetical protein L916_19581 [Phytophthora parasitica]
Length=562

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L+ +E+   F+ P++  A  LGVC +++KKIC  NGLVRWP+R+  S
Sbjct  290  KDLTLNELRPHFNKPMAVVAKELGVCITLMKKICRRNGLVRWPHRRIRS  338



>ref|XP_002900056.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY60683.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=564

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L+ +E+   F+ P++  A  LGVC +++KKIC  NGLVRWP+R+  S
Sbjct  288  KDLTLNELRPHFNKPMAVVAKELGVCITLMKKICRRNGLVRWPHRRIRS  336



>ref|XP_009525604.1| hypothetical protein PHYSODRAFT_350997 [Phytophthora sojae]
 gb|EGZ16546.1| hypothetical protein PHYSODRAFT_350997 [Phytophthora sojae]
Length=572

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L+ +E+   F+ P++  A  LGVC +++KKIC  NGLVRWP+R+  S
Sbjct  279  KELTLNELRPHFNKPMAVVAKELGVCITLMKKICRRNGLVRWPHRRIRS  327



>ref|XP_002998004.1| RWP-RK domain-containing protein, putative [Phytophthora infestans 
T30-4]
 gb|EEY70350.1| RWP-RK domain-containing protein, putative [Phytophthora infestans 
T30-4]
Length=196

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  291  FSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            F  PL  AAD+ GVCT++LKKIC  NG+  WPYRK 
Sbjct  6    FERPLQQAADSFGVCTTLLKKICRRNGISNWPYRKI  41



>gb|KFK25847.1| hypothetical protein AALP_AA8G169800 [Arabis alpina]
Length=453

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            L+ D++ K F LP+  AA T+ VC +VLKK+C   GL RWPYRK  S
Sbjct  358  LTLDDLKKYFHLPIEKAAQTMEVCPTVLKKVCRRGGLRRWPYRKIKS  404



>ref|XP_004357755.1| RWP-RK domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG19461.1| RWP-RK domain-containing protein [Dictyostelium fasciculatum]
Length=453

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  279  VSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +SK F LP++D A  +GVC +VLKKIC +NG+ RWP+RK 
Sbjct  12   LSKYFHLPINDVAKEIGVCATVLKKICRKNGIPRWPHRKI  51



>dbj|GAM17518.1| hypothetical protein SAMD00019534_006930 [Acytostelium subglobosum 
LB1]
Length=343

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  279  VSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +S+ F LP++D A  +GVC +VLKKIC +NG+ RWP+RK 
Sbjct  12   LSQYFHLPINDVAKEIGVCATVLKKICRKNGIPRWPHRKI  51



>ref|XP_008222900.1| PREDICTED: uncharacterized protein LOC103322753, partial [Prunus 
mume]
Length=138

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 62/111 (56%), Gaps = 12/111 (11%)
 Frame = +3

Query  711   DGLSAISYKWWGSRSTDGNEDTKKEGNA--EESKQQS---------AVPMEESAVKTGKS  857
             DGLS  S KWWGS S  G E    EG    E+ K QS         ++ +++   ++GK 
Sbjct  28    DGLSTASNKWWGSNSPYGYESIHGEGAEIDEDKKHQSEKLAGDGASSIVVDKEKCESGKE  87

Query  858   -NVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVF  1007
              N+ S   D L  +R+++ +EG++AL+LGV R +   KL   +R +LL++F
Sbjct  88    ENISSQGTDLLMAVRKRSLEEGQKALKLGVLRGYGAKKLGRRERALLLRIF  138



>ref|XP_005817959.1| hypothetical protein GUITHDRAFT_83535 [Guillardia theta CCMP2712]
 gb|EKX30979.1| hypothetical protein GUITHDRAFT_83535 [Guillardia theta CCMP2712]
Length=57

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFL  401
            L+  E+SK F +P    A  LG+C + LKK+C +NG+ RWPYRK L
Sbjct  9    LTMQELSKYFKMPEKAVAKELGICLTSLKKVCRQNGINRWPYRKVL  54



>ref|XP_004341064.1| RWPRK domain containing protein [Acanthamoeba castellanii str. 
Neff]
 gb|ELR19000.1| RWPRK domain containing protein [Acanthamoeba castellanii str. 
Neff]
Length=413

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            + +  ++++K F LP++  A  LGVC +VLKKIC +NG+ RWP+RK 
Sbjct  5    QDIGLEQLTKYFHLPINAVAKELGVCATVLKKICRKNGIPRWPHRKI  51



>ref|XP_005826185.1| hypothetical protein GUITHDRAFT_49500, partial [Guillardia theta 
CCMP2712]
 gb|EKX39205.1| hypothetical protein GUITHDRAFT_49500, partial [Guillardia theta 
CCMP2712]
Length=54

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/49 (41%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            + L ++E+++ F + +++A + LG+CTS +KKIC  +G+ RWP+RK  S
Sbjct  5    RPLWYEELTRYFGVSINEAGEALGMCTSAIKKICRRHGIARWPHRKIAS  53



>emb|CCA16609.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=225

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +3

Query  252  DPKSLSFD--EVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            + + + FD  ++ K + LPL  AA+ LGVC + LK+IC  N + RWPYR+ 
Sbjct  14   NRRRIHFDVVQLQKYYHLPLRSAAERLGVCEAALKRICRRNSIRRWPYRQI  64



>emb|CCI46796.1| unnamed protein product [Albugo candida]
Length=225

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 33/51 (65%), Gaps = 2/51 (4%)
 Frame = +3

Query  252  DPKSLSFD--EVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            + + + FD  ++ K + LPL  AA+ LGVC + LK+IC  N + RWPYR+ 
Sbjct  14   NRRRIHFDVIQLQKYYHLPLRSAAERLGVCEAALKRICRRNSIRRWPYRQI  64



>ref|XP_003287352.1| hypothetical protein DICPUDRAFT_78210 [Dictyostelium purpureum]
 gb|EGC36095.1| hypothetical protein DICPUDRAFT_78210 [Dictyostelium purpureum]
Length=412

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            + ++ + +SK F LP++  A  +GVC +VLKKIC  NG+ RWP+RK 
Sbjct  6    QDINLEYLSKYFHLPINSVAKEIGVCATVLKKICRRNGIPRWPHRKI  52



>ref|XP_008872070.1| hypothetical protein H310_08186 [Aphanomyces invadans]
 gb|ETV99514.1| hypothetical protein H310_08186 [Aphanomyces invadans]
Length=491

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S +E+   F+ P++  A  LGVC +++KKIC +NGL RWP+R+  S
Sbjct  309  KDVSLNELRPHFNKPMAAVAKELGVCITLMKKICRKNGLTRWPHRRIRS  357



>ref|XP_006646856.1| PREDICTED: protein NLP3-like [Oryza brachyantha]
Length=299

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            KS++ +E+ K FS  L DAA +LGVC + +K+IC ++G+ RWP+RK 
Sbjct  57   KSITLEELQKYFSGSLKDAARSLGVCPTTMKRICRQHGIPRWPFRKI  103



>ref|XP_002971900.1| hypothetical protein SELMODRAFT_73105, partial [Selaginella moellendorffii]
 ref|XP_002993553.1| hypothetical protein SELMODRAFT_73104, partial [Selaginella moellendorffii]
 gb|EFJ05382.1| hypothetical protein SELMODRAFT_73104, partial [Selaginella moellendorffii]
 gb|EFJ26817.1| hypothetical protein SELMODRAFT_73105, partial [Selaginella moellendorffii]
Length=53

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRK  395
            L   ++++ F LP++ AA  LG+C +VLKKIC  NG+ RWP+RK
Sbjct  8    LKMSDLAQHFHLPINAAAKELGICPTVLKKICRRNGMRRWPHRK  51



>ref|XP_009532818.1| hypothetical protein PHYSODRAFT_317537 [Phytophthora sojae]
 gb|EGZ12485.1| hypothetical protein PHYSODRAFT_317537 [Phytophthora sojae]
Length=209

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  291  FSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            F  PL  AAD+ GVCT++LKKIC  NG+  WPYRK 
Sbjct  6    FERPLQQAADSFGVCTTLLKKICRRNGISNWPYRKI  41



>ref|XP_010912806.1| PREDICTED: uncharacterized protein LOC105038636 [Elaeis guineensis]
Length=347

 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            S+   ++   F LP++DAA  LG+CT+ LKKIC ++G+ RWP+RK 
Sbjct  257  SMQLRDLIDYFHLPIADAAKELGICTTALKKICRKHGMPRWPHRKI  302



>ref|XP_002983687.1| hypothetical protein SELMODRAFT_118783, partial [Selaginella 
moellendorffii]
 ref|XP_002989018.1| hypothetical protein SELMODRAFT_129268, partial [Selaginella 
moellendorffii]
 gb|EFJ09812.1| hypothetical protein SELMODRAFT_129268, partial [Selaginella 
moellendorffii]
 gb|EFJ15183.1| hypothetical protein SELMODRAFT_118783, partial [Selaginella 
moellendorffii]
Length=65

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRK  395
            L   ++++ F LP++ AA  LG+C +VLKKIC  NG+ RWP+RK
Sbjct  8    LKMSDLAQHFHLPINAAAKELGICPTVLKKICRRNGMRRWPHRK  51



>ref|XP_010550265.1| PREDICTED: uncharacterized protein LOC104821164 [Tarenaya hassleriana]
Length=184

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRK  395
            L+  ++ K F LP+ +AA  + VC +V+KKIC   GL RWP+RK
Sbjct  49   LTLKDIGKYFHLPVEEAARIMKVCPTVVKKICRRGGLARWPHRK  92



>gb|ETI55129.1| hypothetical protein F443_02170 [Phytophthora parasitica P1569]
 gb|ETM54634.1| hypothetical protein L914_02058 [Phytophthora parasitica]
 gb|ETO83869.1| hypothetical protein F444_02178 [Phytophthora parasitica P1976]
 gb|ETP52932.1| hypothetical protein F442_02128 [Phytophthora parasitica P10297]
Length=299

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +3

Query  180  TPTVTMSTVQIsnsgsnpnpnIKTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKIC  359
            +P  T+S   + +        +    KS++ D +   F  PL++ A+  G+C +++KKIC
Sbjct  99   SPAATLSHQPVQSPSKKRVRALPNASKSITLDMLRPHFEKPLAEVANIFGICMTLMKKIC  158

Query  360  YENGLVRWPYRKF  398
             +NG+ RWP+R+ 
Sbjct  159  RKNGVPRWPHRQI  171



>gb|ETM01445.1| hypothetical protein L917_01976 [Phytophthora parasitica]
Length=299

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +3

Query  180  TPTVTMSTVQIsnsgsnpnpnIKTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKIC  359
            +P  T+S   + +        +    KS++ D +   F  PL++ A+  G+C +++KKIC
Sbjct  99   SPAATLSHQPVQSPSKKRVRALPNASKSITLDMLRPHFEKPLAEVANIFGICMTLMKKIC  158

Query  360  YENGLVRWPYRKF  398
             +NG+ RWP+R+ 
Sbjct  159  RKNGVPRWPHRQI  171



>ref|XP_008915876.1| hypothetical protein PPTG_19247 [Phytophthora parasitica INRA-310]
 gb|ETM98808.1| hypothetical protein PPTG_19247 [Phytophthora parasitica INRA-310]
Length=299

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +3

Query  180  TPTVTMSTVQIsnsgsnpnpnIKTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKIC  359
            +P  T+S   + +        +    KS++ D +   F  PL++ A+  G+C +++KKIC
Sbjct  99   SPAATLSHQPVQSPSKKRVRALPNASKSITLDMLRPHFEKPLAEVANIFGICMTLMKKIC  158

Query  360  YENGLVRWPYRKF  398
             +NG+ RWP+R+ 
Sbjct  159  RKNGVPRWPHRQI  171



>gb|ETP24933.1| hypothetical protein F441_02143 [Phytophthora parasitica CJ01A1]
Length=302

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +3

Query  180  TPTVTMSTVQIsnsgsnpnpnIKTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKIC  359
            +P  T+S   + +        +    KS++ D +   F  PL++ A+  G+C +++KKIC
Sbjct  99   SPAATLSHQPVQSPSKKRVRALPNASKSITLDMLRPHFEKPLAEVANIFGICMTLMKKIC  158

Query  360  YENGLVRWPYRKF  398
             +NG+ RWP+R+ 
Sbjct  159  RKNGVPRWPHRQI  171



>gb|ETL48350.1| hypothetical protein L916_02040 [Phytophthora parasitica]
Length=302

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +3

Query  180  TPTVTMSTVQIsnsgsnpnpnIKTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKIC  359
            +P  T+S   + +        +    KS++ D +   F  PL++ A+  G+C +++KKIC
Sbjct  99   SPAATLSHQPVQSPSKKRVRALPNASKSITLDMLRPHFEKPLAEVANIFGICMTLMKKIC  158

Query  360  YENGLVRWPYRKF  398
             +NG+ RWP+R+ 
Sbjct  159  RKNGVPRWPHRQI  171



>ref|XP_011088847.1| PREDICTED: uncharacterized protein LOC105169981 [Sesamum indicum]
Length=369

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            + L   +    F LP+ DAA  + +C +VLKK+C  NG++RWPYRK  S
Sbjct  278  RKLKLKDFVHYFDLPIEDAAKKMNICPTVLKKVCRRNGVLRWPYRKIKS  326



>gb|ETK94964.1| hypothetical protein L915_02069 [Phytophthora parasitica]
Length=302

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +3

Query  180  TPTVTMSTVQIsnsgsnpnpnIKTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKIC  359
            +P  T+S   + +        +    KS++ D +   F  PL++ A+  G+C +++KKIC
Sbjct  99   SPAATLSHQPVQSPSKKRVRALPNASKSITLDMLRPHFEKPLAEVANIFGICMTLMKKIC  158

Query  360  YENGLVRWPYRKF  398
             +NG+ RWP+R+ 
Sbjct  159  RKNGVPRWPHRQI  171



>gb|KGN47592.1| hypothetical protein Csa_6G362990 [Cucumis sativus]
Length=166

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            ++ ++V +   LP+S+A+  L VC +VLKKIC  +GL RWPYRK  S
Sbjct  77   MTVNDVWEYLHLPISEASKKLNVCNTVLKKICRRSGLSRWPYRKIRS  123



>ref|XP_002681944.1| RWP-RK domain-containing protein [Naegleria gruberi]
 gb|EFC49200.1| RWP-RK domain-containing protein [Naegleria gruberi]
Length=795

 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K ++F ++ + F LP+ +AAD L +  + LK+IC EN + RWPYRK 
Sbjct  16   KDITFQDIQENFDLPIKEAADALQISLTQLKRICRENDIPRWPYRKL  62



>ref|XP_009532829.1| hypothetical protein PHYSODRAFT_517628 [Phytophthora sojae]
 gb|EGZ12496.1| hypothetical protein PHYSODRAFT_517628 [Phytophthora sojae]
Length=258

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            KS++ D +   F  PL++ A+  G+C +++KKIC +NG+ RWP+R+ 
Sbjct  99   KSITLDMLRPHFEKPLAEVANIFGICMTLMKKICRKNGVPRWPHRQI  145



>ref|NP_001170066.1| uncharacterized protein LOC100383982 [Zea mays]
 gb|ACN35695.1| unknown [Zea mays]
Length=426

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++S +E+ + FS  L DAA +LGVC + +K+IC ++G+ RWP+RK 
Sbjct  180  KTVSLEELQRYFSGSLKDAAKSLGVCPTTMKRICRQHGISRWPFRKL  226



>ref|XP_643997.1| RWP-RK domain-containing protein [Dictyostelium discoideum AX4]
 gb|EAL70040.1| RWP-RK domain-containing protein [Dictyostelium discoideum AX4]
Length=548

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +  + +SK F +P++  A  +GVC +VLKK+C  NG+ RWP+RK 
Sbjct  8    IDLEYLSKYFHMPINSVAKEIGVCATVLKKVCRRNGIPRWPHRKI  52



>ref|XP_002997995.1| RWP-RK domain-containing protein, putative [Phytophthora infestans 
T30-4]
 gb|EEY70341.1| RWP-RK domain-containing protein, putative [Phytophthora infestans 
T30-4]
Length=247

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            KS++ D +   F  PL++ A+  G+C +++KKIC +NG+ RWP+R+ 
Sbjct  91   KSITLDMLRPHFEKPLAEVANIFGICMTLMKKICRKNGVPRWPHRQI  137



>ref|XP_008913705.1| hypothetical protein PPTG_17267 [Phytophthora parasitica INRA-310]
 gb|ETL80669.1| hypothetical protein L917_18855 [Phytophthora parasitica]
 gb|ETN00939.1| hypothetical protein PPTG_17267 [Phytophthora parasitica INRA-310]
Length=501

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S +E+   F  P+ D A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  137  KHISIEELRAHFDRPIIDVAKDFGICITLMKKICRRNGIKRWPHRQIRS  185



>gb|ETP03474.1| hypothetical protein F441_19545 [Phytophthora parasitica CJ01A1]
Length=501

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S +E+   F  P+ D A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  137  KHISIEELRAHFDRPIIDVAKDFGICITLMKKICRRNGIKRWPHRQIRS  185



>gb|ETP31666.1| hypothetical protein F442_19489 [Phytophthora parasitica P10297]
Length=501

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S +E+   F  P+ D A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  137  KHISIEELRAHFDRPIIDVAKDFGICITLMKKICRRNGIKRWPHRQIRS  185



>ref|XP_005854508.1| rwp-rk domain-containing protein [Nannochloropsis gaditana CCMP526]
 gb|EKU21852.1| rwp-rk domain-containing protein [Nannochloropsis gaditana CCMP526]
Length=638

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            KS+S  E+ + F  P+ DAA  LG+C+++LKKIC    + RWPYR+  S
Sbjct  325  KSVSLVELRRYFDRPIEDAARALGICSTLLKKICRRYHIKRWPYRQVKS  373



>gb|ETI30088.1| hypothetical protein F443_22790 [Phytophthora parasitica P1569]
 gb|ETI33632.1| hypothetical protein F443_19709 [Phytophthora parasitica P1569]
Length=501

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S +E+   F  P+ D A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  137  KHISIEELRAHFDRPIIDVAKDFGICITLMKKICRRNGIKRWPHRQIRS  185



>ref|XP_010492488.1| PREDICTED: uncharacterized protein LOC104769865 isoform X1 [Camelina 
sativa]
Length=456

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K ++  +    F LP+  AAD L VC +V+KKIC E GL RWPYRK  S
Sbjct  361  KKMTVRDFRMHFHLPIETAADDLDVCPTVIKKICREGGLKRWPYRKIKS  409



>gb|ETM33860.1| hypothetical protein L914_18945 [Phytophthora parasitica]
Length=501

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S +E+   F  P+ D A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  137  KHISIEELRAHFDRPIIDVAKDFGICITLMKKICRRNGIKRWPHRQIRS  185



>gb|ETO62413.1| hypothetical protein F444_19674 [Phytophthora parasitica P1976]
Length=501

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S +E+   F  P+ D A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  137  KHISIEELRAHFDRPIIDVAKDFGICITLMKKICRRNGIKRWPHRQIRS  185



>gb|ETL27412.1| hypothetical protein L916_19037 [Phytophthora parasitica]
Length=501

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S +E+   F  P+ D A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  137  KHISIEELRAHFDRPIIDVAKDFGICITLMKKICRRNGIKRWPHRQIRS  185



>gb|ETK73979.1| hypothetical protein L915_19144 [Phytophthora parasitica]
Length=501

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S +E+   F  P+ D A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  137  KHISIEELRAHFDRPIIDVAKDFGICITLMKKICRRNGIKRWPHRQIRS  185



>ref|XP_008791759.1| PREDICTED: uncharacterized protein LOC103708559 isoform X1 [Phoenix 
dactylifera]
Length=345

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            S+   ++   F LP++DAA  LG+CT+ LKKIC ++G+ RWP RK  S
Sbjct  255  SMQLRDLVDYFHLPIADAAKELGICTTALKKICRKHGMPRWPQRKIKS  302



>gb|EAZ21661.1| hypothetical protein OsJ_05294 [Oryza sativa Japonica Group]
Length=658

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            KS++ +E+ K FS  L DAA +LGVC + +K+IC ++G+ RWP+RK 
Sbjct  422  KSVTLEELQKHFSGSLKDAARSLGVCPTTMKRICRQHGIPRWPFRKI  468



>ref|XP_005822947.1| hypothetical protein GUITHDRAFT_79210 [Guillardia theta CCMP2712]
 gb|EKX35967.1| hypothetical protein GUITHDRAFT_79210 [Guillardia theta CCMP2712]
Length=63

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRK  395
            +++ ++E+S+ F LP    A  LG+C + LKK+C  +G+ RWPYRK
Sbjct  5    RNIDYNELSQYFRLPEKVVAKQLGICLTSLKKVCRSHGIDRWPYRK  50



>ref|XP_008644135.1| PREDICTED: uncharacterized protein LOC100383982 isoform X1 [Zea 
mays]
Length=755

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++S +E+ + FS  L DAA +LGVC + +K+IC ++G+ RWP+RK 
Sbjct  509  KTVSLEELQRYFSGSLKDAAKSLGVCPTTMKRICRQHGISRWPFRKL  555



>ref|XP_010558556.1| PREDICTED: protein NLP1 isoform X1 [Tarenaya hassleriana]
Length=458

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            L+  ++ K F LP+ +AA T+ +C +V+KKIC   GL RWP+RK  S
Sbjct  365  LTLKDIGKYFHLPIEEAARTMKLCPTVVKKICRRGGLARWPHRKIKS  411



>gb|EWM22148.1| rwp-rk domain-containing protein [Nannochloropsis gaditana]
Length=1035

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            KS+S  E+ + F  P+ DAA  LG+C+++LKKIC    + RWPYR+  S
Sbjct  388  KSVSLVELRRYFDRPIEDAARALGICSTLLKKICRRYHIKRWPYRQVKS  436



>ref|XP_010526297.1| PREDICTED: protein NLP8 isoform X1 [Tarenaya hassleriana]
Length=902

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K++S + + + FS  L DAA +LGVC + LK+IC ++G+ RWPYRK 
Sbjct  555  TSEKTVSLNVLQQHFSRSLKDAARSLGVCPTTLKRICRQHGITRWPYRKI  604



>ref|XP_005834700.1| hypothetical protein GUITHDRAFT_69311, partial [Guillardia theta 
CCMP2712]
 gb|EKX47720.1| hypothetical protein GUITHDRAFT_69311, partial [Guillardia theta 
CCMP2712]
Length=111

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  246  KTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            +T  + L ++E+++ F + +++AA+ LG+C S +KKIC  +G+ RWP+RK  S
Sbjct  13   RTYTRPLWYEELAQYFHISINEAAEALGMCMSAIKKICRRHGISRWPHRKLAS  65



>gb|AFW70061.1| hypothetical protein ZEAMMB73_669675 [Zea mays]
Length=786

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++S +E+ + FS  L DAA +LGVC + +K+IC ++G+ RWP+RK 
Sbjct  540  KTVSLEELQRYFSGSLKDAAKSLGVCPTTMKRICRQHGISRWPFRKL  586



>ref|XP_010526304.1| PREDICTED: protein NLP8 isoform X2 [Tarenaya hassleriana]
Length=901

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K++S + + + FS  L DAA +LGVC + LK+IC ++G+ RWPYRK 
Sbjct  554  TSEKTVSLNVLQQHFSRSLKDAARSLGVCPTTLKRICRQHGITRWPYRKI  603



>emb|CEF97977.1| RWP-RK domain [Ostreococcus tauri]
Length=274

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  273  DEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            ++V  +F +P+++AA  LGVC +VLK  C E G+ RWP+RK 
Sbjct  23   EDVRGVFHMPITEAAKRLGVCVTVLKVRCRELGIARWPFRKM  64



>ref|XP_005826590.1| hypothetical protein GUITHDRAFT_76281 [Guillardia theta CCMP2712]
 gb|EKX39610.1| hypothetical protein GUITHDRAFT_76281 [Guillardia theta CCMP2712]
Length=104

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K +  DE+SK F LP    A  LG+C + LKK+C   G+ RWP+RK 
Sbjct  15   KEVKLDELSKYFHLPEKAVAKELGICLTSLKKLCRSYGITRWPFRKL  61



>gb|EAY84388.1| hypothetical protein OsI_05764 [Oryza sativa Indica Group]
Length=719

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            KS++ +E+ K FS  L DAA +LGVC + +K+IC ++G+ RWP+RK 
Sbjct  483  KSVTLEELQKHFSGSLKDAARSLGVCPTTMKRICRQHGIPRWPFRKI  529



>emb|CCA22055.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=420

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K  + +E+   F+ P++  A  LGVC +++KKIC +NGL RWP+R+  S
Sbjct  191  KEFTLNELRPFFNKPMTVVAKELGVCITLMKKICRKNGLNRWPHRRIRS  239



>ref|XP_008791760.1| PREDICTED: uncharacterized protein LOC103708559 isoform X2 [Phoenix 
dactylifera]
Length=300

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRK  395
            S+   ++   F LP++DAA  LG+CT+ LKKIC ++G+ RWP RK
Sbjct  255  SMQLRDLVDYFHLPIADAAKELGICTTALKKICRKHGMPRWPQRK  299



>emb|CCI10645.1| unnamed protein product [Albugo candida]
Length=465

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S DE+   F  P+ + A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  107  KQISLDELRAHFDRPIIEVAKKFGICITLMKKICRRNGIKRWPHRQIRS  155



>ref|XP_002900317.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY60110.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=457

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S +E+   F  P+ D A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  138  KHISIEELRAHFDRPIIDVAKDFGICITLMKKICRRNGIKRWPHRQIRS  186



>ref|XP_005824557.1| hypothetical protein GUITHDRAFT_77999, partial [Guillardia theta 
CCMP2712]
 gb|EKX37577.1| hypothetical protein GUITHDRAFT_77999, partial [Guillardia theta 
CCMP2712]
Length=92

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = +3

Query  270  FDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
             DE+SK F+LP    A  LG+C + LKK+C   G+ RWP+RK 
Sbjct  1    LDELSKFFNLPEKAVAKELGICLTSLKKLCRSYGITRWPFRKL  43



>ref|XP_009532398.1| hypothetical protein PHYSODRAFT_517686 [Phytophthora sojae]
 gb|EGZ12065.1| hypothetical protein PHYSODRAFT_517686 [Phytophthora sojae]
Length=504

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S +E+   F  P+ D A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  151  KHISIEELRAHFDRPIIDVAKDFGICITLMKKICRRNGIKRWPHRQIRS  199



>ref|XP_001753386.1| predicted protein [Physcomitrella patens]
 gb|EDQ81609.1| predicted protein [Physcomitrella patens]
Length=539

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            L   ++++ F LP++ AA  LG+C +VLKKIC  NG+ RWP+RK 
Sbjct  448  LKMTDLAQHFHLPINAAAKELGICPTVLKKICRRNGMRRWPHRKI  492



>gb|ABD96880.1| hypothetical protein [Cleome spinosa]
Length=89

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/47 (47%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            L+  ++ K F LP+ +AA  + VC +V+KKIC   GL RWP+RK  S
Sbjct  22   LTLKDIGKYFHLPVEEAARIMKVCPTVVKKICRRGGLARWPHRKIRS  68



>ref|XP_002453272.1| hypothetical protein SORBIDRAFT_04g002940 [Sorghum bicolor]
 gb|EES06248.1| hypothetical protein SORBIDRAFT_04g002940 [Sorghum bicolor]
Length=747

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++S +E+ + FS  L DAA +LGVC + +K+IC ++G+ RWP+RK 
Sbjct  517  KTVSLEELQRYFSGSLKDAAKSLGVCPTTMKRICRKHGISRWPFRKL  563



>gb|AAV64234.1| unknown [Zea mays]
Length=581

 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K+ S D + K FS  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  85   TSEKNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKI  134



>ref|XP_005821369.1| hypothetical protein GUITHDRAFT_80613, partial [Guillardia theta 
CCMP2712]
 gb|EKX34389.1| hypothetical protein GUITHDRAFT_80613, partial [Guillardia theta 
CCMP2712]
Length=53

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +++ D++S  F LP    A  LG+C + LKKIC   G++RWP+RK 
Sbjct  5    NITLDQLSHYFHLPEKQVAQELGICLTSLKKICRARGVMRWPFRKL  50



>ref|XP_001417754.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96047.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=361

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K ++  +VS  F+LP++ AA  L VC +VLK  C   G++RWPYRK 
Sbjct  41   TGTKIIALIDVSSRFALPIAQAAKELDVCVTVLKSTCRAFGIMRWPYRKM  90



>ref|XP_010453763.1| PREDICTED: uncharacterized protein LOC104735633 [Camelina sativa]
Length=448

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K ++  + S+ F LP+  AA+ + VC +V+KKIC E GL+RWP+RK 
Sbjct  352  KKMTVKDFSEHFHLPIEAAANEMKVCPTVMKKICREGGLMRWPHRKI  398



>emb|CCA24539.1| conserved hypothetical protein [Albugo laibachii Nc14]
 emb|CCA25972.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=471

 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K +S DE+   F  P+ + A   G+C +++KKIC  NG+ RWP+R+  S
Sbjct  110  KQISLDELRAHFDRPIIEVAKKFGICITLMKKICRRNGIKRWPHRQIRS  158



>ref|XP_008611230.1| hypothetical protein SDRG_07188 [Saprolegnia diclina VS20]
 gb|EQC35480.1| hypothetical protein SDRG_07188 [Saprolegnia diclina VS20]
Length=393

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K ++ +E+   F+ P++  A  +GVC +++KKIC +NGL RWP+R+  S
Sbjct  242  KGVTLNELRPHFNKPMAVVAQEMGVCITLMKKICRKNGLSRWPHRRIRS  290



>ref|XP_005708254.1| transcription factor [Galdieria sulphuraria]
 gb|EME31734.1| transcription factor [Galdieria sulphuraria]
Length=427

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            KSL+ D +   F   L +AA  LGVC++V+K +C + G+ RWPYRK  S
Sbjct  6    KSLTLDCLKNYFGRTLEEAAKELGVCSTVIKNVCRQYGIRRWPYRKIQS  54



>gb|AFW73401.1| hypothetical protein ZEAMMB73_631978 [Zea mays]
 gb|AIB04521.1| NLP transcription factor, partial [Zea mays]
Length=236

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            T  K L+F+++S+ FS+P+  AA  L V  +VLK+ C + G+ RWPYRK  S
Sbjct  68   TKKKELTFEQLSRHFSVPIKQAAQELNVGVTVLKRQCRKLGVTRWPYRKLKS  119



>ref|XP_008647199.1| PREDICTED: protein RKD3-like [Zea mays]
Length=235

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            T  K L+F+++S+ FS+P+  AA  L V  +VLK+ C + G+ RWPYRK  S
Sbjct  67   TKKKELTFEQLSRHFSVPIKQAAQELNVGVTVLKRQCRKLGVTRWPYRKLKS  118



>ref|XP_006652467.1| PREDICTED: protein NLP2-like [Oryza brachyantha]
Length=935

 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K++S D + K FS  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  565  TAEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRQHGISRWPSRKI  614



>ref|XP_010527164.1| PREDICTED: protein RKD5 [Tarenaya hassleriana]
Length=240

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            LS +E++K F LP+S+A+  L V  +VLK+ C E G+ RWP+RK  S
Sbjct  105  LSIEELAKYFDLPISEASTKLNVGVTVLKRKCREFGIPRWPHRKIKS  151



>ref|XP_008787160.1| PREDICTED: protein RKD1 [Phoenix dactylifera]
Length=194

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +3

Query  252  DPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            + K+L+F+EVS+ F +P++ AA  L V  ++LK+ C + G+ RWP+RK  S
Sbjct  50   EEKALTFEEVSRCFYMPITQAAKELNVGVTLLKRKCRKLGIPRWPHRKLKS  100



>ref|XP_005702485.1| RWP-RK domain-containing protein [Galdieria sulphuraria]
 gb|EME25965.1| RWP-RK domain-containing protein [Galdieria sulphuraria]
Length=231

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +LS D++S+ F LP  +AA  LGVC ++LK+ C E G+  WP+RK 
Sbjct  125  NLSIDQLSRYFDLPRKEAAQQLGVCVTLLKRRCRELGIHCWPFRKM  170



>ref|XP_010239470.1| PREDICTED: uncharacterized protein LOC104585158 [Brachypodium 
distachyon]
Length=336

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            + FD+++  F LP+ +AA+ L VC +VLK IC   G+ RWP+RK 
Sbjct  278  MKFDDIAPYFHLPIVEAAEKLDVCATVLKGICRRVGVQRWPHRKV  322



>ref|NP_001130095.1| uncharacterized protein LOC100191188 [Zea mays]
 gb|ACF78222.1| unknown [Zea mays]
Length=390

 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K+ S D + K FS  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  13   KNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKI  59



>ref|XP_006382000.1| hypothetical protein POPTR_0006s23960g [Populus trichocarpa]
 gb|ERP59797.1| hypothetical protein POPTR_0006s23960g [Populus trichocarpa]
Length=270

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRK  395
            L+ D+  + F LP+ DAA  L +C +V+KKIC + G+ RWP+RK
Sbjct  192  LTLDDFRQYFHLPIEDAARRLHLCPTVVKKICRKFGMTRWPHRK  235



>ref|XP_007219091.1| hypothetical protein PRUPE_ppa015130mg [Prunus persica]
 gb|EMJ20290.1| hypothetical protein PRUPE_ppa015130mg [Prunus persica]
Length=126

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +L  DE+ K F LP++ AA  L V  +VLK+ C E  ++RWP+RK 
Sbjct  17   ALELDEIQKYFDLPITQAAKKLNVGLTVLKRRCRELNIMRWPHRKI  62



>ref|XP_010091956.1| hypothetical protein L484_003769 [Morus notabilis]
 gb|EXB48286.1| hypothetical protein L484_003769 [Morus notabilis]
Length=416

 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +S  ++  +  LP+ +AA +L VC +V+KKIC +N LVRWP+RK 
Sbjct  326  MSLSDLQSVLHLPMDEAARSLNVCPTVVKKICRKNNLVRWPFRKI  370



>emb|CCI42666.1| unnamed protein product [Albugo candida]
Length=140

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K ++ + +   F  PL++AA   G+C ++LKKIC +NG+ RWP+R+ 
Sbjct  12   KMITLEMLQPYFHKPLAEAAAHFGICVTLLKKICRKNGVSRWPHRQV  58



>gb|EEE61255.1| hypothetical protein OsJ_15319 [Oryza sativa Japonica Group]
Length=914

 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K++S D + K FS  L DAA +LGVC + LK+IC  +G+ RWP RK 
Sbjct  563  TAEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRHHGISRWPSRKI  612



>ref|XP_005822915.1| hypothetical protein GUITHDRAFT_79357 [Guillardia theta CCMP2712]
 gb|EKX35935.1| hypothetical protein GUITHDRAFT_79357 [Guillardia theta CCMP2712]
Length=66

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLSG  407
            +S +E+++   LP    A  LG+C + LKK+C ++G+ RWPYRK   G
Sbjct  2    VSMEELTQYLHLPEKTVAKELGICLTSLKKLCRQHGITRWPYRKVRCG  49



>ref|NP_001053196.1| Os04g0495800 [Oryza sativa Japonica Group]
 dbj|BAF15110.1| Os04g0495800 [Oryza sativa Japonica Group]
Length=936

 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K++S D + K FS  L DAA +LGVC + LK+IC  +G+ RWP RK 
Sbjct  563  TAEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRHHGISRWPSRKI  612



>ref|XP_005824448.1| hypothetical protein GUITHDRAFT_154973 [Guillardia theta CCMP2712]
 gb|EKX37468.1| hypothetical protein GUITHDRAFT_154973 [Guillardia theta CCMP2712]
Length=145

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K    +E+SK F +P    A  LG+C + LKK+C   G+ RWP+RK  S
Sbjct  5    KDFKLEELSKYFHMPEKAVAKELGICLTSLKKLCRSYGITRWPFRKLKS  53



>sp|Q0JC27.2|NLP2_ORYSJ RecName: Full=Protein NLP2; Short=OsNLP2; AltName: Full=NIN-like 
protein 2; AltName: Full=Nodule inception protein-like protein 
2 [Oryza sativa Japonica Group]
 emb|CAE03110.2| OSJNBa0067K08.5 [Oryza sativa Japonica Group]
 dbj|BAG95924.1| unnamed protein product [Oryza sativa Japonica Group]
Length=936

 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K++S D + K FS  L DAA +LGVC + LK+IC  +G+ RWP RK 
Sbjct  563  TAEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRHHGISRWPSRKI  612



>emb|CAH67387.1| OSIGBa0159F11.11 [Oryza sativa Indica Group]
 gb|EEC77553.1| hypothetical protein OsI_16472 [Oryza sativa Indica Group]
Length=936

 Score = 56.2 bits (134),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K++S D + K FS  L DAA +LGVC + LK+IC  +G+ RWP RK 
Sbjct  563  TAEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRHHGISRWPSRKI  612



>ref|XP_008445526.1| PREDICTED: protein RKD2-like isoform X1 [Cucumis melo]
Length=370

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            ++ ++V +   LP+S+A+  L VC +VLKKIC  +GL RWPYRK  S
Sbjct  281  MTVNDVWEYLHLPISEASKKLNVCNTVLKKICRRSGLSRWPYRKIRS  327



>gb|KFM24743.1| Protein NLP9 [Auxenochlorella protothecoides]
Length=142

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  279  VSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            +++ F  P+SDAA  + +C +VLKKIC  +G+ RWP RK  S
Sbjct  52   IAQYFRYPISDAAQMMDICPTVLKKICRRHGINRWPQRKLKS  93



>ref|XP_008445527.1| PREDICTED: uncharacterized protein LOC103488516 isoform X2 [Cucumis 
melo]
Length=369

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            ++ ++V +   LP+S+A+  L VC +VLKKIC  +GL RWPYRK  S
Sbjct  280  MTVNDVWEYLHLPISEASKKLNVCNTVLKKICRRSGLSRWPYRKIRS  326



>ref|XP_005836965.1| hypothetical protein GUITHDRAFT_151353 [Guillardia theta CCMP2712]
 gb|EKX49985.1| hypothetical protein GUITHDRAFT_151353 [Guillardia theta CCMP2712]
Length=217

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +3

Query  255  PKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            P  L+ D + K + +PL  AA  LG+C + +KK+C + G+++WPY++ 
Sbjct  106  PVVLTLDLLEKFYGMPLHVAAKRLGICQTAIKKVCRKLGIMKWPYKEM  153



>ref|XP_002446731.1| hypothetical protein SORBIDRAFT_06g021370 [Sorghum bicolor]
 gb|EES11059.1| hypothetical protein SORBIDRAFT_06g021370 [Sorghum bicolor]
Length=610

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K+ S D + K FS  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  232  TSEKNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKI  281



>dbj|BAJ95517.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=672

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            + +S +E+   FS  L DAA +LGVC + +K+IC ++G+ RWP+RK 
Sbjct  497  RPISLNELQGYFSGSLKDAARSLGVCPTTMKRICRQHGISRWPFRKI  543



>ref|XP_001784045.1| predicted protein [Physcomitrella patens]
 gb|EDQ51151.1| predicted protein [Physcomitrella patens]
Length=612

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRK  395
            L   ++++ F LP++ AA  LG+C +VLKKIC  NG+ RWP+RK
Sbjct  470  LKMIDLAQHFHLPINAAAKELGICPTVLKKICRRNGMRRWPHRK  513



>gb|KGN55364.1| hypothetical protein Csa_4G646380 [Cucumis sativus]
Length=183

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/47 (43%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            ++ +++ +   LP+S+AA  + +C +V+KKIC  +GL RWPYRK  S
Sbjct  93   MTVNDLKEYLHLPISEAAKKMNLCLTVVKKICRRSGLRRWPYRKVKS  139



>gb|AAV64196.1| unknown [Zea mays]
 tpg|DAA37139.1| TPA: hypothetical protein ZEAMMB73_593515 [Zea mays]
Length=1194

 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K+ S D + K FS  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  725  TSEKNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKI  774



>ref|XP_008669225.1| PREDICTED: protein NLP2-like [Zea mays]
 gb|AIB05247.1| NLP transcription factor, partial [Zea mays]
Length=931

 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K+ S D + K FS  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  567  TSEKNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKI  616



>ref|XP_008802620.1| PREDICTED: protein RKD1-like [Phoenix dactylifera]
Length=300

 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K+L+F+EVS  F +P++ AA  L +  ++LKK C E G+ RWP+RK  S
Sbjct  116  KALTFEEVSHYFYMPITQAAKELNIGVTLLKKKCRELGIPRWPHRKLKS  164



>tpg|DAA37138.1| TPA: hypothetical protein ZEAMMB73_593515 [Zea mays]
Length=1089

 Score = 55.8 bits (133),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K+ S D + K FS  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  725  TSEKNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKI  774



>ref|XP_008234884.1| PREDICTED: protein RKD4 [Prunus mume]
Length=146

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +L  DE+ K F LP++ AA  L V  +VLK+ C E  ++RWP+RK 
Sbjct  37   ALELDEIQKYFDLPITQAAKKLNVGLTVLKRRCRELKIMRWPHRKI  82



>gb|EYU27184.1| hypothetical protein MIMGU_mgv1a026577mg, partial [Erythranthe 
guttata]
Length=289

 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPY  389
            ++L   +    F LP+ DAA  + +C +VLKKIC  NG++RWPY
Sbjct  197  RNLKLKDFIDYFDLPIEDAARKMNICPTVLKKICRRNGVLRWPY  240



>ref|XP_010240492.1| PREDICTED: protein NLP2-like [Brachypodium distachyon]
Length=953

 Score = 55.5 bits (132),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K++S D + K FS  L DAA +LGVC + LK+IC  +G+ RWP RK 
Sbjct  568  TAEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRAHGISRWPSRKI  617



>ref|XP_005702472.1| RWP-RK domain-containing protein [Galdieria sulphuraria]
 gb|EME25952.1| RWP-RK domain-containing protein [Galdieria sulphuraria]
Length=300

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +LS D++S+ F LP  +AA  LGVC ++LK+ C E G+  WP+RK 
Sbjct  194  NLSIDQLSRYFDLPRKEAAQQLGVCVTLLKRRCRELGIHCWPFRKM  239



>gb|AFW58707.1| hypothetical protein ZEAMMB73_961517 [Zea mays]
Length=939

 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K+ S D + K FS  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  562  KNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKI  608



>ref|XP_009540211.1| hypothetical protein PHYSODRAFT_382362, partial [Phytophthora 
sojae]
 gb|EGZ04343.1| hypothetical protein PHYSODRAFT_382362 [Phytophthora sojae]
Length=83

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  291  FSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            F+ P++  A  LGVC +++KKIC  NGLVRWP+R+  S
Sbjct  4    FNKPMAVVAKELGVCITLMKKICRRNGLVRWPHRRIRS  41



>ref|XP_008661302.1| PREDICTED: uncharacterized protein LOC100191188 isoform X1 [Zea 
mays]
 gb|AFW58708.1| hypothetical protein ZEAMMB73_961517 [Zea mays]
Length=945

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K+ S D + K FS  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  568  KNFSLDVLRKYFSGSLRDAAMSLGVCPTTLKRICRQHGISRWPSRKI  614



>ref|XP_008812750.1| PREDICTED: protein NLP1-like [Phoenix dactylifera]
Length=953

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++S  E+ K F+  L DAA +LGVC + LK+IC  +G+ RWP RK 
Sbjct  637  KTISLQELRKYFAGSLKDAAKSLGVCPTTLKRICRHHGISRWPSRKI  683



>ref|XP_010538845.1| PREDICTED: protein NLP7-like isoform X2 [Tarenaya hassleriana]
Length=895

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++S D + + F+  L DAA +LGVC + +K+IC ++G++RWP RK 
Sbjct  585  KTISLDVLQQYFTGSLKDAAKSLGVCPTTMKRICRQHGILRWPSRKI  631



>gb|KHN23358.1| Protein RKD4 [Glycine soja]
Length=217

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  246  KTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K  P +L F+E+SK F +P+++AA  + V  ++LKK C E  ++RWP RK 
Sbjct  104  KKRPCALEFEEISKYFGVPINEAAKQMNVGVTMLKKRCRELNIMRWPRRKI  154



>ref|XP_010538846.1| PREDICTED: protein NLP7-like isoform X3 [Tarenaya hassleriana]
Length=894

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++S D + + F+  L DAA +LGVC + +K+IC ++G++RWP RK 
Sbjct  585  KTISLDVLQQYFTGSLKDAAKSLGVCPTTMKRICRQHGILRWPSRKI  631



>gb|AAD38282.1|AC007789_8 hypothetical protein [Oryza sativa Japonica Group]
Length=771

 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 60/126 (48%), Gaps = 11/126 (9%)
 Frame = +3

Query  684   DEFKYGFPSDGLSAISYKWWGSRS-TDGNEDTKKEGNAEESKQQSAVPMEESAVKTG---  851
             D+FKYGFPS GLS  + KWWG+ S T+        G A ES  +++  M +  +  G   
Sbjct  640   DDFKYGFPSSGLSLQTMKWWGTDSHTETTPAKDDNGEAPESANEASKGMTDDELDWGADE  699

Query  852   -------KSNVDSFRADSLSDLREQAAKEGKEALRLGVYREHSLFKLDLTKRKVLLQVFK  1010
                     S + +  +  L  LR +A  +G++ L         L +L+  ++  L QVF 
Sbjct  700   AEAEADADSAITTEPSAQLCSLRRKAVDDGRKLLTGKSCGGLELCRLNKRQKMALAQVFG  759

Query  1011  SSYPPQ  1028
             +S P Q
Sbjct  760   ASLPEQ  765



>ref|XP_010446048.1| PREDICTED: uncharacterized protein LOC104728818 [Camelina sativa]
Length=514

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K L+  +++ LF LP+  AA  + +C +VLKKIC +  L+RWP+RK 
Sbjct  419  KRLTLKDINMLFHLPIETAAKQMNLCPTVLKKICRKGSLMRWPHRKI  465



>ref|XP_004955210.1| PREDICTED: protein RKD1-like [Setaria italica]
Length=160

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            ++ K+L+F+ VS+ FS+P+  AA  L V  + +KK C E G+ RWP+RK 
Sbjct  34   SEAKALTFELVSQHFSMPIEQAARELNVGVTGMKKRCRELGIPRWPHRKV  83



>ref|XP_010485077.1| PREDICTED: uncharacterized protein LOC104763398 [Camelina sativa]
Length=511

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K L+  +++ LF LP+  AA  + +C +VLKKIC +  L+RWP+RK 
Sbjct  416  KRLTLKDINMLFHLPIETAAKQMNLCPTVLKKICRKGSLMRWPHRKI  462



>gb|EAZ20046.1| hypothetical protein OsJ_35645 [Oryza sativa Japonica Group]
Length=420

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L   +++  F LP++ AA  L +C + LK IC ++G++RWPYRK  S
Sbjct  335  KQLQLSDIAPYFELPIAKAAKKLDICATALKGICRKHGVLRWPYRKVRS  383



>ref|XP_004955211.1| PREDICTED: protein RKD3-like [Setaria italica]
Length=180

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRK  395
            K+L+F+ VS+ F +P+  AA  L V  +VLKK C E G+ RWP+RK
Sbjct  124  KALTFELVSRHFCMPIKQAAQELNVGVTVLKKRCRELGIPRWPHRK  169



>gb|KCW89738.1| hypothetical protein EUGRSUZ_A01998 [Eucalyptus grandis]
Length=84

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 4/61 (7%)
 Frame = +3

Query  573  MPKSAAASQQQGSKTAQTLSSQHLLSVNLPKATTAGSDEFKYGFPSDGLSAISYKWWGSR  752
            +P+S   SQQ  SK  Q+   Q ++S +L K + A  DEFKYGFPS+GLS  S KWWGS 
Sbjct  3    LPRS---SQQPESKQGQSGQIQSVISGSLIK-SLAVLDEFKYGFPSNGLSVTSNKWWGSG  58

Query  753  S  755
            S
Sbjct  59   S  59



>ref|XP_002671084.1| predicted protein [Naegleria gruberi]
 gb|EFC38340.1| predicted protein [Naegleria gruberi]
Length=550

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +3

Query  273  DEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            +++ + F LPL +AA  LG C+SVLK+ C + G+ RWPYR+  S
Sbjct  8    EQIQQYFHLPLEEAAIKLGCCSSVLKRTCRQLGIKRWPYRRMKS  51



>ref|XP_010939773.1| PREDICTED: protein RKD1-like [Elaeis guineensis]
Length=253

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +3

Query  252  DPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            + K L+F+EVS  F +P++ AA  L +  ++LKK C E G+ RWP+RK  S
Sbjct  114  EEKVLTFEEVSHYFYMPITQAAKELNIGVTLLKKKCRELGIPRWPHRKLKS  164



>ref|XP_009384610.1| PREDICTED: protein NLP1-like [Musa acuminata subsp. malaccensis]
Length=930

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            +++S  E+ K F+  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  623  RTVSLQELQKYFAGSLKDAARSLGVCPTTLKRICRQHGITRWPSRKI  669



>ref|XP_010538844.1| PREDICTED: protein NLP7-like isoform X1 [Tarenaya hassleriana]
Length=918

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++S D + + F+  L DAA +LGVC + +K+IC ++G++RWP RK 
Sbjct  585  KTISLDVLQQYFTGSLKDAAKSLGVCPTTMKRICRQHGILRWPSRKI  631



>ref|XP_010648375.1| PREDICTED: uncharacterized protein LOC104878986 [Vitis vinifera]
Length=373

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRK  395
            L+  + ++ F LP+  AA+ L +C +V+KKIC ++G+ RWPYRK
Sbjct  274  LTIYDFTRYFHLPIDKAAEGLNICPTVVKKICRKHGVDRWPYRK  317



>ref|XP_002455780.1| hypothetical protein SORBIDRAFT_03g025130 [Sorghum bicolor]
 gb|EES00900.1| hypothetical protein SORBIDRAFT_03g025130 [Sorghum bicolor]
Length=403

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +3

Query  246  KTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            KT    + FDE+ K F +P++ AA  + V  +VLKK C E G++RWP+RK  S
Sbjct  240  KTRLDHIGFDELRKYFYMPITRAAREMNVGLTVLKKRCRELGVLRWPHRKMKS  292



>ref|XP_006402676.1| hypothetical protein EUTSA_v10005779mg [Eutrema salsugineum]
 gb|ESQ44129.1| hypothetical protein EUTSA_v10005779mg [Eutrema salsugineum]
Length=898

 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K +S D + + FS  L DAA +LGVC + LK+IC ++G++RWP RK 
Sbjct  569  KYVSLDVLQQYFSGSLKDAAKSLGVCPTTLKRICRQHGIMRWPSRKI  615



>emb|CDP14498.1| unnamed protein product [Coffea canephora]
Length=823

 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            KS+S  ++ + FS  L DAA ++GVC + LK+IC ++G+ RWP RK 
Sbjct  505  KSISLQDLRQYFSGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKI  551



>gb|EMT25644.1| hypothetical protein F775_06752 [Aegilops tauschii]
Length=585

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            + +S  E+   FS  L DAA +LGVC + +K+IC ++G+ RWP+RK 
Sbjct  351  RPVSLKELQGYFSGSLKDAARSLGVCPTTMKRICRQHGISRWPFRKI  397



>dbj|BAK05032.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=163

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +3

Query  261  SLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            S++ +++S+ F LP+ +A+ +L +  S+LKK C E G+ RWP+RK  S
Sbjct  30   SITLNDISQYFHLPIREASRSLKIGLSILKKKCREYGIPRWPHRKLKS  77



>ref|XP_009401874.1| PREDICTED: protein NLP1-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=864

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K +S  E+ K F+  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  577  KIVSLQELQKYFAGSLKDAAKSLGVCPTTLKRICRQHGITRWPSRKI  623



>dbj|BAF42666.1| minus dominant protein [Pleodorina starrii]
Length=69

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/47 (43%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            L+  ++S  F +P+ DA+  LG+ T+ L +IC ++G+ RWPYRK  S
Sbjct  17   LTIKDISSFFRMPIKDASRELGLSTTYLLRICRQHGIPRWPYRKVAS  63



>ref|XP_010918251.1| PREDICTED: protein NLP1-like isoform X2 [Elaeis guineensis]
Length=832

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++   E+ K F+  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  516  KTIGLQELQKYFAGSLKDAAKSLGVCPTTLKRICRQHGISRWPSRKI  562



>ref|XP_009401873.1| PREDICTED: protein NLP1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=894

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K +S  E+ K F+  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  577  KIVSLQELQKYFAGSLKDAAKSLGVCPTTLKRICRQHGITRWPSRKI  623



>ref|XP_010028835.1| PREDICTED: protein NLP2-like [Eucalyptus grandis]
 ref|XP_010028836.1| PREDICTED: protein NLP2-like [Eucalyptus grandis]
 ref|XP_010028837.1| PREDICTED: protein NLP2-like [Eucalyptus grandis]
 ref|XP_010028838.1| PREDICTED: protein NLP2-like [Eucalyptus grandis]
 gb|KCW55665.1| hypothetical protein EUGRSUZ_I01519 [Eucalyptus grandis]
 gb|KCW55666.1| hypothetical protein EUGRSUZ_I01519 [Eucalyptus grandis]
Length=926

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++S D + + F+  L DAA ++GVC + LK+IC ++G+ RWP RK 
Sbjct  598  KTISLDVLRQYFAGSLKDAARSIGVCPTTLKRICRQHGITRWPSRKI  644



>ref|XP_004501440.1| PREDICTED: hybrid signal transduction histidine kinase A-like 
[Cicer arietinum]
Length=467

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = +3

Query  264  LSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRK  395
            L+ +++  LF LP+ +A++ + +C +V+KK C + GL RWPYRK
Sbjct  361  LTLNDLCDLFHLPIEEASECVKLCPTVVKKTCRKAGLARWPYRK  404



>ref|XP_006664445.1| PREDICTED: uncharacterized protein LOC102713973 [Oryza brachyantha]
Length=333

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 30/49 (61%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L   +V+  F  P++ AA  L VC + LK IC +NG+ RWPYRK  S
Sbjct  250  KKLCLGDVAPYFDQPIAKAARKLDVCATALKAICRKNGVQRWPYRKVRS  298



>ref|XP_004301980.1| PREDICTED: protein NLP5-like [Fragaria vesca subsp. vesca]
Length=882

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K+++ + + K FS  L DAA +LGVC++ LK+IC ++G+ RWP RK 
Sbjct  591  KAITLEVLRKYFSGSLKDAAKSLGVCSTTLKRICRQHGIKRWPSRKI  637



>ref|XP_008675515.1| PREDICTED: uncharacterized protein LOC103651621 [Zea mays]
 tpg|DAA59034.1| TPA: hypothetical protein ZEAMMB73_949603 [Zea mays]
 gb|AIB04529.1| NLP transcription factor, partial [Zea mays]
Length=391

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +3

Query  246  KTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            KT    + FDE+ K F +P++ AA  + V  +VLKK C E G+ RWP+RK  S
Sbjct  227  KTRMDHIGFDELRKYFYMPITRAAREMNVGLTVLKKRCRELGVARWPHRKMKS  279



>ref|XP_009415647.1| PREDICTED: uncharacterized protein LOC103996450 [Musa acuminata 
subsp. malaccensis]
Length=338

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            + L   +V+    LP+++AA  L +C + LKK+C ++G++RWPYRK 
Sbjct  247  RRLHLKDVANYVHLPITEAAKELQICPTALKKVCRKHGMLRWPYRKI  293



>gb|EPS64185.1| hypothetical protein M569_10596, partial [Genlisea aurea]
Length=133

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K LS + +S+ F LP++ AA  L V  ++LKK C E G+ RWP+RK +S
Sbjct  8    KKLSREAISEYFYLPITQAARELNVGLTLLKKRCRELGIKRWPHRKLMS  56



>ref|XP_009385448.1| PREDICTED: protein NLP2-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=937

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++S  ++ + +S  L DAA ++GVC + LK+IC ENG+ RWP RK 
Sbjct  569  KNVSLSDLQQYYSGTLKDAAKSIGVCPTTLKRICRENGISRWPSRKI  615



>gb|ABA96321.1| RWP-RK domain containing protein [Oryza sativa Japonica Group]
Length=452

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKFLS  404
            K L   +++  F LP++ AA  L +C + LK IC ++G++RWPYRK  S
Sbjct  367  KQLQLSDIAPYFELPIAKAAKKLDICATALKGICRKHGVLRWPYRKVRS  415



>gb|EAZ00241.1| hypothetical protein OsI_22248 [Oryza sativa Indica Group]
Length=534

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  243  IKTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            ++++ K+L+F+ VS+ F +P++ AA  L V  ++LKK C E G+ RWP+RK 
Sbjct  407  VRSEEKALTFELVSQYFYMPITQAARELNVGLTLLKKKCRELGIPRWPHRKM  458



>ref|XP_008237985.1| PREDICTED: protein NLP4-like isoform X1 [Prunus mume]
Length=911

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K+++ + + K FS  L DAA+++GVC++ LK+IC ++G+ RWP RK 
Sbjct  594  KAITLEVLRKYFSGSLKDAANSIGVCSTTLKRICRQHGIKRWPSRKI  640



>ref|XP_006656806.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62260, 
mitochondrial-like [Oryza brachyantha]
Length=835

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +3

Query  243  IKTDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            ++++ KSL+F+ VS+ F +P++ AA  L V  ++LKK C E G+ RWP+RK 
Sbjct  708  VRSEDKSLTFELVSQYFYMPITQAARELNVGLTLLKKKCRELGIPRWPHRKM  759



>ref|XP_007210497.1| hypothetical protein PRUPE_ppa001086mg [Prunus persica]
 gb|EMJ11696.1| hypothetical protein PRUPE_ppa001086mg [Prunus persica]
Length=912

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K+++ + + K FS  L DAA+++GVC++ LK+IC ++G+ RWP RK 
Sbjct  594  KAITLEVLRKYFSGSLKDAANSIGVCSTTLKRICRQHGIKRWPSRKI  640



>ref|XP_010912769.1| PREDICTED: LOW QUALITY PROTEIN: protein NLP2-like [Elaeis guineensis]
Length=964

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%), Gaps = 0/50 (0%)
 Frame = +3

Query  249  TDPKSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            T  K++S   + + F   L DAA ++GVC + LK+IC ++G++RWP RK 
Sbjct  579  TTEKNISLSVLQRYFPFSLKDAAKSMGVCPTTLKRICRQHGILRWPSRKI  628



>ref|XP_009385447.1| PREDICTED: protein NLP2-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=947

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++S  ++ + +S  L DAA ++GVC + LK+IC ENG+ RWP RK 
Sbjct  579  KNVSLSDLQQYYSGTLKDAAKSIGVCPTTLKRICRENGISRWPSRKI  625



>ref|XP_010918248.1| PREDICTED: protein NLP1-like isoform X1 [Elaeis guineensis]
 ref|XP_010918249.1| PREDICTED: protein NLP1-like isoform X1 [Elaeis guineensis]
 ref|XP_010918250.1| PREDICTED: protein NLP1-like isoform X1 [Elaeis guineensis]
Length=956

 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  258  KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF  398
            K++   E+ K F+  L DAA +LGVC + LK+IC ++G+ RWP RK 
Sbjct  640  KTIGLQELQKYFAGSLKDAAKSLGVCPTTLKRICRQHGISRWPSRKI  686



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3994635736224