BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c101936_g1_i1 len=245 path=[223:0-244]

Length=245
                                                                      Score     E

gb|EYU39551.1|  hypothetical protein MIMGU_mgv1a019423mg              83.6    1e-17   
ref|XP_009780362.1|  PREDICTED: LOB domain-containing protein 1-like  82.0    3e-17   
ref|XP_004240278.1|  PREDICTED: LOB domain-containing protein 1-like  82.4    4e-17   
ref|XP_009588230.1|  PREDICTED: LOB domain-containing protein 1-like  82.0    4e-17   
gb|KGN50464.1|  hypothetical protein Csa_5G175870                     81.6    4e-17   
ref|XP_006360671.1|  PREDICTED: LOB domain-containing protein 11-...  82.0    5e-17   
ref|XP_004143693.1|  PREDICTED: LOB domain-containing protein 1-like  81.6    5e-17   
ref|XP_009611728.1|  PREDICTED: LOB domain-containing protein 1-like  81.6    6e-17   
ref|XP_009378148.1|  PREDICTED: LOB domain-containing protein 1-like  81.3    9e-17   
emb|CDP04291.1|  unnamed protein product                              80.9    1e-16   
ref|XP_008369398.1|  PREDICTED: LOB domain-containing protein 1-like  81.3    1e-16   
ref|XP_007219697.1|  hypothetical protein PRUPE_ppa023989mg           81.3    1e-16   
ref|XP_007009738.1|  LOB domain-containing protein 1                  80.9    1e-16   
ref|NP_172268.1|  LOB domain-containing protein 1                     80.5    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008795252.1|  PREDICTED: LOB domain-containing protein 1       80.5    1e-16   
ref|XP_002889671.1|  LOB domain protein 1                             80.5    1e-16   
gb|KHG16785.1|  LOB domain-containing 1 -like protein                 80.5    1e-16   
ref|XP_010458003.1|  PREDICTED: LOB domain-containing protein 1       80.1    2e-16   
ref|XP_010475566.1|  PREDICTED: LOB domain-containing protein 1-like  80.1    2e-16   
ref|XP_010488117.1|  PREDICTED: LOB domain-containing protein 1-like  79.7    2e-16   
emb|CAN78080.1|  hypothetical protein VITISV_021299                   79.7    2e-16   Vitis vinifera
ref|XP_010557308.1|  PREDICTED: LOB domain-containing protein 11-...  80.1    2e-16   
ref|XP_010910576.1|  PREDICTED: LOB domain-containing protein 1-like  79.7    3e-16   
ref|XP_010658441.1|  PREDICTED: LOB domain-containing protein 1-like  79.7    3e-16   
ref|XP_010244970.1|  PREDICTED: LOB domain-containing protein 1-like  79.7    3e-16   
ref|XP_008789049.1|  PREDICTED: LOB domain-containing protein 1-like  79.3    3e-16   
ref|XP_010521775.1|  PREDICTED: LOB domain-containing protein 1       79.7    4e-16   
ref|XP_006436214.1|  hypothetical protein CICLE_v10033956mg           79.3    4e-16   
gb|EEE62158.1|  hypothetical protein OsJ_16945                        77.0    4e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009140905.1|  PREDICTED: LOB domain-containing protein 11      79.7    4e-16   
emb|CDY62454.1|  BnaA04g28360D                                        79.3    4e-16   
emb|CDX77182.1|  BnaC04g39770D                                        79.3    4e-16   
ref|XP_008463908.1|  PREDICTED: LOB domain-containing protein 1-like  79.0    4e-16   
ref|XP_006485928.1|  PREDICTED: LOB domain-containing protein 1-like  79.3    5e-16   
gb|KHN05716.1|  LOB domain-containing protein 1                       79.0    5e-16   
gb|ACU21351.1|  unknown                                               79.0    5e-16   Glycine max [soybeans]
ref|XP_010669677.1|  PREDICTED: LOB domain-containing protein 1-like  79.3    5e-16   
ref|XP_003539733.1|  PREDICTED: LOB domain-containing protein 1-like  79.0    5e-16   
ref|XP_008805041.1|  PREDICTED: LOB domain-containing protein 11-...  79.0    6e-16   
gb|AFK47293.1|  unknown                                               79.0    6e-16   
ref|XP_006305673.1|  hypothetical protein CARUB_v10010390mg           78.6    7e-16   
gb|EYU39788.1|  hypothetical protein MIMGU_mgv1a019167mg              78.2    8e-16   
ref|XP_007205910.1|  hypothetical protein PRUPE_ppa011528mg           78.6    8e-16   
ref|XP_002526340.1|  LOB domain-containing protein, putative          78.6    8e-16   Ricinus communis
ref|XP_003538040.1|  PREDICTED: LOB domain-containing protein 1-like  78.2    9e-16   
ref|NP_180417.2|  LOB domain-containing protein 11                    78.6    9e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAD21485.1|  hypothetical protein                                  78.6    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32292.1|  hypothetical protein AALP_AA6G223700                  78.2    1e-15   
ref|XP_006417754.1|  hypothetical protein EUTSA_v10008781mg           78.2    1e-15   
gb|KDO73135.1|  hypothetical protein CISIN_1g047491mg                 78.2    1e-15   
ref|XP_006488170.1|  PREDICTED: LOB domain-containing protein 11-...  78.2    1e-15   
ref|XP_006424648.1|  hypothetical protein CICLE_v10029283mg           78.2    1e-15   
ref|XP_009784336.1|  PREDICTED: LOB domain-containing protein 1-like  77.8    1e-15   
ref|XP_004149555.1|  PREDICTED: LOB domain-containing protein 1-like  77.8    1e-15   
ref|XP_006294934.1|  hypothetical protein CARUB_v10023989mg           78.2    1e-15   
ref|XP_011090094.1|  PREDICTED: LOB domain-containing protein 1       77.8    1e-15   
emb|CDY22713.1|  BnaC08g43470D                                        77.8    1e-15   
ref|XP_010470075.1|  PREDICTED: LOB domain-containing protein 11-...  78.2    1e-15   
ref|XP_009118406.1|  PREDICTED: LOB domain-containing protein 1-like  77.8    2e-15   
ref|XP_006654943.1|  PREDICTED: LOB domain-containing protein 11-...  77.0    2e-15   
ref|XP_008224697.1|  PREDICTED: LOB domain-containing protein 1-like  77.8    2e-15   
emb|CDY06285.1|  BnaA09g49180D                                        77.4    2e-15   
ref|XP_006485927.1|  PREDICTED: LOB domain-containing protein 1-like  77.4    2e-15   
ref|XP_006436215.1|  hypothetical protein CICLE_v10032782mg           77.4    2e-15   
ref|XP_003597159.1|  LOB domain protein                               77.4    2e-15   
ref|XP_010104136.1|  hypothetical protein L484_014422                 77.8    2e-15   
ref|XP_007015486.1|  LOB domain-containing protein 1                  77.4    2e-15   
gb|AAV33307.1|  putatvie LOB domain protein                           77.8    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008463550.1|  PREDICTED: LOB domain-containing protein 1-like  77.4    2e-15   
ref|XP_004505954.1|  PREDICTED: LOB domain-containing protein 11-...  77.4    2e-15   
ref|XP_008370637.1|  PREDICTED: LOB domain-containing protein 1-like  77.0    3e-15   
ref|XP_010666030.1|  PREDICTED: LOB domain-containing protein 1-like  77.0    3e-15   
ref|XP_010108453.1|  hypothetical protein L484_014124                 77.0    3e-15   
ref|XP_006409877.1|  hypothetical protein EUTSA_v10017165mg           77.4    3e-15   
ref|XP_004307415.1|  PREDICTED: LOB domain-containing protein 1-like  77.0    3e-15   
gb|KFK43106.1|  hypothetical protein AALP_AA1G080800                  75.5    4e-15   
ref|XP_002282070.1|  PREDICTED: LOB domain-containing protein 1       76.6    4e-15   Vitis vinifera
ref|XP_010510616.1|  PREDICTED: LOB domain-containing protein 11-...  76.6    4e-15   
emb|CDY31207.1|  BnaC03g46840D                                        76.6    4e-15   
ref|XP_004294671.1|  PREDICTED: LOB domain-containing protein 1-like  76.6    5e-15   
ref|XP_004240601.1|  PREDICTED: LOB domain-containing protein 1-like  76.3    5e-15   
ref|XP_008783779.1|  PREDICTED: LOB domain-containing protein 1-like  76.3    5e-15   
ref|XP_002440509.1|  hypothetical protein SORBIDRAFT_09g002190        76.3    5e-15   Sorghum bicolor [broomcorn]
ref|XP_004960340.1|  PREDICTED: LOB domain-containing protein 11-...  76.3    5e-15   
ref|XP_002880987.1|  hypothetical protein ARALYDRAFT_481760           76.3    5e-15   
ref|XP_009148039.1|  PREDICTED: LOB domain-containing protein 1-like  76.6    5e-15   
emb|CDX93609.1|  BnaA06g04390D                                        76.3    5e-15   
ref|XP_010414515.1|  PREDICTED: LOB domain-containing protein 11 ...  76.3    6e-15   
ref|XP_010414516.1|  PREDICTED: LOB domain-containing protein 11 ...  76.3    6e-15   
ref|XP_009776231.1|  PREDICTED: LOB domain-containing protein 1-like  75.9    6e-15   
emb|CDX95115.1|  BnaC05g05560D                                        76.3    6e-15   
ref|XP_010068859.1|  PREDICTED: LOB domain-containing protein 1-like  76.3    6e-15   
ref|XP_010651120.1|  PREDICTED: LOB domain-containing protein 1-like  75.9    7e-15   
ref|XP_009133875.1|  PREDICTED: LOB domain-containing protein 11-...  76.3    7e-15   
ref|XP_002312035.2|  hypothetical protein POPTR_0008s04350g           75.9    7e-15   Populus trichocarpa [western balsam poplar]
ref|XP_009358251.1|  PREDICTED: LOB domain-containing protein 1-like  75.9    7e-15   
ref|XP_009411741.1|  PREDICTED: LOB domain-containing protein 1-like  75.5    9e-15   
ref|XP_009409552.1|  PREDICTED: LOB domain-containing protein 1-like  75.5    9e-15   
ref|XP_008650200.1|  PREDICTED: LOB domain-containing protein 1-like  75.9    9e-15   
ref|XP_009380677.1|  PREDICTED: LOB domain-containing protein 1-like  75.9    9e-15   
ref|XP_006365742.1|  PREDICTED: LOB domain-containing protein 11-...  75.5    9e-15   
ref|XP_011020741.1|  PREDICTED: LOB domain-containing protein 1-like  75.9    9e-15   
ref|XP_006340510.1|  PREDICTED: LOB domain-containing protein 1-like  75.1    1e-14   
ref|XP_009794709.1|  PREDICTED: LOB domain-containing protein 1-l...  75.5    1e-14   
ref|XP_004147299.1|  PREDICTED: LOB domain-containing protein 11-...  75.5    1e-14   
emb|CAN70036.1|  hypothetical protein VITISV_019695                   78.2    1e-14   Vitis vinifera
ref|XP_006649894.1|  PREDICTED: LOB domain-containing protein 1-like  75.5    1e-14   
gb|EYU36210.1|  hypothetical protein MIMGU_mgv1a013837mg              75.5    1e-14   
ref|XP_011027000.1|  PREDICTED: LOB domain-containing protein 1-like  75.5    1e-14   
ref|XP_002465424.1|  hypothetical protein SORBIDRAFT_01g038650        75.5    1e-14   Sorghum bicolor [broomcorn]
ref|XP_006843281.1|  hypothetical protein AMTR_s00080p00153120        75.1    1e-14   
ref|XP_009406941.1|  PREDICTED: LOB domain-containing protein 1-like  75.1    1e-14   
ref|XP_009103694.1|  PREDICTED: LOB domain-containing protein 11-...  75.5    1e-14   
ref|NP_001147202.1|  LOB domain protein 11                            75.5    1e-14   Zea mays [maize]
ref|XP_008358286.1|  PREDICTED: LOB domain-containing protein 1-like  75.1    1e-14   
ref|XP_004237662.1|  PREDICTED: LOB domain-containing protein 1-like  74.7    1e-14   
emb|CDY04570.1|  BnaA07g13960D                                        75.1    1e-14   
gb|KHN33447.1|  LOB domain-containing protein 11                      74.7    1e-14   
gb|AAT40528.1|  LOB domain protein 1, putative                        75.1    1e-14   Solanum demissum
ref|XP_010043701.1|  PREDICTED: LOB domain-containing protein 1       75.1    1e-14   
gb|EAY89550.1|  hypothetical protein OsI_11084                        75.1    1e-14   Oryza sativa Indica Group [Indian rice]
emb|CDY15755.1|  BnaC04g15690D                                        75.1    1e-14   
ref|XP_008660255.1|  PREDICTED: LOB domain-containing protein 1       75.1    1e-14   
ref|XP_009794710.1|  PREDICTED: LOB domain-containing protein 1-l...  75.1    2e-14   
ref|XP_009794708.1|  PREDICTED: LOB domain-containing protein 1-l...  75.1    2e-14   
tpg|DAA44812.1|  TPA: putative LOB domain-containing family protein   75.1    2e-14   
ref|XP_004251265.1|  PREDICTED: LOB domain-containing protein 1       74.7    2e-14   
ref|XP_003542002.1|  PREDICTED: LOB domain-containing protein 11-...  74.7    2e-14   
ref|NP_001049778.1|  Os03g0287400                                     74.7    2e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010658439.1|  PREDICTED: LOB domain-containing protein 1       73.9    2e-14   
ref|XP_011089355.1|  PREDICTED: LOB domain-containing protein 1       74.3    2e-14   
gb|KHG03359.1|  LOB domain-containing 1 -like protein                 74.3    2e-14   
ref|XP_006343464.1|  PREDICTED: LOB domain-containing protein 11-...  74.3    3e-14   
gb|KHG27704.1|  LOB domain-containing 11 -like protein                74.3    3e-14   
ref|XP_007150227.1|  hypothetical protein PHAVU_005G137300g           73.9    3e-14   
ref|XP_010542601.1|  PREDICTED: LOB domain-containing protein 1-like  74.3    3e-14   
ref|XP_009378147.1|  PREDICTED: LOB domain-containing protein 1-like  73.9    4e-14   
ref|XP_009610820.1|  PREDICTED: LOB domain-containing protein 1-like  73.6    4e-14   
ref|XP_003566656.1|  PREDICTED: LOB domain-containing protein 1-like  73.6    4e-14   
ref|XP_009626018.1|  PREDICTED: LOB domain-containing protein 1-like  73.6    5e-14   
ref|XP_008656534.1|  PREDICTED: LOB domain-containing protein 1       73.6    5e-14   
ref|XP_003606493.1|  LOB domain protein                               73.2    6e-14   
ref|XP_008233367.1|  PREDICTED: LOB domain-containing protein 1-like  73.2    7e-14   
ref|XP_007143674.1|  hypothetical protein PHAVU_007G092000g           73.2    8e-14   
ref|XP_004143835.1|  PREDICTED: pentatricopeptide repeat-containi...  74.3    9e-14   
ref|XP_008369390.1|  PREDICTED: LOB domain-containing protein 1-like  73.2    9e-14   
ref|XP_004987050.1|  PREDICTED: LOB domain-containing protein 1-like  72.8    9e-14   
ref|XP_011077047.1|  PREDICTED: LOB domain-containing protein 1-like  72.8    9e-14   
ref|XP_008445860.1|  PREDICTED: LOB domain-containing protein 1-like  72.8    1e-13   
gb|KHN17110.1|  LOB domain-containing protein 1                       72.8    1e-13   
ref|XP_003536369.1|  PREDICTED: LOB domain-containing protein 11-...  72.8    1e-13   
ref|XP_004487250.1|  PREDICTED: LOB domain-containing protein 11-...  72.4    1e-13   
ref|XP_004496332.1|  PREDICTED: LOB domain-containing protein 11-...  72.8    1e-13   
ref|XP_003556215.1|  PREDICTED: LOB domain-containing protein 11-...  72.4    1e-13   
ref|XP_004173617.1|  PREDICTED: LOB domain-containing protein 11-...  71.2    1e-13   
ref|XP_003591977.1|  LOB domain-containing protein                    72.4    2e-13   
gb|EMT13503.1|  hypothetical protein F775_02335                       72.4    2e-13   
ref|XP_008376313.1|  PREDICTED: LOB domain-containing protein 1-like  72.4    2e-13   
gb|ACU17708.1|  unknown                                               70.9    2e-13   Glycine max [soybeans]
emb|CBI31510.3|  unnamed protein product                              72.4    2e-13   
ref|XP_010920920.1|  PREDICTED: LOB domain-containing protein 1       72.0    2e-13   
gb|KHN21539.1|  LOB domain-containing protein 11                      71.6    2e-13   
gb|KGN51231.1|  hypothetical protein Csa_5G496470                     71.6    2e-13   
ref|XP_009333736.1|  PREDICTED: LOB domain-containing protein 1-like  72.0    2e-13   
ref|XP_003561741.1|  PREDICTED: LOB domain-containing protein 1       71.6    2e-13   
ref|XP_010922519.1|  PREDICTED: LOB domain-containing protein 1-like  71.2    3e-13   
ref|XP_006597316.1|  PREDICTED: LOB domain-containing protein 11-...  70.9    3e-13   
ref|XP_010253538.1|  PREDICTED: LOB domain-containing protein 1-like  71.2    4e-13   
ref|XP_007132174.1|  hypothetical protein PHAVU_011G072200g           71.2    4e-13   
gb|ACU24293.1|  unknown                                               71.2    4e-13   Glycine max [soybeans]
ref|XP_009772858.1|  PREDICTED: LOB domain-containing protein 1-like  70.9    5e-13   
ref|XP_010056894.1|  PREDICTED: LOB domain-containing protein 1-like  70.5    5e-13   
ref|XP_002315279.1|  LOB domain protein 11                            70.5    5e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010032234.1|  PREDICTED: LOB domain-containing protein 1-like  70.9    6e-13   
ref|XP_002275323.1|  PREDICTED: LOB domain-containing protein 1       70.1    7e-13   Vitis vinifera
gb|ADU54137.1|  lateral organ boundaries domain 1                     70.5    7e-13   
gb|KDP46164.1|  hypothetical protein JCGZ_06675                       70.5    7e-13   
ref|XP_009396864.1|  PREDICTED: LOB domain-containing protein 11-...  70.1    8e-13   
gb|KCW73808.1|  hypothetical protein EUGRSUZ_E02410                   68.9    9e-13   
gb|EPS63137.1|  hypothetical protein M569_11650                       68.9    1e-12   
ref|XP_006436216.1|  hypothetical protein CICLE_v10032772mg           69.3    2e-12   
ref|XP_006486488.1|  PREDICTED: LOB domain-containing protein 1-like  69.3    2e-12   
gb|KDO44597.1|  hypothetical protein CISIN_1g047530mg                 67.0    2e-12   
gb|KDP44115.1|  hypothetical protein JCGZ_05582                       68.9    2e-12   
ref|XP_002274953.3|  PREDICTED: uncharacterized protein LOC100265000  70.1    3e-12   Vitis vinifera
ref|XP_009593636.1|  PREDICTED: LOB domain-containing protein 1-like  68.6    3e-12   
emb|CDP08929.1|  unnamed protein product                              68.2    4e-12   
ref|XP_010909448.1|  PREDICTED: LOB domain-containing protein 1-like  67.8    5e-12   
emb|CAN69741.1|  hypothetical protein VITISV_017585                   67.8    6e-12   Vitis vinifera
ref|XP_009763968.1|  PREDICTED: LOB domain-containing protein 1-like  67.8    6e-12   
ref|XP_008463578.1|  PREDICTED: LOB domain-containing protein 1-like  67.4    8e-12   
ref|XP_004147298.1|  PREDICTED: LOB domain-containing protein 1-like  66.2    2e-11   
ref|XP_004161318.1|  PREDICTED: LOB domain-containing protein 1-like  66.2    2e-11   
ref|NP_179946.1|  LOB domain-containing protein 10                    67.4    2e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CBI31509.3|  unnamed protein product                              65.9    2e-11   
emb|CAN75803.1|  hypothetical protein VITISV_030052                   65.5    2e-11   Vitis vinifera
ref|XP_010318580.1|  PREDICTED: LOB domain-containing protein 1-like  65.9    2e-11   
ref|XP_010531219.1|  PREDICTED: LOB domain-containing protein 10-...  66.6    3e-11   
ref|XP_002275182.2|  PREDICTED: LOB domain-containing protein 1       65.5    3e-11   Vitis vinifera
ref|XP_008463841.1|  PREDICTED: LOB domain-containing protein 12-...  65.5    3e-11   
ref|XP_006404852.1|  hypothetical protein EUTSA_v10000525mg           66.6    4e-11   
ref|XP_002880519.1|  LOB domain family protein                        66.6    4e-11   
ref|XP_002274989.2|  PREDICTED: LOB domain-containing protein 1       65.9    4e-11   Vitis vinifera
ref|XP_006340400.1|  PREDICTED: LOB domain-containing protein 1-like  65.1    5e-11   
ref|XP_010472359.1|  PREDICTED: LOB domain-containing protein 10-...  66.2    5e-11   
ref|XP_010417109.1|  PREDICTED: LOB domain-containing protein 10-...  66.2    5e-11   
ref|XP_004143222.1|  PREDICTED: LOB domain-containing protein 12-...  64.7    6e-11   
emb|CBI31511.3|  unnamed protein product                              64.7    6e-11   
ref|XP_010429315.1|  PREDICTED: LOB domain-containing protein 10      65.9    7e-11   
ref|XP_002275345.1|  PREDICTED: LOB domain-containing protein 1       64.3    7e-11   Vitis vinifera
ref|XP_009392713.1|  PREDICTED: LOB domain-containing protein 1-like  64.3    1e-10   
ref|XP_010658649.1|  PREDICTED: LOB domain-containing protein 1-like  63.9    1e-10   
ref|XP_006340077.1|  PREDICTED: LOB domain-containing protein 1-like  63.9    1e-10   
ref|XP_006338222.1|  PREDICTED: LOB domain-containing protein 36-...  65.1    1e-10   
emb|CBI31504.3|  unnamed protein product                              64.7    2e-10   
ref|XP_009140479.1|  PREDICTED: LOB domain-containing protein 10      64.7    2e-10   
ref|XP_004232054.1|  PREDICTED: LOB domain-containing protein 36-...  64.7    2e-10   
ref|XP_009362272.1|  PREDICTED: LOB domain-containing protein 36-...  63.9    2e-10   
ref|XP_010464781.1|  PREDICTED: LOB domain-containing protein 36-...  64.7    2e-10   
ref|XP_008371805.1|  PREDICTED: LOB domain-containing protein 36-...  63.5    2e-10   
ref|XP_008225579.1|  PREDICTED: LOB domain-containing protein 6-like  63.9    3e-10   
ref|XP_006296515.1|  hypothetical protein CARUB_v10025704mg           64.3    3e-10   
emb|CBI31506.3|  unnamed protein product                              62.4    3e-10   
ref|XP_007212478.1|  hypothetical protein PRUPE_ppa015145mg           63.5    3e-10   
emb|CDY40054.1|  BnaC05g12610D                                        62.4    4e-10   
ref|XP_009149087.1|  PREDICTED: LOB domain-containing protein 3       62.4    4e-10   
emb|CDY03987.1|  BnaC02g37020D                                        62.0    4e-10   
emb|CBI31505.3|  unnamed protein product                              62.0    4e-10   
ref|XP_009129401.1|  PREDICTED: LOB domain-containing protein 25-...  62.0    4e-10   
ref|XP_009416706.1|  PREDICTED: LOB domain-containing protein 1-like  62.0    5e-10   
ref|XP_002275051.1|  PREDICTED: LOB domain-containing protein 1       62.0    5e-10   Vitis vinifera
emb|CDY52150.1|  BnaA02g34590D                                        63.5    5e-10   
ref|XP_002866728.1|  hypothetical protein ARALYDRAFT_496913           63.5    6e-10   
ref|XP_004150042.1|  PREDICTED: LOB domain-containing protein 4-like  62.0    6e-10   
ref|XP_006344071.1|  PREDICTED: LOB domain-containing protein 12-...  61.2    6e-10   
ref|XP_006344072.1|  PREDICTED: LOB domain-containing protein 12-...  61.2    6e-10   
ref|XP_010444719.1|  PREDICTED: LOB domain-containing protein 36-...  63.5    6e-10   
ref|XP_009132714.1|  PREDICTED: LOB domain-containing protein 12-...  62.4    7e-10   
ref|XP_009388947.1|  PREDICTED: LOB domain-containing protein 4       61.6    7e-10   
ref|XP_010484574.1|  PREDICTED: LOB domain-containing protein 36      63.2    8e-10   
ref|XP_010687953.1|  PREDICTED: LOB domain-containing protein 36-...  63.2    8e-10   
ref|XP_009349366.1|  PREDICTED: LOB domain-containing protein 6-like  62.0    9e-10   
ref|XP_009336227.1|  PREDICTED: LOB domain-containing protein 6-like  62.0    9e-10   
gb|AAM64523.1|  unknown                                               61.6    9e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459193.1|  PREDICTED: LOB domain-containing protein 3-like  61.2    1e-09   
emb|CDP04292.1|  unnamed protein product                              61.2    1e-09   
ref|XP_002984853.1|  hypothetical protein SELMODRAFT_49084            60.5    1e-09   
gb|ABK23871.1|  unknown                                               61.2    1e-09   Picea sitchensis
ref|XP_010476763.1|  PREDICTED: LOB domain-containing protein 3       61.2    1e-09   
ref|XP_002985907.1|  hypothetical protein SELMODRAFT_49085            60.5    1e-09   
emb|CDY01457.1|  BnaA07g12300D                                        63.2    1e-09   
ref|NP_201488.1|  LOB domain-containing protein 36 (ASYMMETRIC LE...  62.8    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103474.1|  PREDICTED: LOB domain-containing protein 36      62.8    1e-09   
ref|XP_010658438.1|  PREDICTED: LOB domain-containing protein 1-like  61.2    1e-09   
gb|KDP31887.1|  hypothetical protein JCGZ_12348                       62.4    1e-09   
ref|XP_009117760.1|  PREDICTED: LOB domain-containing protein 3-like  60.8    1e-09   
emb|CDY50999.1|  BnaA09g56280D                                        60.8    1e-09   
emb|CDP04293.1|  unnamed protein product                              61.2    1e-09   
dbj|BAF00455.1|  hypothetical protein                                 62.4    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105838.1|  LOB domain-containing protein 6                  61.6    1e-09   Zea mays [maize]
ref|XP_009412520.1|  PREDICTED: LOB domain-containing protein 12-...  60.8    1e-09   
ref|XP_002513395.1|  LOB domain-containing protein, putative          60.8    1e-09   Ricinus communis
ref|XP_008673457.1|  PREDICTED: LOB domain-containing protein 6 i...  61.6    1e-09   
ref|XP_006280835.1|  hypothetical protein CARUB_v10026811mg           62.4    1e-09   
ref|XP_010521993.1|  PREDICTED: LOB domain-containing protein 12      60.8    1e-09   
ref|XP_007155957.1|  hypothetical protein PHAVU_003G246700g           62.0    1e-09   
gb|ADE77053.1|  unknown                                               60.8    1e-09   
ref|XP_010064042.1|  PREDICTED: LOB domain-containing protein 4-l...  60.8    1e-09   
ref|XP_009412521.1|  PREDICTED: LOB domain-containing protein 12-...  60.5    2e-09   
ref|XP_006422217.1|  hypothetical protein CICLE_v100061132mg          58.9    2e-09   
gb|KHG26276.1|  LOB domain-containing 36 -like protein                62.0    2e-09   
ref|XP_002892914.1|  predicted protein                                60.5    2e-09   
ref|XP_006425834.1|  hypothetical protein CICLE_v10027275mg           62.0    2e-09   
ref|XP_006393884.1|  hypothetical protein EUTSA_v10004535mg           62.4    2e-09   
ref|XP_008673454.1|  PREDICTED: LOB domain-containing protein 6 i...  61.6    2e-09   
emb|CDM85427.1|  unnamed protein product                              61.2    2e-09   
ref|XP_011030434.1|  PREDICTED: LOB domain-containing protein 4-like  60.5    2e-09   
ref|XP_009600699.1|  PREDICTED: LOB domain-containing protein 36-...  62.0    2e-09   
ref|XP_008244000.1|  PREDICTED: LOB domain-containing protein 15      61.2    2e-09   
gb|KDP25103.1|  hypothetical protein JCGZ_22638                       60.1    2e-09   
gb|KFK43864.1|  hypothetical protein AALP_AA1G184000                  60.5    2e-09   
ref|XP_006416807.1|  hypothetical protein EUTSA_v10009386mg           60.5    2e-09   
ref|XP_004970852.1|  PREDICTED: LOB domain-containing protein 6-like  61.2    2e-09   
emb|CDY12784.1|  BnaC07g16490D                                        62.0    2e-09   
ref|XP_006360231.1|  PREDICTED: LOB domain-containing protein 36-...  61.6    2e-09   
ref|NP_001045046.1|  Os01g0889400                                     61.2    2e-09   
ref|NP_001241746.1|  ASYMMETRIC LEAVES2                               61.2    2e-09   
ref|XP_004233943.1|  PREDICTED: LOB domain-containing protein 36-...  61.6    2e-09   
gb|KDO61639.1|  hypothetical protein CISIN_1g044340mg                 60.1    2e-09   
ref|XP_006475320.1|  PREDICTED: LOB domain-containing protein 4-like  60.1    2e-09   
ref|XP_006382972.1|  hypothetical protein POPTR_0005s10060g           59.3    2e-09   
ref|XP_009600700.1|  PREDICTED: LOB domain-containing protein 36-...  61.6    2e-09   
gb|EYU31583.1|  hypothetical protein MIMGU_mgv1a018865mg              60.5    2e-09   
ref|NP_001105986.1|  protein IAL1                                     61.2    2e-09   
ref|XP_010542672.1|  PREDICTED: LOB domain-containing protein 12-...  60.5    2e-09   
ref|XP_008654208.1|  PREDICTED: protein IAL1 isoform X1               61.2    2e-09   
ref|XP_009790388.1|  PREDICTED: protein LATERAL ORGAN BOUNDARIES-...  58.5    2e-09   
emb|CDY24027.1|  BnaC03g16640D                                        60.1    2e-09   
ref|XP_011009273.1|  PREDICTED: LOB domain-containing protein 36-...  61.6    2e-09   
ref|XP_009784491.1|  PREDICTED: LOB domain-containing protein 12      60.1    2e-09   
ref|XP_007022340.1|  LOB domain-containing protein 4                  60.1    2e-09   
ref|XP_006350925.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    3e-09   
ref|XP_004242550.1|  PREDICTED: LOB domain-containing protein 12      60.1    3e-09   
ref|XP_008388838.1|  PREDICTED: LOB domain-containing protein 6-like  60.8    3e-09   
ref|XP_009141041.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    3e-09   
ref|XP_008241536.1|  PREDICTED: LOB domain-containing protein 36      61.6    3e-09   
ref|XP_004978582.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    3e-09   
ref|XP_009144327.1|  PREDICTED: LOB domain-containing protein 12      60.1    3e-09   
ref|XP_010263734.1|  PREDICTED: LOB domain-containing protein 6-like  61.6    3e-09   
ref|XP_001775491.1|  predicted protein                                60.1    3e-09   
ref|XP_006435806.1|  hypothetical protein CICLE_v10032929mg           60.1    3e-09   
emb|CDX81767.1|  BnaC08g38340D                                        60.1    3e-09   
ref|XP_009597089.1|  PREDICTED: LOB domain-containing protein 12-...  59.7    3e-09   
dbj|BAK04804.1|  predicted protein                                    60.8    3e-09   
ref|XP_009366786.1|  PREDICTED: LOB domain-containing protein 36-...  61.2    3e-09   
ref|XP_002879253.1|  hypothetical protein ARALYDRAFT_481923           60.1    3e-09   
ref|XP_004288064.1|  PREDICTED: LOB domain-containing protein 36-...  61.6    3e-09   
ref|XP_006296371.1|  hypothetical protein CARUB_v10025543mg           60.1    3e-09   
ref|XP_008226099.1|  PREDICTED: LOB domain-containing protein 4       60.1    3e-09   
ref|XP_007212145.1|  hypothetical protein PRUPE_ppa012253mg           60.1    3e-09   
ref|XP_007206519.1|  hypothetical protein PRUPE_ppa019397mg           60.5    3e-09   
gb|ABU44494.1|  LOB domain protein 6                                  60.8    3e-09   
ref|XP_003564815.1|  PREDICTED: LOB domain-containing protein 6-like  60.5    3e-09   
ref|XP_009629688.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    3e-09   
ref|XP_011080777.1|  PREDICTED: LOB domain-containing protein 12      59.7    3e-09   
ref|XP_010414305.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    3e-09   
emb|CDY72536.1|  BnaA03g56340D                                        59.7    3e-09   
gb|AFW64564.1|  putative LOB domain-containing family protein         60.1    3e-09   
ref|NP_565695.1|  LOB domain-containing protein 12                    60.1    3e-09   
ref|XP_010469890.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    3e-09   
ref|XP_002307250.2|  LOB domain protein 28                            61.2    3e-09   
ref|XP_010510404.1|  PREDICTED: LOB domain-containing protein 12      60.1    3e-09   
ref|XP_009369547.1|  PREDICTED: LOB domain-containing protein 15-...  60.5    3e-09   
ref|XP_008679328.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    3e-09   
ref|XP_009760471.1|  PREDICTED: LOB domain-containing protein 12-...  59.7    3e-09   
emb|CDP09242.1|  unnamed protein product                              59.7    3e-09   
ref|XP_008370861.1|  PREDICTED: LOB domain-containing protein 6 i...  60.5    3e-09   
ref|XP_010255134.1|  PREDICTED: LOB domain-containing protein 36      61.2    3e-09   
ref|XP_011039216.1|  PREDICTED: LOB domain-containing protein 36 ...  60.8    3e-09   
gb|EMT24931.1|  hypothetical protein F775_20715                       60.5    3e-09   
gb|KDP31888.1|  hypothetical protein JCGZ_12349                       61.2    3e-09   
ref|XP_008383078.1|  PREDICTED: LOB domain-containing protein 4-l...  59.7    3e-09   
gb|EPS57704.1|  hypothetical protein M569_17113                       60.5    3e-09   
ref|XP_008383080.1|  PREDICTED: LOB domain-containing protein 4-l...  59.7    4e-09   
ref|XP_003525697.1|  PREDICTED: LOB domain-containing protein 36-...  60.8    4e-09   
ref|XP_010093051.1|  hypothetical protein L484_016263                 59.7    4e-09   
ref|XP_001764110.1|  predicted protein                                58.9    4e-09   
ref|XP_001778407.1|  predicted protein                                58.9    4e-09   
gb|EYU44367.1|  hypothetical protein MIMGU_mgv1a009012mg              61.6    4e-09   
ref|XP_009391699.1|  PREDICTED: LOB domain-containing protein 12-...  59.3    4e-09   
ref|XP_004242472.2|  PREDICTED: LOB domain-containing protein 24-...  59.7    4e-09   
ref|XP_004294159.1|  PREDICTED: LOB domain-containing protein 4-like  59.7    4e-09   
ref|XP_003599327.1|  LOB domain-containing protein                    59.7    4e-09   
ref|XP_011022119.1|  PREDICTED: LOB domain-containing protein 4-like  59.3    4e-09   
ref|XP_003611797.1|  LOB domain-containing protein                    61.2    4e-09   
ref|XP_004233326.1|  PREDICTED: LOB domain-containing protein 25      59.3    4e-09   
emb|CDY51008.1|  BnaC04g54590D                                        59.3    4e-09   
ref|XP_002979980.1|  hypothetical protein SELMODRAFT_58936            58.9    4e-09   
emb|CDY49773.1|  BnaA02g28980D                                        59.3    4e-09   
ref|XP_009630099.1|  PREDICTED: LOB domain-containing protein 36-...  60.8    4e-09   
ref|XP_002310683.1|  hypothetical protein POPTR_0007s08290g           59.3    4e-09   
ref|XP_009377477.1|  PREDICTED: LOB domain-containing protein 36-...  60.1    4e-09   
ref|XP_004978387.1|  PREDICTED: LOB domain-containing protein 12-...  60.1    4e-09   
ref|XP_007133379.1|  hypothetical protein PHAVU_011G174300g           59.3    4e-09   
ref|XP_010086870.1|  hypothetical protein L484_005283                 60.1    4e-09   
ref|XP_011039214.1|  PREDICTED: LOB domain-containing protein 36 ...  60.5    5e-09   
gb|AAX21517.1|  AS2                                                   60.1    5e-09   
ref|XP_006422220.1|  hypothetical protein CICLE_v10006208mg           58.9    5e-09   
ref|XP_008354773.1|  PREDICTED: LOB domain-containing protein 15-...  60.1    5e-09   
ref|XP_010673843.1|  PREDICTED: LOB domain-containing protein 6       60.1    5e-09   
ref|XP_010497944.1|  PREDICTED: LOB domain-containing protein 3-l...  59.3    5e-09   
ref|XP_008365927.1|  PREDICTED: LOB domain-containing protein 15-...  60.1    5e-09   
ref|XP_009792980.1|  PREDICTED: LOB domain-containing protein 36-...  60.8    5e-09   
ref|XP_007203679.1|  hypothetical protein PRUPE_ppa026393mg           60.8    5e-09   
ref|XP_006292048.1|  hypothetical protein CARUB_v10018238mg           58.9    5e-09   
ref|XP_010554689.1|  PREDICTED: LOB domain-containing protein 12-...  59.3    5e-09   
ref|XP_002264049.2|  PREDICTED: LOB domain-containing protein 4       58.9    6e-09   
ref|XP_008338277.1|  PREDICTED: LOB domain-containing protein 36-...  60.8    6e-09   
emb|CBI23279.3|  unnamed protein product                              60.5    6e-09   
emb|CDY20041.1|  BnaA09g02100D                                        58.9    6e-09   
ref|XP_009603165.1|  PREDICTED: LOB domain-containing protein 4-like  58.9    6e-09   
ref|XP_008372032.1|  PREDICTED: LOB domain-containing protein 4-like  58.9    6e-09   
ref|XP_010412413.1|  PREDICTED: LOB domain-containing protein 25-...  58.9    6e-09   
ref|XP_004148465.1|  PREDICTED: LOB domain-containing protein 36-...  60.5    6e-09   
dbj|BAB02689.1|  unnamed protein product                              58.5    6e-09   
ref|XP_010905635.1|  PREDICTED: LOB domain-containing protein 36-...  60.5    6e-09   
ref|XP_003596142.1|  LOB domain-containing protein                    58.9    6e-09   
ref|XP_002310159.2|  hypothetical protein POPTR_0007s11460g           60.5    6e-09   
ref|XP_007131989.1|  hypothetical protein PHAVU_011G0575001g          57.4    6e-09   
ref|XP_010497950.1|  PREDICTED: LOB domain-containing protein 3-l...  58.9    6e-09   
ref|XP_008457883.1|  PREDICTED: LOB domain-containing protein 36-...  60.5    6e-09   
ref|XP_009402888.1|  PREDICTED: LOB domain-containing protein 36-...  60.5    6e-09   
gb|EYU46299.1|  hypothetical protein MIMGU_mgv1a020761mg              58.9    6e-09   
ref|XP_002466819.1|  hypothetical protein SORBIDRAFT_01g014650        60.5    7e-09   
ref|XP_009151937.1|  PREDICTED: LOB domain-containing protein 25      58.5    7e-09   
ref|XP_006583939.1|  PREDICTED: LOB domain-containing protein 4-like  58.9    7e-09   
ref|XP_010045372.1|  PREDICTED: LOB domain-containing protein 12-...  58.9    7e-09   
ref|XP_010499684.1|  PREDICTED: LOB domain-containing protein 4-like  58.9    7e-09   
ref|XP_002875394.1|  LOB domain-containing protein 25                 58.9    7e-09   
emb|CDY49845.1|  BnaC02g44040D                                        60.5    7e-09   
ref|XP_009757880.1|  PREDICTED: LOB domain-containing protein 25-...  58.9    7e-09   
ref|XP_009111580.1|  PREDICTED: LOB domain-containing protein 25      58.5    7e-09   
ref|XP_011080319.1|  PREDICTED: LOB domain-containing protein 4-like  58.9    7e-09   
ref|XP_002263845.2|  PREDICTED: LOB domain-containing protein 36-...  60.5    7e-09   
ref|XP_010528230.1|  PREDICTED: LOB domain-containing protein 25      58.5    7e-09   
ref|XP_009774046.1|  PREDICTED: LOB domain-containing protein 36-...  60.5    7e-09   
ref|XP_007024850.1|  LOB domain-containing protein 4 isoform 1        58.5    8e-09   
ref|XP_009102666.1|  PREDICTED: LOB domain-containing protein 4       58.5    8e-09   
ref|XP_008792769.1|  PREDICTED: LOB domain-containing protein 36-...  58.5    8e-09   
emb|CDY50718.1|  BnaCnng19520D                                        58.5    8e-09   
ref|XP_004505337.1|  PREDICTED: LOB domain-containing protein 4-like  58.5    8e-09   
ref|XP_006305715.1|  hypothetical protein CARUB_v10010462mg           58.5    8e-09   
ref|XP_009757882.1|  PREDICTED: LOB domain-containing protein 25-...  58.5    8e-09   
ref|XP_009371914.1|  PREDICTED: LOB domain-containing protein 4-like  58.5    8e-09   
ref|XP_008359794.1|  PREDICTED: LOW QUALITY PROTEIN: LOB domain-c...  58.5    8e-09   
ref|XP_010460960.1|  PREDICTED: LOB domain-containing protein 4-like  58.5    8e-09   
ref|XP_003531496.1|  PREDICTED: LOB domain-containing protein 4-like  58.5    8e-09   
ref|NP_566823.1|  LOB domain-containing protein 25                    58.5    8e-09   
gb|EMT24456.1|  hypothetical protein F775_33210                       57.4    8e-09   
ref|XP_010478882.1|  PREDICTED: LOB domain-containing protein 4       58.5    8e-09   
ref|XP_006415344.1|  hypothetical protein EUTSA_v10008917mg           58.5    8e-09   
ref|XP_002263109.2|  PREDICTED: LOB domain-containing protein 36-...  60.1    8e-09   
ref|XP_004161732.1|  PREDICTED: LOB domain-containing protein 11-...  57.4    8e-09   
ref|XP_004511963.1|  PREDICTED: LOB domain-containing protein 36-...  60.1    8e-09   
gb|EAZ27773.1|  hypothetical protein OsJ_11721                        60.5    8e-09   
ref|XP_003635533.2|  PREDICTED: LOB domain-containing protein 36-...  59.7    9e-09   
ref|XP_008794215.1|  PREDICTED: LOB domain-containing protein 12-...  58.2    9e-09   
ref|XP_007212152.1|  hypothetical protein PRUPE_ppa012322mg           58.5    9e-09   
ref|XP_007024851.1|  LOB domain-containing protein 4 isoform 2        58.2    9e-09   
gb|EYU20059.1|  hypothetical protein MIMGU_mgv1a020601mg              58.5    9e-09   
ref|XP_011011627.1|  PREDICTED: LOB domain-containing protein 4-like  58.5    9e-09   
ref|XP_011026753.1|  PREDICTED: LOB domain-containing protein 4-like  58.5    9e-09   
ref|XP_008383342.1|  PREDICTED: LOB domain-containing protein 4       58.5    9e-09   
ref|XP_004293726.1|  PREDICTED: LOB domain-containing protein 4-like  58.5    9e-09   
gb|AAM67184.1|  unknown                                               58.5    9e-09   
ref|XP_009354353.1|  PREDICTED: LOB domain-containing protein 15-...  59.3    9e-09   
ref|XP_007047171.1|  ASYMMETRIC LEAVES 2-like 1                       60.1    9e-09   
gb|EMS45175.1|  hypothetical protein TRIUR3_06488                     58.5    9e-09   
ref|XP_010658225.1|  PREDICTED: LOB domain-containing protein 12-...  58.5    9e-09   
ref|NP_174417.1|  LOB domain-containing protein 4                     58.5    9e-09   
ref|NP_001042133.1|  Os01g0169400                                     59.3    1e-08   
ref|XP_010056710.1|  PREDICTED: LOB domain-containing protein 4-like  58.5    1e-08   
ref|XP_010692935.1|  PREDICTED: LOB domain-containing protein 12-...  58.5    1e-08   
emb|CBI25425.3|  unnamed protein product                              58.2    1e-08   
ref|XP_007149195.1|  hypothetical protein PHAVU_005G049700g           58.5    1e-08   
ref|XP_010667079.1|  PREDICTED: LOB domain-containing protein 4       58.5    1e-08   
ref|XP_002893847.1|  LOB domain protein 4                             58.5    1e-08   
ref|XP_003535054.1|  PREDICTED: LOB domain-containing protein 4-like  58.5    1e-08   
emb|CBI29565.3|  unnamed protein product                              58.9    1e-08   
ref|XP_006364248.1|  PREDICTED: LOB domain-containing protein 4-like  58.5    1e-08   
ref|XP_009403403.1|  PREDICTED: LOB domain-containing protein 36-...  59.7    1e-08   
ref|XP_007206843.1|  hypothetical protein PRUPE_ppa027059mg           58.9    1e-08   
ref|XP_006643800.1|  PREDICTED: protein LATERAL ORGAN BOUNDARIES-...  59.3    1e-08   
ref|XP_004250781.1|  PREDICTED: LOB domain-containing protein 4-like  58.5    1e-08   
ref|XP_009353911.1|  PREDICTED: LOB domain-containing protein 4       58.2    1e-08   
gb|KDP36462.1|  hypothetical protein JCGZ_08592                       58.2    1e-08   
gb|KHN20496.1|  LOB domain-containing protein 4                       58.2    1e-08   
ref|NP_001236751.1|  uncharacterized protein LOC100306560             58.2    1e-08   
emb|CDP17397.1|  unnamed protein product                              58.2    1e-08   
ref|XP_006448764.1|  hypothetical protein CICLE_v10016993mg           58.2    1e-08   
ref|XP_011035872.1|  PREDICTED: LOB domain-containing protein 12-...  58.2    1e-08   
ref|XP_010067560.1|  PREDICTED: LOB domain-containing protein 12-...  58.2    1e-08   
ref|NP_001168375.1|  putative LOB domain-containing family protein    59.7    1e-08   
ref|XP_003618148.1|  Lateral organ boundaries-like protein            58.2    1e-08   
gb|AES74366.2|  lateral organ boundaries (LOB) domain protein         58.2    1e-08   
ref|XP_010518982.1|  PREDICTED: LOB domain-containing protein 4-like  58.2    1e-08   
ref|XP_007157815.1|  hypothetical protein PHAVU_002G100500g           57.8    1e-08   
gb|ABU44495.1|  LOB domain protein 1                                  58.9    1e-08   
ref|XP_003547318.1|  PREDICTED: LOB domain-containing protein 4-like  58.2    1e-08   
ref|XP_006573622.1|  PREDICTED: LOB domain-containing protein 36-...  59.7    1e-08   
ref|XP_003600972.1|  LOB domain-containing protein                    58.2    1e-08   
ref|NP_001151668.1|  LOB domain protein 25                            58.9    1e-08   
ref|XP_004968335.1|  PREDICTED: LOB domain-containing protein 6-like  58.9    1e-08   
emb|CDP02469.1|  unnamed protein product                              59.7    1e-08   
ref|XP_004962077.1|  PREDICTED: LOB domain-containing protein 6-l...  59.3    1e-08   
ref|XP_011099212.1|  PREDICTED: LOB domain-containing protein 36      60.1    1e-08   
ref|XP_009389756.1|  PREDICTED: protein LATERAL ORGAN BOUNDARIES-...  59.3    1e-08   
ref|XP_004252871.1|  PREDICTED: LOB domain-containing protein 4-like  58.2    1e-08   
ref|XP_011022387.1|  PREDICTED: LOB domain-containing protein 4-like  58.2    1e-08   
ref|XP_003519421.1|  PREDICTED: LOB domain-containing protein 12-...  57.8    1e-08   
gb|KHG01642.1|  LOB domain-containing 4 -like protein                 57.8    1e-08   
ref|XP_003616690.1|  LOB domain-containing protein                    57.8    1e-08   
ref|XP_009764881.1|  PREDICTED: LOB domain-containing protein 12-...  57.8    1e-08   
ref|XP_002304584.1|  LOB domain protein 3                             57.8    2e-08   
ref|XP_009766014.1|  PREDICTED: LOB domain-containing protein 4-l...  57.8    2e-08   
gb|ADJ67794.1|  LOB faimly transfactor Ramosa2.2                      58.9    2e-08   
ref|XP_002270650.1|  PREDICTED: LOB domain-containing protein 4       57.8    2e-08   
gb|KEH34867.1|  LOB domain protein                                    58.2    2e-08   
ref|NP_001055559.1|  Os05g0417000                                     59.3    2e-08   
ref|XP_003601210.1|  Lateral organ boundaries-like protein            59.7    2e-08   
ref|XP_011002671.1|  PREDICTED: LOB domain-containing protein 12-...  57.8    2e-08   
gb|EMT22297.1|  hypothetical protein F775_21760                       58.5    2e-08   
gb|EAY98062.1|  hypothetical protein OsI_19980                        58.9    2e-08   
ref|XP_007016975.1|  Lateral organ boundaries domain family protein   57.8    2e-08   
ref|XP_008665134.1|  PREDICTED: LOB domain-containing protein 36-...  58.9    2e-08   
ref|XP_002263136.3|  PREDICTED: LOB domain-containing protein 36      58.5    2e-08   
ref|XP_010906837.1|  PREDICTED: LOB domain-containing protein 12-...  57.8    2e-08   
ref|XP_002456560.1|  hypothetical protein SORBIDRAFT_03g038410        58.5    2e-08   
ref|XP_009361815.1|  PREDICTED: LOB domain-containing protein 4       57.8    2e-08   
ref|XP_002441102.1|  hypothetical protein SORBIDRAFT_09g020440        59.3    2e-08   



>gb|EYU39551.1| hypothetical protein MIMGU_mgv1a019423mg [Erythranthe guttata]
Length=212

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VILSPCAACKILRRRCVE+CVLAPYFPPTEPLKFTIAHR
Sbjct  48   VILSPCAACKILRRRCVEKCVLAPYFPPTEPLKFTIAHR  86



>ref|XP_009780362.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana sylvestris]
Length=189

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VIL+PCAACKILRRRCV++CVLAPYFPPTEPLKFTIAHR
Sbjct  29   VILTPCAACKILRRRCVDKCVLAPYFPPTEPLKFTIAHR  67



>ref|XP_004240278.1| PREDICTED: LOB domain-containing protein 1-like [Solanum lycopersicum]
Length=215

 Score = 82.4 bits (202),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             V+LSPCAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  49   NVVLSPCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  88



>ref|XP_009588230.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=189

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VIL+PCAACKILRRRCV++CVLAPYFPPTEPLKFTIAHR
Sbjct  29   VILTPCAACKILRRRCVDKCVLAPYFPPTEPLKFTIAHR  67



>gb|KGN50464.1| hypothetical protein Csa_5G175870 [Cucumis sativus]
Length=173

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             V+LSPCAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  17   AVVLSPCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  56



>ref|XP_006360671.1| PREDICTED: LOB domain-containing protein 11-like [Solanum tuberosum]
Length=214

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             ++LSPCAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  48   NIVLSPCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  87



>ref|XP_004143693.1| PREDICTED: LOB domain-containing protein 1-like [Cucumis sativus]
 ref|XP_004172387.1| PREDICTED: LOB domain-containing protein 1-like [Cucumis sativus]
Length=203

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/40 (90%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             V+LSPCAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  47   AVVLSPCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  86



>ref|XP_009611728.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=206

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VIL+PCAACKILRRRCV++CVLAPYFPPT+PLKFTIAHR
Sbjct  52   VILTPCAACKILRRRCVDKCVLAPYFPPTDPLKFTIAHR  90



>ref|XP_009378148.1| PREDICTED: LOB domain-containing protein 1-like [Pyrus x bretschneideri]
Length=232

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VILSPCAACKILRRRC E+CVLAPYFPPTEPLKFTIAH+
Sbjct  73   VILSPCAACKILRRRCAEKCVLAPYFPPTEPLKFTIAHK  111



>emb|CDP04291.1| unnamed protein product [Coffea canephora]
Length=206

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VILSPCAACKILRRRC E+CVLAPYFPPTEPLKFTIAH+
Sbjct  47   VILSPCAACKILRRRCAEKCVLAPYFPPTEPLKFTIAHK  85



>ref|XP_008369398.1| PREDICTED: LOB domain-containing protein 1-like [Malus domestica]
Length=232

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VILSPCAACKILRR+C E+CVLAPYFPPTEPLKFTIAHR
Sbjct  73   VILSPCAACKILRRKCAEKCVLAPYFPPTEPLKFTIAHR  111



>ref|XP_007219697.1| hypothetical protein PRUPE_ppa023989mg [Prunus persica]
 gb|EMJ20896.1| hypothetical protein PRUPE_ppa023989mg [Prunus persica]
Length=231

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPTEPLKFTIAHR
Sbjct  72   VVLSPCAACKILRRRCAEKCVLAPYFPPTEPLKFTIAHR  110



>ref|XP_007009738.1| LOB domain-containing protein 1 [Theobroma cacao]
 gb|EOY18548.1| LOB domain-containing protein 1 [Theobroma cacao]
Length=220

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCVE+CVLAPYFPPTEP KFTIAHR
Sbjct  63   VVLSPCAACKILRRRCVEKCVLAPYFPPTEPYKFTIAHR  101



>ref|NP_172268.1| LOB domain-containing protein 1 [Arabidopsis thaliana]
 sp|Q9LQR0.1|LBD1_ARATH RecName: Full=LOB domain-containing protein 1; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 8; Short=AS2-like protein 8 
[Arabidopsis thaliana]
 gb|AAF75065.1|AC007583_1 F24B9.1 [Arabidopsis thaliana]
 dbj|BAH10552.1| ASYMMETRIC LEAVES2-like 8 protein [Arabidopsis thaliana]
 gb|AEE28208.1| LOB domain-containing protein 1 [Arabidopsis thaliana]
Length=190

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC ERCVLAPYFPPT+P KFTIAHR
Sbjct  29   VVLSPCAACKILRRRCAERCVLAPYFPPTDPAKFTIAHR  67



>ref|XP_008795252.1| PREDICTED: LOB domain-containing protein 1 [Phoenix dactylifera]
Length=194

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV++CVLAPYFPPTEPLKFT AHR
Sbjct  31   VVLSPCAACKILRRRCVDKCVLAPYFPPTEPLKFTTAHR  69



>ref|XP_002889671.1| LOB domain protein 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65930.1| LOB domain protein 1 [Arabidopsis lyrata subsp. lyrata]
Length=190

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC ERCVLAPYFPPT+P KFTIAHR
Sbjct  29   VVLSPCAACKILRRRCAERCVLAPYFPPTDPAKFTIAHR  67



>gb|KHG16785.1| LOB domain-containing 1 -like protein [Gossypium arboreum]
Length=204

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCVE+CVLAPYFPPTEP KFTIAHR
Sbjct  47   VVLSPCAACKILRRRCVEKCVLAPYFPPTEPYKFTIAHR  85



>ref|XP_010458003.1| PREDICTED: LOB domain-containing protein 1 [Camelina sativa]
Length=190

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  29   VVLSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  67



>ref|XP_010475566.1| PREDICTED: LOB domain-containing protein 1-like [Camelina sativa]
 ref|XP_010475567.1| PREDICTED: LOB domain-containing protein 1-like [Camelina sativa]
 ref|XP_010475568.1| PREDICTED: LOB domain-containing protein 1-like [Camelina sativa]
 ref|XP_010475569.1| PREDICTED: LOB domain-containing protein 1-like [Camelina sativa]
Length=193

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  30   VVLSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  68



>ref|XP_010488117.1| PREDICTED: LOB domain-containing protein 1-like [Camelina sativa]
Length=190

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  29   VVLSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  67



>emb|CAN78080.1| hypothetical protein VITISV_021299 [Vitis vinifera]
Length=197

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC ++CVLAPYFPPTEPLKFTIAHR
Sbjct  38   VVLSPCAACKILRRRCADKCVLAPYFPPTEPLKFTIAHR  76



>ref|XP_010557308.1| PREDICTED: LOB domain-containing protein 11-like [Tarenaya hassleriana]
Length=212

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC E+CVLAPYFPPTEP KFTIAHR
Sbjct  36   VVMSPCAACKILRRRCAEKCVLAPYFPPTEPTKFTIAHR  74



>ref|XP_010910576.1| PREDICTED: LOB domain-containing protein 1-like [Elaeis guineensis]
Length=206

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             +LSPCAACKILRRRCVE+CVLAPYFPPTEPLKFT AHR
Sbjct  39   AVLSPCAACKILRRRCVEKCVLAPYFPPTEPLKFTTAHR  77



>ref|XP_010658441.1| PREDICTED: LOB domain-containing protein 1-like [Vitis vinifera]
 emb|CBI31512.3| unnamed protein product [Vitis vinifera]
Length=197

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC ++CVLAPYFPPTEPLKFTIAHR
Sbjct  38   VVLSPCAACKILRRRCADKCVLAPYFPPTEPLKFTIAHR  76



>ref|XP_010244970.1| PREDICTED: LOB domain-containing protein 1-like [Nelumbo nucifera]
Length=206

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRCVE+CVLAPYFPPTEPLKFT AHR
Sbjct  37   VVISPCAACKILRRRCVEKCVLAPYFPPTEPLKFTTAHR  75



>ref|XP_008789049.1| PREDICTED: LOB domain-containing protein 1-like [Phoenix dactylifera]
Length=202

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV++CVLAPYFPPTEPLKFT AHR
Sbjct  37   VVLSPCAACKILRRRCVDKCVLAPYFPPTEPLKFTTAHR  75



>ref|XP_010521775.1| PREDICTED: LOB domain-containing protein 1 [Tarenaya hassleriana]
Length=225

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VI+SPCAACKILRRRC E+CVLAPYFPPTEP KFTIAHR
Sbjct  53   VIMSPCAACKILRRRCAEKCVLAPYFPPTEPTKFTIAHR  91



>ref|XP_006436214.1| hypothetical protein CICLE_v10033956mg, partial [Citrus clementina]
 gb|ESR49454.1| hypothetical protein CICLE_v10033956mg, partial [Citrus clementina]
Length=186

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++LSPCAACKILRRRCVE+CVLAPYFPPTEP KFTIAHR
Sbjct  25   IVLSPCAACKILRRRCVEKCVLAPYFPPTEPYKFTIAHR  63



>gb|EEE62158.1| hypothetical protein OsJ_16945 [Oryza sativa Japonica Group]
Length=89

 Score = 77.0 bits (188),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV+RCVLAPYFPPTEP KFT AHR
Sbjct  34   VVLSPCAACKILRRRCVDRCVLAPYFPPTEPHKFTTAHR  72



>ref|XP_009140905.1| PREDICTED: LOB domain-containing protein 11 [Brassica rapa]
Length=232

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  52   VVLSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  90



>emb|CDY62454.1| BnaA04g28360D [Brassica napus]
Length=217

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  52   VVLSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  90



>emb|CDX77182.1| BnaC04g39770D [Brassica napus]
Length=217

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  52   VVLSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  90



>ref|XP_008463908.1| PREDICTED: LOB domain-containing protein 1-like [Cucumis melo]
Length=198

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/39 (92%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VILSPCAACKILRRRC ERCVLAPYFPPTEP KF IAHR
Sbjct  33   VILSPCAACKILRRRCAERCVLAPYFPPTEPAKFAIAHR  71



>ref|XP_006485928.1| PREDICTED: LOB domain-containing protein 1-like [Citrus sinensis]
 gb|KDO44596.1| hypothetical protein CISIN_1g026556mg [Citrus sinensis]
Length=237

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++LSPCAACKILRRRCVE+CVLAPYFPPTEP KFTIAHR
Sbjct  76   IVLSPCAACKILRRRCVEKCVLAPYFPPTEPYKFTIAHR  114



>gb|KHN05716.1| LOB domain-containing protein 1 [Glycine soja]
Length=202

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC E+CVLAPYFPPTEP KFTIAHR
Sbjct  31   VVMSPCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHR  69



>gb|ACU21351.1| unknown [Glycine max]
Length=202

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC E+CVLAPYFPPTEP KFTIAHR
Sbjct  31   VVMSPCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHR  69



>ref|XP_010669677.1| PREDICTED: LOB domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=237

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VI+SPCAACKILRRRC ++CVLAPYFPPT+PLKFTIAH+
Sbjct  55   VIMSPCAACKILRRRCADKCVLAPYFPPTDPLKFTIAHK  93



>ref|XP_003539733.1| PREDICTED: LOB domain-containing protein 1-like [Glycine max]
Length=202

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC E+CVLAPYFPPTEP KFTIAHR
Sbjct  31   VVMSPCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHR  69



>ref|XP_008805041.1| PREDICTED: LOB domain-containing protein 11-like [Phoenix dactylifera]
Length=203

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACK+LRRRCV++CVLAPYFPP EPLKFT AHR
Sbjct  37   VVLSPCAACKVLRRRCVDKCVLAPYFPPNEPLKFTTAHR  75



>gb|AFK47293.1| unknown [Lotus japonicus]
Length=223

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACK+LRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  62   VVVSPCAACKVLRRRCVEKCVLAPYFPPTDPLKFTIAHR  100



>ref|XP_006305673.1| hypothetical protein CARUB_v10010390mg [Capsella rubella]
 gb|EOA38571.1| hypothetical protein CARUB_v10010390mg [Capsella rubella]
Length=186

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC ++CVLAPYFPPT+P KFTIAHR
Sbjct  26   VVLSPCAACKILRRRCADKCVLAPYFPPTDPAKFTIAHR  64



>gb|EYU39788.1| hypothetical protein MIMGU_mgv1a019167mg [Erythranthe guttata]
Length=187

 Score = 78.2 bits (191),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             VILSPCAACKILRRRC E+CVLAPYFPPT+PLKF IAHR
Sbjct  23   AVILSPCAACKILRRRCGEKCVLAPYFPPTDPLKFAIAHR  62



>ref|XP_007205910.1| hypothetical protein PRUPE_ppa011528mg [Prunus persica]
 gb|EMJ07109.1| hypothetical protein PRUPE_ppa011528mg [Prunus persica]
Length=207

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC E+CVLAPYFPPTEP KFTIAHR
Sbjct  38   VVISPCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHR  76



>ref|XP_002526340.1| LOB domain-containing protein, putative [Ricinus communis]
 gb|EEF36011.1| LOB domain-containing protein, putative [Ricinus communis]
Length=201

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VILSPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  36   VILSPCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHR  74



>ref|XP_003538040.1| PREDICTED: LOB domain-containing protein 1-like [Glycine max]
 gb|KHN22041.1| LOB domain-containing protein 1 [Glycine soja]
Length=204

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRR+C E+CVLAPYFPPTEP KFTIAHR
Sbjct  33   VVMSPCAACKILRRKCAEKCVLAPYFPPTEPAKFTIAHR  71



>ref|NP_180417.2| LOB domain-containing protein 11 [Arabidopsis thaliana]
 sp|Q9SK08.2|LBD11_ARATH RecName: Full=LOB domain-containing protein 11; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 7; Short=AS2-like protein 
7 [Arabidopsis thaliana]
 gb|AEC08131.1| LOB domain-containing protein 11 [Arabidopsis thaliana]
Length=232

 Score = 78.6 bits (192),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC ++CVLAPYFPPT+P KFTIAHR
Sbjct  51   VVLSPCAACKILRRRCADKCVLAPYFPPTDPAKFTIAHR  89



>gb|AAD21485.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH10551.1| ASYMMETRIC LEAVES2-like 7 protein [Arabidopsis thaliana]
Length=229

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC ++CVLAPYFPPT+P KFTIAHR
Sbjct  48   VVLSPCAACKILRRRCADKCVLAPYFPPTDPAKFTIAHR  86



>gb|KFK32292.1| hypothetical protein AALP_AA6G223700 [Arabis alpina]
Length=229

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  47   VVLSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  85



>ref|XP_006417754.1| hypothetical protein EUTSA_v10008781mg [Eutrema salsugineum]
 gb|ESQ36107.1| hypothetical protein EUTSA_v10008781mg [Eutrema salsugineum]
Length=207

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPTEP KFTIAHR
Sbjct  31   VVLSPCAACKILRRRCGEKCVLAPYFPPTEPAKFTIAHR  69



>gb|KDO73135.1| hypothetical protein CISIN_1g047491mg [Citrus sinensis]
Length=206

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VI+SPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  38   VIMSPCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHR  76



>ref|XP_006488170.1| PREDICTED: LOB domain-containing protein 11-like [Citrus sinensis]
Length=209

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VI+SPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  41   VIMSPCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHR  79



>ref|XP_006424648.1| hypothetical protein CICLE_v10029283mg [Citrus clementina]
 gb|ESR37888.1| hypothetical protein CICLE_v10029283mg [Citrus clementina]
Length=209

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VI+SPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  41   VIMSPCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHR  79



>ref|XP_009784336.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana sylvestris]
Length=202

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            L+PCAACKILRRRCV++CVLAPYFPPT+PLKFTIAHR
Sbjct  47   LTPCAACKILRRRCVDKCVLAPYFPPTDPLKFTIAHR  83



>ref|XP_004149555.1| PREDICTED: LOB domain-containing protein 1-like [Cucumis sativus]
 ref|XP_004167808.1| PREDICTED: LOB domain-containing protein 1-like [Cucumis sativus]
 gb|KGN47298.1| hypothetical protein Csa_6G290790 [Cucumis sativus]
Length=200

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VILSPCAACKILRRRC ERCVLAPYFPP+EP KF IAHR
Sbjct  33   VILSPCAACKILRRRCAERCVLAPYFPPSEPAKFAIAHR  71



>ref|XP_006294934.1| hypothetical protein CARUB_v10023989mg [Capsella rubella]
 gb|EOA27832.1| hypothetical protein CARUB_v10023989mg [Capsella rubella]
Length=231

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            LSPCAACKILRRRC E+CVLAPYFPPT+P+KFTIAHR
Sbjct  52   LSPCAACKILRRRCAEKCVLAPYFPPTDPMKFTIAHR  88



>ref|XP_011090094.1| PREDICTED: LOB domain-containing protein 1 [Sesamum indicum]
Length=190

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRCVE+CVLAPYFPP +PLKFT AHR
Sbjct  26   VVISPCAACKILRRRCVEKCVLAPYFPPNDPLKFTTAHR  64



>emb|CDY22713.1| BnaC08g43470D [Brassica napus]
Length=191

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPTEP KF+IAHR
Sbjct  28   VVLSPCAACKILRRRCGEKCVLAPYFPPTEPAKFSIAHR  66



>ref|XP_010470075.1| PREDICTED: LOB domain-containing protein 11-like [Camelina sativa]
Length=238

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ILSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  54   ILSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  91



>ref|XP_009118406.1| PREDICTED: LOB domain-containing protein 1-like [Brassica rapa]
Length=207

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPTEP KF+IAHR
Sbjct  28   VVLSPCAACKILRRRCGEKCVLAPYFPPTEPAKFSIAHR  66



>ref|XP_006654943.1| PREDICTED: LOB domain-containing protein 11-like [Oryza brachyantha]
Length=153

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV+RCVLAPYFPPTEP KFT AHR
Sbjct  30   VVLSPCAACKILRRRCVDRCVLAPYFPPTEPHKFTTAHR  68



>ref|XP_008224697.1| PREDICTED: LOB domain-containing protein 1-like [Prunus mume]
Length=214

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  45   VVISPCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHR  83



>emb|CDY06285.1| BnaA09g49180D [Brassica napus]
Length=190

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPTEP KF+IAHR
Sbjct  28   VVLSPCAACKILRRRCGEKCVLAPYFPPTEPAKFSIAHR  66



>ref|XP_006485927.1| PREDICTED: LOB domain-containing protein 1-like [Citrus sinensis]
Length=201

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             ++LSPCAACKILRRRCVE+CVLAPYFPPTEP KF IAHR
Sbjct  37   SIVLSPCAACKILRRRCVEKCVLAPYFPPTEPQKFVIAHR  76



>ref|XP_006436215.1| hypothetical protein CICLE_v10032782mg [Citrus clementina]
 gb|ESR49455.1| hypothetical protein CICLE_v10032782mg [Citrus clementina]
Length=201

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             ++LSPCAACKILRRRCVE+CVLAPYFPPTEP KF IAHR
Sbjct  37   SIVLSPCAACKILRRRCVEKCVLAPYFPPTEPQKFVIAHR  76



>ref|XP_003597159.1| LOB domain protein [Medicago truncatula]
 gb|AES67410.1| lateral organ boundaries (LOB) domain protein [Medicago truncatula]
Length=198

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC E+CVLAPYFPPTEP KFT AHR
Sbjct  29   VVMSPCAACKILRRRCAEKCVLAPYFPPTEPSKFTTAHR  67



>ref|XP_010104136.1| hypothetical protein L484_014422 [Morus notabilis]
 gb|EXB98577.1| hypothetical protein L484_014422 [Morus notabilis]
Length=224

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  42   VVISPCAACKILRRRCADKCVLAPYFPPTEPSKFTIAHR  80



>ref|XP_007015486.1| LOB domain-containing protein 1 [Theobroma cacao]
 gb|EOY33105.1| LOB domain-containing protein 1 [Theobroma cacao]
Length=217

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  51   VVISPCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHR  89



>gb|AAV33307.1| putatvie LOB domain protein [Oryza sativa Japonica Group]
Length=234

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV+RCVLAPYFPPTEP KFT AHR
Sbjct  64   VVLSPCAACKILRRRCVDRCVLAPYFPPTEPHKFTTAHR  102



>ref|XP_008463550.1| PREDICTED: LOB domain-containing protein 1-like [Cucumis melo]
Length=204

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC E+CVLAPYFPP++PLKFTIAHR
Sbjct  33   VVVSPCAACKILRRRCAEKCVLAPYFPPSDPLKFTIAHR  71



>ref|XP_004505954.1| PREDICTED: LOB domain-containing protein 11-like [Cicer arietinum]
Length=202

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  29   VVMSPCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHR  67



>ref|XP_008370637.1| PREDICTED: LOB domain-containing protein 1-like [Malus domestica]
Length=212

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC ++CVLAPYFPP+EP+KFTIAHR
Sbjct  42   VVISPCAACKILRRRCADKCVLAPYFPPSEPVKFTIAHR  80



>ref|XP_010666030.1| PREDICTED: LOB domain-containing protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=199

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             V++SPCAACKILRRRC ++CVLAPYFPPT+PLKF+IAHR
Sbjct  27   AVVVSPCAACKILRRRCADKCVLAPYFPPTDPLKFSIAHR  66



>ref|XP_010108453.1| hypothetical protein L484_014124 [Morus notabilis]
 gb|EXC19494.1| hypothetical protein L484_014124 [Morus notabilis]
Length=230

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACKILRRRCV++CVLAPYFPPTEPLKFTIAHR
Sbjct  77   SPCAACKILRRRCVDKCVLAPYFPPTEPLKFTIAHR  112



>ref|XP_006409877.1| hypothetical protein EUTSA_v10017165mg [Eutrema salsugineum]
 gb|ESQ51330.1| hypothetical protein EUTSA_v10017165mg [Eutrema salsugineum]
Length=244

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACKILRRRC ++CVLAPYFPPT+P KFTIAHR
Sbjct  60   SPCAACKILRRRCADKCVLAPYFPPTDPAKFTIAHR  95



>ref|XP_004307415.1| PREDICTED: LOB domain-containing protein 1-like [Fragaria vesca 
subsp. vesca]
Length=224

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             V++SPCAACKILRRRCVERCVLAPYFPP++P+KF IAHR
Sbjct  49   AVVVSPCAACKILRRRCVERCVLAPYFPPSDPIKFIIAHR  88



>gb|KFK43106.1| hypothetical protein AALP_AA1G080800 [Arabis alpina]
Length=134

 Score = 75.5 bits (184),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++LSPCAACKILRRRC E CVLAPYFPPTEP KFTIAHR
Sbjct  28   MVLSPCAACKILRRRCGENCVLAPYFPPTEPAKFTIAHR  66



>ref|XP_002282070.1| PREDICTED: LOB domain-containing protein 1 [Vitis vinifera]
 emb|CBI16264.3| unnamed protein product [Vitis vinifera]
Length=202

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             V+LSPCAACKILRRRC ++CVLAPYFPPT+P KFT AHR
Sbjct  35   NVVLSPCAACKILRRRCADKCVLAPYFPPTDPAKFTTAHR  74



>ref|XP_010510616.1| PREDICTED: LOB domain-containing protein 11-like [Camelina sativa]
Length=238

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            LSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  55   LSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  91



>emb|CDY31207.1| BnaC03g46840D [Brassica napus]
Length=216

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPT+P KF IAHR
Sbjct  50   VVLSPCAACKILRRRCAEKCVLAPYFPPTDPAKFIIAHR  88



>ref|XP_004294671.1| PREDICTED: LOB domain-containing protein 1-like [Fragaria vesca 
subsp. vesca]
Length=236

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             V++SPCAACKILRRRC E+CVLAPYFPP+EP KFTIAHR
Sbjct  56   NVVVSPCAACKILRRRCAEKCVLAPYFPPSEPAKFTIAHR  95



>ref|XP_004240601.1| PREDICTED: LOB domain-containing protein 1-like [Solanum lycopersicum]
Length=198

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             V++SPCAACKILRRRC E+CVLAPYFPP +P+KFT AHR
Sbjct  40   AVVISPCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHR  79



>ref|XP_008783779.1| PREDICTED: LOB domain-containing protein 1-like [Phoenix dactylifera]
Length=204

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPP EPLKF  AHR
Sbjct  37   VVLSPCAACKILRRRCTEKCVLAPYFPPNEPLKFATAHR  75



>ref|XP_002440509.1| hypothetical protein SORBIDRAFT_09g002190 [Sorghum bicolor]
 gb|EES18939.1| hypothetical protein SORBIDRAFT_09g002190 [Sorghum bicolor]
Length=219

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV+RCVLAPYFPPTEP KF  AHR
Sbjct  34   VVLSPCAACKILRRRCVDRCVLAPYFPPTEPHKFATAHR  72



>ref|XP_004960340.1| PREDICTED: LOB domain-containing protein 11-like [Setaria italica]
Length=210

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV+RCVLAPYFPPTEP KF  AHR
Sbjct  32   VVLSPCAACKILRRRCVDRCVLAPYFPPTEPHKFATAHR  70



>ref|XP_002880987.1| hypothetical protein ARALYDRAFT_481760 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57246.1| hypothetical protein ARALYDRAFT_481760 [Arabidopsis lyrata subsp. 
lyrata]
Length=230

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            LSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  52   LSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  88



>ref|XP_009148039.1| PREDICTED: LOB domain-containing protein 1-like [Brassica rapa]
Length=240

 Score = 76.6 bits (187),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++LSPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  63   LVLSPCAACKILRRRCGDKCVLAPYFPPTEPAKFTIAHR  101



>emb|CDX93609.1| BnaA06g04390D [Brassica napus]
Length=225

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++LSPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  63   LVLSPCAACKILRRRCGDKCVLAPYFPPTEPAKFTIAHR  101



>ref|XP_010414515.1| PREDICTED: LOB domain-containing protein 11 isoform X1 [Camelina 
sativa]
Length=238

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            LSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  55   LSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  91



>ref|XP_010414516.1| PREDICTED: LOB domain-containing protein 11 isoform X2 [Camelina 
sativa]
Length=238

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            LSPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  55   LSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  91



>ref|XP_009776231.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana sylvestris]
Length=189

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++PCAACKILRRRC+++CVLAPYFPPTEPLKFT AHR
Sbjct  39   ITPCAACKILRRRCIDKCVLAPYFPPTEPLKFTNAHR  75



>emb|CDX95115.1| BnaC05g05560D [Brassica napus]
Length=228

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++LSPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  66   LVLSPCAACKILRRRCGDKCVLAPYFPPTEPAKFTIAHR  104



>ref|XP_010068859.1| PREDICTED: LOB domain-containing protein 1-like [Eucalyptus grandis]
Length=225

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             V++SPCAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  66   AVVMSPCAACKILRRRCADKCVLAPYFPPTEPYKFTIAHR  105



>ref|XP_010651120.1| PREDICTED: LOB domain-containing protein 1-like [Vitis vinifera]
 emb|CBI16262.3| unnamed protein product [Vitis vinifera]
Length=204

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+CVLAPYFPPT+P KFT AHR
Sbjct  36   VVLSPCAACKILRRRCAEKCVLAPYFPPTDPAKFTTAHR  74



>ref|XP_009133875.1| PREDICTED: LOB domain-containing protein 11-like [Brassica rapa]
 emb|CDX83290.1| BnaA03g22160D [Brassica napus]
Length=231

 Score = 76.3 bits (186),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC ++CVLAPYFPPT+P KF IAHR
Sbjct  50   VVLSPCAACKILRRRCADKCVLAPYFPPTDPAKFIIAHR  88



>ref|XP_002312035.2| hypothetical protein POPTR_0008s04350g [Populus trichocarpa]
 gb|EEE89402.2| hypothetical protein POPTR_0008s04350g [Populus trichocarpa]
Length=221

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+++PCAACKILRRRCV++CVLAPYFPP+EP KFTIAHR
Sbjct  64   VVITPCAACKILRRRCVDKCVLAPYFPPSEPYKFTIAHR  102



>ref|XP_009358251.1| PREDICTED: LOB domain-containing protein 1-like [Pyrus x bretschneideri]
 ref|XP_009338292.1| PREDICTED: LOB domain-containing protein 1-like [Pyrus x bretschneideri]
Length=213

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC ++CVLAPYFPP+EP KFTIAHR
Sbjct  42   VVVSPCAACKILRRRCADKCVLAPYFPPSEPAKFTIAHR  80



>ref|XP_009411741.1| PREDICTED: LOB domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=204

 Score = 75.5 bits (184),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VI SPCAACKILRRRC + CVLAPYFPPTEPLKFT AHR
Sbjct  37   VIHSPCAACKILRRRCADNCVLAPYFPPTEPLKFTTAHR  75



>ref|XP_009409552.1| PREDICTED: LOB domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=196

 Score = 75.5 bits (184),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
              I SPCAACKILRRRC ++CVLAPYFPPTEPLKFT AHR
Sbjct  27   AAIHSPCAACKILRRRCADKCVLAPYFPPTEPLKFTTAHR  66



>ref|XP_008650200.1| PREDICTED: LOB domain-containing protein 1-like [Zea mays]
 gb|AFW74764.1| putative LOB domain-containing family protein [Zea mays]
Length=221

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV+RCVLAPYFPPTEP KF  AHR
Sbjct  37   VVLSPCAACKILRRRCVDRCVLAPYFPPTEPHKFATAHR  75



>ref|XP_009380677.1| PREDICTED: LOB domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=250

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VI SPCAACKILRRRC  +CVLAPYFPPTEPLKFT AHR
Sbjct  83   VIHSPCAACKILRRRCAGKCVLAPYFPPTEPLKFTTAHR  121



>ref|XP_006365742.1| PREDICTED: LOB domain-containing protein 11-like [Solanum tuberosum]
Length=198

 Score = 75.5 bits (184),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+ +PCAACKILRRRC E+CVLAPYFPP+EP+KFTIAHR
Sbjct  31   VVATPCAACKILRRRCAEKCVLAPYFPPSEPIKFTIAHR  69



>ref|XP_011020741.1| PREDICTED: LOB domain-containing protein 1-like [Populus euphratica]
Length=248

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +SPCAACKILRRRCVE+CVLAPYFPP+EP KFTIAHR
Sbjct  93   ISPCAACKILRRRCVEKCVLAPYFPPSEPYKFTIAHR  129



>ref|XP_006340510.1| PREDICTED: LOB domain-containing protein 1-like [Solanum tuberosum]
Length=173

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  141  PCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            PCAACKILRRRCVE+CVLAPYFPPT PLKFTIAHR
Sbjct  13   PCAACKILRRRCVEKCVLAPYFPPTHPLKFTIAHR  47



>ref|XP_009794709.1| PREDICTED: LOB domain-containing protein 1-like isoform X2 [Nicotiana 
sylvestris]
Length=219

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VI+SPCAACKILRRRC E+CVLAPYFPP +P+KFT AHR
Sbjct  37   VIVSPCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHR  75



>ref|XP_004147299.1| PREDICTED: LOB domain-containing protein 11-like [Cucumis sativus]
 ref|XP_004161319.1| PREDICTED: LOB domain-containing protein 11-like [Cucumis sativus]
Length=208

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 38/39 (97%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+++PCAACKILRRRC ++CVLAPYFPP++PLKFTIAHR
Sbjct  36   VVVTPCAACKILRRRCTQKCVLAPYFPPSDPLKFTIAHR  74



>emb|CAN70036.1| hypothetical protein VITISV_019695 [Vitis vinifera]
Length=577

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +  PCAACKILRRRC ERCVLAPYFPPTEPLKF IAH+
Sbjct  441  VQGPCAACKILRRRCTERCVLAPYFPPTEPLKFVIAHK  478



>ref|XP_006649894.1| PREDICTED: LOB domain-containing protein 1-like [Oryza brachyantha]
Length=231

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACK+LRRRC + CVLAPYFPPTEP KFT AHR
Sbjct  53   VVLSPCAACKVLRRRCADGCVLAPYFPPTEPAKFTTAHR  91



>gb|EYU36210.1| hypothetical protein MIMGU_mgv1a013837mg [Erythranthe guttata]
Length=209

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++ SPCAACKILRRRCV++CVLAPYFPP +PLKFT AHR
Sbjct  33   LVASPCAACKILRRRCVDKCVLAPYFPPNDPLKFTTAHR  71



>ref|XP_011027000.1| PREDICTED: LOB domain-containing protein 1-like [Populus euphratica]
Length=216

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++SPCAACKILRRRCV++CVLAPYFPP+EP KFTIAHR
Sbjct  60   VVSPCAACKILRRRCVDKCVLAPYFPPSEPYKFTIAHR  97



>ref|XP_002465424.1| hypothetical protein SORBIDRAFT_01g038650 [Sorghum bicolor]
 gb|EER92422.1| hypothetical protein SORBIDRAFT_01g038650 [Sorghum bicolor]
Length=235

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC + CVLAPYFPPTEP KFT AHR
Sbjct  56   VVLSPCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHR  94



>ref|XP_006843281.1| hypothetical protein AMTR_s00080p00153120 [Amborella trichopoda]
 gb|ERN04956.1| hypothetical protein AMTR_s00080p00153120 [Amborella trichopoda]
Length=194

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            + +PCAACKILRRRC ERC+LAPYFPPT+PLKFT AHR
Sbjct  33   VATPCAACKILRRRCAERCILAPYFPPTQPLKFTTAHR  70



>ref|XP_009406941.1| PREDICTED: LOB domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=196

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +LSPCAACK+LRRRCV++CVLAPYFPPT+P KFT AHR
Sbjct  29   VLSPCAACKVLRRRCVDKCVLAPYFPPTDPQKFTNAHR  66



>ref|XP_009103694.1| PREDICTED: LOB domain-containing protein 11-like [Brassica rapa]
Length=233

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  58   SPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  93



>ref|NP_001147202.1| LOB domain protein 11 [Zea mays]
 gb|ACG26055.1| LOB domain protein 11 [Zea mays]
Length=239

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC + CVLAPYFPPTEP KFT AHR
Sbjct  57   VVLSPCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHR  95



>ref|XP_008358286.1| PREDICTED: LOB domain-containing protein 1-like [Malus domestica]
 ref|XP_008363479.1| PREDICTED: LOB domain-containing protein 1-like [Malus domestica]
Length=213

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC ++C+LAPYFPP+EP KFTIAHR
Sbjct  42   VVVSPCAACKILRRRCADKCILAPYFPPSEPAKFTIAHR  80



>ref|XP_004237662.1| PREDICTED: LOB domain-containing protein 1-like [Solanum lycopersicum]
Length=165

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  141  PCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            PCAACKILRRRCVE+CVLAPYFPPT PLKFTIAHR
Sbjct  13   PCAACKILRRRCVEKCVLAPYFPPTHPLKFTIAHR  47



>emb|CDY04570.1| BnaA07g13960D [Brassica napus]
Length=218

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  58   SPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  93



>gb|KHN33447.1| LOB domain-containing protein 11 [Glycine soja]
Length=172

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +SPCAACKILRRRC E+CVLAPYFPPTEP KFT AHR
Sbjct  1    MSPCAACKILRRRCAEKCVLAPYFPPTEPAKFTTAHR  37



>gb|AAT40528.1| LOB domain protein 1, putative [Solanum demissum]
Length=189

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC E+CVLAPYFPP +P+KFT AHR
Sbjct  32   VVVSPCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHR  70



>ref|XP_010043701.1| PREDICTED: LOB domain-containing protein 1 [Eucalyptus grandis]
 gb|KCW85687.1| hypothetical protein EUGRSUZ_B02465 [Eucalyptus grandis]
Length=223

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 37/39 (95%), Gaps = 1/39 (3%)
 Frame = +3

Query  132  ILSPCAACKILRRRC-VERCVLAPYFPPTEPLKFTIAHR  245
            I+SPCAACKILRRRC VE+CVLAPYFPPTEP KFTIAHR
Sbjct  50   IISPCAACKILRRRCAVEKCVLAPYFPPTEPAKFTIAHR  88



>gb|EAY89550.1| hypothetical protein OsI_11084 [Oryza sativa Indica Group]
Length=236

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACK+LRRRC + CVLAPYFPPTEP KFT AHR
Sbjct  56   VVLSPCAACKVLRRRCADGCVLAPYFPPTEPTKFTTAHR  94



>emb|CDY15755.1| BnaC04g15690D [Brassica napus]
Length=217

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACKILRRRC E+CVLAPYFPPT+P KFTIAHR
Sbjct  58   SPCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHR  93



>ref|XP_008660255.1| PREDICTED: LOB domain-containing protein 1 [Zea mays]
 ref|XP_008660256.1| PREDICTED: LOB domain-containing protein 1 [Zea mays]
 ref|XP_008660257.1| PREDICTED: LOB domain-containing protein 1 [Zea mays]
 gb|AFW88724.1| putative LOB domain-containing family protein [Zea mays]
Length=239

 Score = 75.1 bits (183),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC + CVLAPYFPPTEP KFT AHR
Sbjct  60   VVLSPCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHR  98



>ref|XP_009794710.1| PREDICTED: LOB domain-containing protein 1-like isoform X3 [Nicotiana 
sylvestris]
Length=207

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VI+SPCAACKILRRRC E+CVLAPYFPP +P+KFT AHR
Sbjct  37   VIVSPCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHR  75



>ref|XP_009794708.1| PREDICTED: LOB domain-containing protein 1-like isoform X1 [Nicotiana 
sylvestris]
Length=219

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            VI+SPCAACKILRRRC E+CVLAPYFPP +P+KFT AHR
Sbjct  37   VIVSPCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHR  75



>tpg|DAA44812.1| TPA: putative LOB domain-containing family protein [Zea mays]
 gb|AIB04798.1| LOB transcription factor, partial [Zea mays]
Length=235

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC + CVLAPYFPPTEP KFT AHR
Sbjct  57   VVLSPCAACKILRRRCADGCVLAPYFPPTEPAKFTTAHR  95



>ref|XP_004251265.1| PREDICTED: LOB domain-containing protein 1 [Solanum lycopersicum]
Length=189

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC E+CVLAPYFPP +P+KFT AHR
Sbjct  32   VVVSPCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHR  70



>ref|XP_003542002.1| PREDICTED: LOB domain-containing protein 11-like [Glycine max]
Length=198

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++ PCAACKILRRRC E+CVLAPYFPPTEP KFT AHR
Sbjct  26   VVMIPCAACKILRRRCAEKCVLAPYFPPTEPAKFTTAHR  64



>ref|NP_001049778.1| Os03g0287400 [Oryza sativa Japonica Group]
 gb|ABF95365.1| LOB domain protein 1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11692.1| Os03g0287400 [Oryza sativa Japonica Group]
 gb|EAZ26529.1| hypothetical protein OsJ_10424 [Oryza sativa Japonica Group]
 dbj|BAG93008.1| unnamed protein product [Oryza sativa Japonica Group]
Length=239

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACK+LRRRC + CVLAPYFPPTEP KFT AHR
Sbjct  59   VVLSPCAACKVLRRRCADGCVLAPYFPPTEPTKFTTAHR  97



>ref|XP_010658439.1| PREDICTED: LOB domain-containing protein 1 [Vitis vinifera]
Length=174

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             +  PCAACKILRRRC ERCVLAPYFPPTEPLKF IAH+
Sbjct  37   TVQGPCAACKILRRRCTERCVLAPYFPPTEPLKFVIAHK  75



>ref|XP_011089355.1| PREDICTED: LOB domain-containing protein 1 [Sesamum indicum]
Length=195

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  141  PCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            PCAACKILRRRCVE+CVLAPYFPPT+PLKFT AHR
Sbjct  31   PCAACKILRRRCVEKCVLAPYFPPTDPLKFTTAHR  65



>gb|KHG03359.1| LOB domain-containing 1 -like protein [Gossypium arboreum]
Length=208

 Score = 74.3 bits (181),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++L PCAACKILRRRCV++CVLAPYFPPTEP KF IAHR
Sbjct  60   LVLGPCAACKILRRRCVDKCVLAPYFPPTEPSKFIIAHR  98



>ref|XP_006343464.1| PREDICTED: LOB domain-containing protein 11-like [Solanum tuberosum]
Length=209

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             V++SPCAACKILRRRC ++CVLAPYFPP +P+KFT AHR
Sbjct  40   AVVVSPCAACKILRRRCADKCVLAPYFPPNDPIKFTTAHR  79



>gb|KHG27704.1| LOB domain-containing 11 -like protein [Gossypium arboreum]
Length=202

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACKILRRRC ++C+LAPYFPPTEP KFT AHR
Sbjct  33   VVISPCAACKILRRRCADKCMLAPYFPPTEPAKFTTAHR  71



>ref|XP_007150227.1| hypothetical protein PHAVU_005G137300g [Phaseolus vulgaris]
 gb|ESW22221.1| hypothetical protein PHAVU_005G137300g [Phaseolus vulgaris]
Length=199

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++++PCAACKILRRRC ++CVLAPYFPPTEP KFT AHR
Sbjct  30   LVMTPCAACKILRRRCADKCVLAPYFPPTEPAKFTTAHR  68



>ref|XP_010542601.1| PREDICTED: LOB domain-containing protein 1-like [Tarenaya hassleriana]
Length=241

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = +3

Query  129  VILSPCAACKILRRRCV-ERCVLAPYFPPTEPLKFTIAHR  245
            V+ SPCAACKILRRRCV ++CVLAPYFPPTEP KFTIAHR
Sbjct  43   VVASPCAACKILRRRCVADKCVLAPYFPPTEPTKFTIAHR  82



>ref|XP_009378147.1| PREDICTED: LOB domain-containing protein 1-like [Pyrus x bretschneideri]
Length=230

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPPTEPLKFTIAHR
Sbjct  76   CAACKILRRRCVEKCVLAPYFPPTEPLKFTIAHR  109



>ref|XP_009610820.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=204

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             I+SPCAACKILRRRC E+CVLAPYFPP +P+KFT AHR
Sbjct  37   AIVSPCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHR  75



>ref|XP_003566656.1| PREDICTED: LOB domain-containing protein 1-like [Brachypodium 
distachyon]
Length=203

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV+RC+LAPYFPPT+P KF  AHR
Sbjct  29   VVLSPCAACKILRRRCVDRCILAPYFPPTDPHKFAAAHR  67



>ref|XP_009626018.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=202

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+++PCAACKILRRRC E+CVLAPYFPP +P KFT AHR
Sbjct  32   VVVTPCAACKILRRRCAEKCVLAPYFPPNDPFKFTTAHR  70



>ref|XP_008656534.1| PREDICTED: LOB domain-containing protein 1 [Zea mays]
 gb|AFW82776.1| putative LOB domain-containing family protein [Zea mays]
 gb|AIB04718.1| LOB transcription factor, partial [Zea mays]
Length=212

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            LSPCAACKILRRRCV+RCVLAPYFPPTEP KF  AHR
Sbjct  34   LSPCAACKILRRRCVDRCVLAPYFPPTEPHKFATAHR  70



>ref|XP_003606493.1| LOB domain protein [Medicago truncatula]
 gb|AES88690.1| lateral organ boundaries (LOB) domain protein [Medicago truncatula]
Length=190

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 37/41 (90%), Gaps = 1/41 (2%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCV-ERCVLAPYFPPTEPLKFTIAHR  245
             V++SPCAACKILRRRC  ++CVLAPYFPPT+P KFTIAHR
Sbjct  19   AVVMSPCAACKILRRRCAADKCVLAPYFPPTDPAKFTIAHR  59



>ref|XP_008233367.1| PREDICTED: LOB domain-containing protein 1-like [Prunus mume]
Length=230

 Score = 73.2 bits (178),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC E+CVLAPYFPPTEPLKFTIAHR
Sbjct  75   CAACKILRRRCAEKCVLAPYFPPTEPLKFTIAHR  108



>ref|XP_007143674.1| hypothetical protein PHAVU_007G092000g [Phaseolus vulgaris]
 gb|ESW15668.1| hypothetical protein PHAVU_007G092000g [Phaseolus vulgaris]
Length=218

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  66   CAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  99



>ref|XP_004143835.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61400-like 
[Cucumis sativus]
Length=362

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV++C+LAPYFPPT+P KF   HR
Sbjct  11   VVLSPCAACKILRRRCVDKCILAPYFPPTDPFKFAAVHR  49



>ref|XP_008369390.1| PREDICTED: LOB domain-containing protein 1-like [Malus domestica]
 ref|XP_008354087.1| PREDICTED: LOB domain-containing protein 1-like [Malus domestica]
Length=230

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPPTEPLKFT+AHR
Sbjct  76   CAACKILRRRCVEKCVLAPYFPPTEPLKFTVAHR  109



>ref|XP_004987050.1| PREDICTED: LOB domain-containing protein 1-like [Setaria italica]
Length=236

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC + CVLAPYFPP EP KFT AHR
Sbjct  55   VVLSPCAACKILRRRCADGCVLAPYFPPAEPAKFTTAHR  93



>ref|XP_011077047.1| PREDICTED: LOB domain-containing protein 1-like [Sesamum indicum]
Length=192

 Score = 72.8 bits (177),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC E+CVLAPYFPPTEPLKFTIAHR
Sbjct  39   CAACKILRRRCAEKCVLAPYFPPTEPLKFTIAHR  72



>ref|XP_008445860.1| PREDICTED: LOB domain-containing protein 1-like [Cucumis melo]
Length=203

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  53   CAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  86



>gb|KHN17110.1| LOB domain-containing protein 1 [Glycine soja]
Length=222

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  70   CAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  103



>ref|XP_003536369.1| PREDICTED: LOB domain-containing protein 11-like [Glycine max]
Length=222

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  70   CAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  103



>ref|XP_004487250.1| PREDICTED: LOB domain-containing protein 11-like [Cicer arietinum]
Length=197

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V++SPCAACK LRRRC E+CVLAPYFPPT+P KFT  HR
Sbjct  20   VVMSPCAACKFLRRRCAEKCVLAPYFPPTQPAKFTTVHR  58



>ref|XP_004496332.1| PREDICTED: LOB domain-containing protein 11-like [Cicer arietinum]
Length=231

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  75   CAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  108



>ref|XP_003556215.1| PREDICTED: LOB domain-containing protein 11-like [Glycine max]
 gb|KHN00821.1| LOB domain-containing protein 1 [Glycine soja]
Length=222

 Score = 72.4 bits (176),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  70   CAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  103



>ref|XP_004173617.1| PREDICTED: LOB domain-containing protein 11-like, partial [Cucumis 
sativus]
Length=131

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV++C+LAPYFPPT+P KF   HR
Sbjct  11   VVLSPCAACKILRRRCVDKCILAPYFPPTDPFKFAAVHR  49



>ref|XP_003591977.1| LOB domain-containing protein [Medicago truncatula]
 gb|AES62228.1| lateral organ boundaries (LOB) domain protein [Medicago truncatula]
Length=229

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  73   CAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  106



>gb|EMT13503.1| hypothetical protein F775_02335 [Aegilops tauschii]
Length=223

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++LSPCAACK+LRRRC + C+LAPYFPPTEP KFT AHR
Sbjct  48   IVLSPCAACKVLRRRCADGCMLAPYFPPTEPAKFTTAHR  86



>ref|XP_008376313.1| PREDICTED: LOB domain-containing protein 1-like [Malus domestica]
Length=231

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC E+CVLAPYFPP EPLKFTIAHR
Sbjct  77   CAACKILRRRCAEKCVLAPYFPPNEPLKFTIAHR  110



>gb|ACU17708.1| unknown [Glycine max]
Length=117

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPPT+PLKFTIAHR
Sbjct  70   CAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHR  103



>emb|CBI31510.3| unnamed protein product [Vitis vinifera]
Length=279

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             PCAACKILRRRC ERCVLAPYFPPTEPLKF IAH+
Sbjct  145  GPCAACKILRRRCTERCVLAPYFPPTEPLKFVIAHK  180


 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             +  PCAACKILRRRC +RCVLAPYFPPTEP  F IAHR
Sbjct  27   AVQRPCAACKILRRRCTDRCVLAPYFPPTEPFNFIIAHR  65



>ref|XP_010920920.1| PREDICTED: LOB domain-containing protein 1 [Elaeis guineensis]
Length=199

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCV++CVLAPYFPPTEPLKFT AHR
Sbjct  42   CAACKILRRRCVDKCVLAPYFPPTEPLKFTTAHR  75



>gb|KHN21539.1| LOB domain-containing protein 11 [Glycine soja]
Length=171

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  141  PCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            PCAACKILRRRC E+CVLAPYFPPTEP KFT AHR
Sbjct  3    PCAACKILRRRCAEKCVLAPYFPPTEPAKFTTAHR  37



>gb|KGN51231.1| hypothetical protein Csa_5G496470 [Cucumis sativus]
Length=161

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRCV++C+LAPYFPPT+P KF   HR
Sbjct  11   VVLSPCAACKILRRRCVDKCILAPYFPPTDPFKFAAVHR  49



>ref|XP_009333736.1| PREDICTED: LOB domain-containing protein 1-like [Pyrus x bretschneideri]
Length=232

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC E+CVLAPYFPP EPLKFTIAHR
Sbjct  78   CAACKILRRRCAEKCVLAPYFPPNEPLKFTIAHR  111



>ref|XP_003561741.1| PREDICTED: LOB domain-containing protein 1 [Brachypodium distachyon]
Length=213

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACK+LRRRC + C+LAPYFPPT+P KFT AHR
Sbjct  47   VVLSPCAACKLLRRRCADGCMLAPYFPPTDPAKFTTAHR  85



>ref|XP_010922519.1| PREDICTED: LOB domain-containing protein 1-like [Elaeis guineensis]
Length=199

 Score = 71.2 bits (173),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+LSPCAACKILRRRC E+C+ APYFPP EPLKF  +HR
Sbjct  36   VVLSPCAACKILRRRCSEKCMFAPYFPPNEPLKFATSHR  74



>ref|XP_006597316.1| PREDICTED: LOB domain-containing protein 11-like [Glycine max]
Length=172

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +SPCAACKILRRRC E+CVLAPYFP TEP KFT AHR
Sbjct  1    MSPCAACKILRRRCAEKCVLAPYFPLTEPSKFTTAHR  37



>ref|XP_010253538.1| PREDICTED: LOB domain-containing protein 1-like [Nelumbo nucifera]
Length=207

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPP EPLKFT AHR
Sbjct  42   CAACKILRRRCVEKCVLAPYFPPNEPLKFTTAHR  75



>ref|XP_007132174.1| hypothetical protein PHAVU_011G072200g [Phaseolus vulgaris]
 gb|ESW04168.1| hypothetical protein PHAVU_011G072200g [Phaseolus vulgaris]
Length=200

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC E+CVLAPYFPPTEP KFTIAHR
Sbjct  36   CAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHR  69



>gb|ACU24293.1| unknown [Glycine max]
Length=222

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+C LAPYFPPT+PLKFTIAHR
Sbjct  70   CAACKILRRRCVEKCALAPYFPPTDPLKFTIAHR  103



>ref|XP_009772858.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana sylvestris]
Length=190

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +PCAACKILRRRC E+CVLAPYFPP +P+KFT AHR
Sbjct  34   TPCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHR  69



>ref|XP_010056894.1| PREDICTED: LOB domain-containing protein 1-like [Eucalyptus grandis]
Length=197

 Score = 70.5 bits (171),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+ SPCAACK LRRRC E CVLAPYFPP+EP KF IAHR
Sbjct  34   VVASPCAACKTLRRRCSESCVLAPYFPPSEPAKFAIAHR  72



>ref|XP_002315279.1| LOB domain protein 11 [Populus trichocarpa]
 gb|EEF01450.1| LOB domain protein 11 [Populus trichocarpa]
Length=213

 Score = 70.5 bits (171),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCV++CVLAPYFPP+EP KFTIAHR
Sbjct  61   CAACKILRRRCVDKCVLAPYFPPSEPYKFTIAHR  94



>ref|XP_010032234.1| PREDICTED: LOB domain-containing protein 1-like [Eucalyptus grandis]
 gb|KCW51633.1| hypothetical protein EUGRSUZ_J01123 [Eucalyptus grandis]
Length=228

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCV++CVLAPYFPPTEP KFTIAHR
Sbjct  78   CAACKILRRRCVDKCVLAPYFPPTEPYKFTIAHR  111



>ref|XP_002275323.1| PREDICTED: LOB domain-containing protein 1 [Vitis vinifera]
Length=162

 Score = 70.1 bits (170),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  141  PCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            PCAACKILRRRC +RCVLAPYFPPTEP  F IAHR
Sbjct  31   PCAACKILRRRCTDRCVLAPYFPPTEPFNFIIAHR  65



>gb|ADU54137.1| lateral organ boundaries domain 1 [Populus tremula x Populus 
alba]
Length=219

 Score = 70.5 bits (171),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCV++CVLAPYFPP+EP KFTIAHR
Sbjct  67   CAACKILRRRCVDKCVLAPYFPPSEPYKFTIAHR  100



>gb|KDP46164.1| hypothetical protein JCGZ_06675 [Jatropha curcas]
Length=215

 Score = 70.5 bits (171),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC E+CVLAPYFPPTEP KFTIAHR
Sbjct  60   CAACKILRRRCAEKCVLAPYFPPTEPYKFTIAHR  93



>ref|XP_009396864.1| PREDICTED: LOB domain-containing protein 11-like [Musa acuminata 
subsp. malaccensis]
Length=190

 Score = 70.1 bits (170),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+ SPCAACKILRRRC   CVLAPYFPPTEPL+FT AHR
Sbjct  30   VVHSPCAACKILRRRCSGGCVLAPYFPPTEPLEFTTAHR  68



>gb|KCW73808.1| hypothetical protein EUGRSUZ_E02410, partial [Eucalyptus grandis]
Length=117

 Score = 68.9 bits (167),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+ SPCAACK LRRRC E CVLAPYFPP+EP KF IAHR
Sbjct  34   VVASPCAACKTLRRRCSESCVLAPYFPPSEPAKFAIAHR  72



>gb|EPS63137.1| hypothetical protein M569_11650, partial [Genlisea aurea]
Length=152

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++ PCAACKILRRRC E+C+LAPYFPP +P KFT AHR
Sbjct  1    VVGPCAACKILRRRCEEKCILAPYFPPNDPFKFTTAHR  38



>ref|XP_006436216.1| hypothetical protein CICLE_v10032772mg [Citrus clementina]
 gb|ESR49456.1| hypothetical protein CICLE_v10032772mg [Citrus clementina]
 gb|KDO44598.1| hypothetical protein CISIN_1g045080mg [Citrus sinensis]
Length=203

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++LSPCAACK LRRRC E+CVLAPYFPPTEP  F I HR
Sbjct  39   IVLSPCAACKSLRRRCDEKCVLAPYFPPTEPQNFIIVHR  77



>ref|XP_006486488.1| PREDICTED: LOB domain-containing protein 1-like [Citrus sinensis]
Length=234

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++LSPCAACK LRRRC E+CVLAPYFPPTEP  F I HR
Sbjct  70   IVLSPCAACKSLRRRCDEKCVLAPYFPPTEPQNFIIVHR  108



>gb|KDO44597.1| hypothetical protein CISIN_1g047530mg, partial [Citrus sinensis]
Length=72

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRCVE+CVLAPYFPPTEP KF IAHR
Sbjct  27   CAACKILRRRCVEKCVLAPYFPPTEPQKFVIAHR  60



>gb|KDP44115.1| hypothetical protein JCGZ_05582 [Jatropha curcas]
Length=206

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC ++CVLAPYFPPTEP KFTIAHR
Sbjct  47   CAACKILRRRCADKCVLAPYFPPTEPAKFTIAHR  80



>ref|XP_002274953.3| PREDICTED: uncharacterized protein LOC100265000, partial [Vitis 
vinifera]
Length=352

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            + SPCAAC++LRRRC +RC+LAPYFP +EPL F IAHR
Sbjct  228  VQSPCAACRVLRRRCTDRCMLAPYFPSSEPLNFIIAHR  265



>ref|XP_009593636.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana tomentosiformis]
Length=211

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC E+CVLAPYFPP +P+KFT AHR
Sbjct  46   CAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHR  79



>emb|CDP08929.1| unnamed protein product [Coffea canephora]
Length=206

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC E+CVLAPYFPP +P+KFT AHR
Sbjct  41   CAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHR  74



>ref|XP_010909448.1| PREDICTED: LOB domain-containing protein 1-like [Elaeis guineensis]
Length=207

 Score = 67.8 bits (164),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC+++C+LAPYFPP EPLKF+ AHR
Sbjct  43   CAACKILRRRCIDKCLLAPYFPPNEPLKFSTAHR  76



>emb|CAN69741.1| hypothetical protein VITISV_017585 [Vitis vinifera]
Length=204

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC E+CVLAPYFPPT+P KFT AHR
Sbjct  41   CAACKILRRRCAEKCVLAPYFPPTDPAKFTTAHR  74



>ref|XP_009763968.1| PREDICTED: LOB domain-containing protein 1-like [Nicotiana sylvestris]
Length=212

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  144  CAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            CAACKILRRRC E+CVLAPYFPP  P+KFT AHR
Sbjct  46   CAACKILRRRCAEKCVLAPYFPPNNPIKFTTAHR  79



>ref|XP_008463578.1| PREDICTED: LOB domain-containing protein 1-like [Cucumis melo]
Length=177

 Score = 67.4 bits (163),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             PCAACKILRRRC E C L PYFPP EPLKFTIAHR
Sbjct  20   QPCAACKILRRRCRENCELGPYFPPMEPLKFTIAHR  55



>ref|XP_004147298.1| PREDICTED: LOB domain-containing protein 1-like [Cucumis sativus]
 gb|KGN64754.1| hypothetical protein Csa_1G088440 [Cucumis sativus]
Length=183

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACKILRRRC E C L PYFP  EPLKFTIAHR
Sbjct  20   SPCAACKILRRRCRENCELGPYFPSMEPLKFTIAHR  55



>ref|XP_004161318.1| PREDICTED: LOB domain-containing protein 1-like [Cucumis sativus]
Length=183

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACKILRRRC E C L PYFP  EPLKFTIAHR
Sbjct  20   SPCAACKILRRRCRENCELGPYFPSMEPLKFTIAHR  55



>ref|NP_179946.1| LOB domain-containing protein 10 [Arabidopsis thaliana]
 ref|NP_001154530.1| LOB domain-containing protein 10 [Arabidopsis thaliana]
 sp|O64836.1|LBD10_ARATH RecName: Full=LOB domain-containing protein 10; AltName: Full=ASYMMETRIC 
LEAVES 2-like protein 2; Short=AS2-like protein 
2 [Arabidopsis thaliana]
 gb|AAC17095.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM14865.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH10546.1| ASYMMETRIC LEAVES2-like 2 protein [Arabidopsis thaliana]
 gb|AEC07476.1| LOB domain-containing protein 10 [Arabidopsis thaliana]
 gb|AEC07477.1| LOB domain-containing protein 10 [Arabidopsis thaliana]
Length=311

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +PCAACK+LRR+C + CV APYFPPT P KF   HR
Sbjct  4    TPCAACKLLRRKCTQECVFAPYFPPTNPQKFIFVHR  39



>emb|CBI31509.3| unnamed protein product [Vitis vinifera]
Length=165

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+  PCAACK+LRRRC + C LAPYFPP+E LKF IAH+
Sbjct  37   VVQGPCAACKVLRRRCTDTCSLAPYFPPSEQLKFVIAHK  75



>emb|CAN75803.1| hypothetical protein VITISV_030052 [Vitis vinifera]
Length=137

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+  PCAACK+LRRRC + C LAPYFPP+E LKF IAH+
Sbjct  9    VVQGPCAACKVLRRRCTDTCXLAPYFPPSEQLKFVIAHK  47



>ref|XP_010318580.1| PREDICTED: LOB domain-containing protein 1-like [Solanum lycopersicum]
Length=171

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            + +PCAACK LRRRC+E C+L PYFPP EP+KF +AH+
Sbjct  14   LFTPCAACKFLRRRCLEDCLLKPYFPPNEPMKFIVAHK  51



>ref|XP_010531219.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
 ref|XP_010531220.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
 ref|XP_010531221.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
 ref|XP_010531222.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
 ref|XP_010531223.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
 ref|XP_010531224.1| PREDICTED: LOB domain-containing protein 10-like [Tarenaya hassleriana]
Length=295

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +PCAACK+LRR+C + CV APYFPP++P KF   HR
Sbjct  4    TPCAACKLLRRKCTQECVFAPYFPPSQPQKFAFVHR  39



>ref|XP_002275182.2| PREDICTED: LOB domain-containing protein 1 [Vitis vinifera]
Length=185

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            V+  PCAACK+LRRRC + C LAPYFPP+E LKF IAH+
Sbjct  57   VVQGPCAACKVLRRRCTDTCSLAPYFPPSEQLKFVIAHK  95



>ref|XP_008463841.1| PREDICTED: LOB domain-containing protein 12-like [Cucumis melo]
Length=161

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            GV  SPCA+CK+LRRRC + C+ APYFPP +PLKF I H+
Sbjct  2    GVGSSPCASCKLLRRRCAKDCIFAPYFPPEDPLKFAIVHK  41



>ref|XP_006404852.1| hypothetical protein EUTSA_v10000525mg [Eutrema salsugineum]
 gb|ESQ46305.1| hypothetical protein EUTSA_v10000525mg [Eutrema salsugineum]
Length=310

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +PCAACK+LRR+C + CV APYFPPT+P KF   HR
Sbjct  4    TPCAACKLLRRKCTQECVFAPYFPPTQPQKFISVHR  39



>ref|XP_002880519.1| LOB domain family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56778.1| LOB domain family protein [Arabidopsis lyrata subsp. lyrata]
Length=311

 Score = 66.6 bits (161),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +PCAACK+LRR+C + CV APYFPPT P KF   HR
Sbjct  4    TPCAACKLLRRKCTQECVFAPYFPPTNPQKFIFVHR  39



>ref|XP_002274989.2| PREDICTED: LOB domain-containing protein 1 [Vitis vinifera]
Length=270

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +  PC ACK+LRRRC + C+LAPYFPPTEP+KF  AH+
Sbjct  30   VQGPCGACKVLRRRCTKSCLLAPYFPPTEPMKFINAHK  67



>ref|XP_006340400.1| PREDICTED: LOB domain-containing protein 1-like [Solanum tuberosum]
Length=185

 Score = 65.1 bits (157),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  147  AACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            AACKILRRRC E+CVLAPYFPP +P+KFT AHR
Sbjct  34   AACKILRRRCAEKCVLAPYFPPNDPIKFTTAHR  66



>ref|XP_010472359.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
 ref|XP_010472360.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
 ref|XP_010472361.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
Length=308

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +PCAACK+LRR+C + CV APYFPPT P KF   HR
Sbjct  4    TPCAACKLLRRKCTQECVFAPYFPPTNPQKFICVHR  39



>ref|XP_010417109.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
 ref|XP_010417110.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
 ref|XP_010417111.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
 ref|XP_010417112.1| PREDICTED: LOB domain-containing protein 10-like [Camelina sativa]
Length=308

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +PCAACK+LRR+C + CV APYFPPT P KF   HR
Sbjct  4    TPCAACKLLRRKCTQECVFAPYFPPTNPQKFICVHR  39



>ref|XP_004143222.1| PREDICTED: LOB domain-containing protein 12-like [Cucumis sativus]
 ref|XP_004162401.1| PREDICTED: LOB domain-containing protein 12-like [Cucumis sativus]
 gb|KGN47050.1| hypothetical protein Csa_6G181550 [Cucumis sativus]
Length=162

 Score = 64.7 bits (156),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            GV  SPCA+CK+LRRRC + C+ APYFPP +PLKF I H+
Sbjct  2    GVGSSPCASCKLLRRRCAKDCIFAPYFPPHDPLKFAIVHK  41



>emb|CBI31511.3| unnamed protein product [Vitis vinifera]
Length=190

 Score = 64.7 bits (156),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             +  PCAACKILRRRC ++ +LAPYFPPTE LKF IAH+
Sbjct  53   AVKGPCAACKILRRRCTDKGMLAPYFPPTETLKFIIAHK  91



>ref|XP_010429315.1| PREDICTED: LOB domain-containing protein 10 [Camelina sativa]
Length=308

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +PCAACK+LRR+C + CV APYFPPT P KF   HR
Sbjct  4    TPCAACKLLRRKCTQECVFAPYFPPTNPQKFICVHR  39



>ref|XP_002275345.1| PREDICTED: LOB domain-containing protein 1 [Vitis vinifera]
Length=165

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             +  PCAACKILRRRC ++ +LAPYFPPTE LKF IAH+
Sbjct  28   AVKGPCAACKILRRRCTDKGMLAPYFPPTETLKFIIAHK  66



>ref|XP_009392713.1| PREDICTED: LOB domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=207

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            LSPCAACK LRRRC   C+LAP+FPPTE LKFT AHR
Sbjct  45   LSPCAACKSLRRRCTVSCLLAPFFPPTETLKFTTAHR  81



>ref|XP_010658649.1| PREDICTED: LOB domain-containing protein 1-like [Vitis vinifera]
Length=173

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  129  VILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             +  PC ACK+LRRRC + C+LAPYFPPTEP+KF  AH+
Sbjct  29   AVQGPCGACKVLRRRCTKSCLLAPYFPPTEPMKFINAHK  67



>ref|XP_006340077.1| PREDICTED: LOB domain-containing protein 1-like [Solanum tuberosum]
Length=171

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            + +PCAACK LRRRC+E C+L PYFPP EP+KF + H+
Sbjct  14   LFTPCAACKFLRRRCLEDCLLKPYFPPNEPMKFIVVHK  51



>ref|XP_006338222.1| PREDICTED: LOB domain-containing protein 36-like [Solanum tuberosum]
Length=313

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +PLKF+  H+
Sbjct  6    SPCAACKFLRRKCTQECVFAPYFPPDQPLKFSNVHK  41



>emb|CBI31504.3| unnamed protein product [Vitis vinifera]
Length=298

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +  PC ACK+LRRRC + C+LAPYFPPTEP+KF  AH+
Sbjct  136  VQGPCGACKVLRRRCTKSCLLAPYFPPTEPMKFINAHK  173



>ref|XP_009140479.1| PREDICTED: LOB domain-containing protein 10 [Brassica rapa]
 ref|XP_009140480.1| PREDICTED: LOB domain-containing protein 10 [Brassica rapa]
 ref|XP_009140481.1| PREDICTED: LOB domain-containing protein 10 [Brassica rapa]
 ref|XP_009140482.1| PREDICTED: LOB domain-containing protein 10 [Brassica rapa]
 emb|CDX89590.1| BnaC04g36090D [Brassica napus]
 emb|CDX68120.1| BnaA07g21600D [Brassica napus]
Length=308

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +PCAACK+LRR+C + CV APYFPPT+P KF   H+
Sbjct  4    TPCAACKLLRRKCTQECVFAPYFPPTQPQKFIYVHK  39



>ref|XP_004232054.1| PREDICTED: LOB domain-containing protein 36-like [Solanum lycopersicum]
 ref|XP_010316156.1| PREDICTED: LOB domain-containing protein 36-like [Solanum lycopersicum]
Length=311

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +PLKF+  H+
Sbjct  6    SPCAACKFLRRKCTQECVFAPYFPPDQPLKFSNVHK  41



>ref|XP_009362272.1| PREDICTED: LOB domain-containing protein 36-like [Pyrus x bretschneideri]
Length=263

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +P KF   H+
Sbjct  7    SPCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHK  42



>ref|XP_010464781.1| PREDICTED: LOB domain-containing protein 36-like [Camelina sativa]
Length=327

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +P KF+  H+
Sbjct  6    SPCAACKFLRRKCTQECVFAPYFPPDQPQKFSFVHK  41



>ref|XP_008371805.1| PREDICTED: LOB domain-containing protein 36-like [Malus domestica]
Length=263

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +P KF   H+
Sbjct  7    SPCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHK  42



>ref|XP_008225579.1| PREDICTED: LOB domain-containing protein 6-like [Prunus mume]
Length=266

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +P KF   HR
Sbjct  7    SPCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHR  42



>ref|XP_006296515.1| hypothetical protein CARUB_v10025704mg [Capsella rubella]
 gb|EOA29413.1| hypothetical protein CARUB_v10025704mg [Capsella rubella]
Length=309

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +PCAACK+LRR+C + CV APYFPPT P KF   H+
Sbjct  4    TPCAACKLLRRKCTQECVFAPYFPPTNPQKFICVHK  39



>emb|CBI31506.3| unnamed protein product [Vitis vinifera]
Length=147

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             PCAACK+LRRRC E C+LAPYFPP EPLKF  AH+
Sbjct  60   GPCAACKVLRRRCDESCILAPYFPPNEPLKFINAHK  95



>ref|XP_007212478.1| hypothetical protein PRUPE_ppa015145mg [Prunus persica]
 gb|EMJ13677.1| hypothetical protein PRUPE_ppa015145mg [Prunus persica]
Length=265

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +P KF   HR
Sbjct  7    SPCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHR  42



>emb|CDY40054.1| BnaC05g12610D [Brassica napus]
Length=163

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +SPCAACK+LRR+CVE CV APYFP  EP KF I H+
Sbjct  11   VSPCAACKLLRRKCVEDCVFAPYFPAKEPYKFAIVHK  47



>ref|XP_009149087.1| PREDICTED: LOB domain-containing protein 3 [Brassica rapa]
 emb|CDY66794.1| BnaA06g38340D [Brassica napus]
Length=163

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +SPCAACK+LRR+CVE CV APYFP  EP KF I H+
Sbjct  11   VSPCAACKLLRRKCVEDCVFAPYFPAKEPYKFAIVHK  47



>emb|CDY03987.1| BnaC02g37020D [Brassica napus]
Length=132

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            I SPCAACK LRRRC   CV APYFPP EP KF   HR
Sbjct  9    INSPCAACKFLRRRCTSDCVFAPYFPPDEPTKFANVHR  46



>emb|CBI31505.3| unnamed protein product [Vitis vinifera]
Length=139

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             PCAAC+ LRRRC E C+LAPYFPP EPLKF  AH+
Sbjct  11   GPCAACRFLRRRCNESCILAPYFPPNEPLKFINAHK  46



>ref|XP_009129401.1| PREDICTED: LOB domain-containing protein 25-like [Brassica rapa]
Length=132

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            I SPCAACK LRRRC   CV APYFPP EP KF   HR
Sbjct  9    INSPCAACKFLRRRCTSDCVFAPYFPPDEPTKFANVHR  46



>ref|XP_009416706.1| PREDICTED: LOB domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=178

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  132  ILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            ++ PCAACK+LRRRC ++C+LAPYFPPT+   FT AHR
Sbjct  12   VVGPCAACKVLRRRCTDKCMLAPYFPPTDLRTFTNAHR  49



>ref|XP_002275051.1| PREDICTED: LOB domain-containing protein 1 [Vitis vinifera]
Length=167

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
             PCAAC+ LRRRC E C+LAPYFPP EPLKF  AH+
Sbjct  39   GPCAACRFLRRRCNESCILAPYFPPNEPLKFINAHK  74



>emb|CDY52150.1| BnaA02g34590D [Brassica napus]
Length=316

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +P KF   H+
Sbjct  8    SPCAACKFLRRKCTQECVFAPYFPPDQPHKFAYVHK  43



>ref|XP_002866728.1| hypothetical protein ARALYDRAFT_496913 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42987.1| hypothetical protein ARALYDRAFT_496913 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +P KF   H+
Sbjct  6    SPCAACKFLRRKCTQECVFAPYFPPDQPQKFAYVHK  41



>ref|XP_004150042.1| PREDICTED: LOB domain-containing protein 4-like [Cucumis sativus]
 ref|XP_004161659.1| PREDICTED: LOB domain-containing protein 4-like [Cucumis sativus]
 gb|KGN46813.1| hypothetical protein Csa_6G139130 [Cucumis sativus]
Length=173

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            G  LSPCAACK+LRRRC + CV APYFP  EP KF   H+
Sbjct  10   GTSLSPCAACKLLRRRCAQDCVFAPYFPADEPHKFASVHK  49



>ref|XP_006344071.1| PREDICTED: LOB domain-containing protein 12-like, partial [Solanum 
tuberosum]
Length=115

 Score = 61.2 bits (147),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            G   SPCA+CK+LRRRC + C+ APYFPP EP KF I H+
Sbjct  2    GGSSSPCASCKLLRRRCAKDCIFAPYFPPNEPHKFAIVHK  41



>ref|XP_006344072.1| PREDICTED: LOB domain-containing protein 12-like, partial [Solanum 
tuberosum]
Length=115

 Score = 61.2 bits (147),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            G   SPCA+CK+LRRRC + C+ APYFPP EP KF I H+
Sbjct  2    GGSSSPCASCKLLRRRCTKDCIFAPYFPPNEPHKFAIVHK  41



>ref|XP_010444719.1| PREDICTED: LOB domain-containing protein 36-like [Camelina sativa]
Length=322

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +P KF   H+
Sbjct  6    SPCAACKFLRRKCTQECVFAPYFPPDQPQKFAFVHK  41



>ref|XP_009132714.1| PREDICTED: LOB domain-containing protein 12-like [Brassica rapa]
Length=249

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCA+CK+LRRRC + C+ APYFPP +P KF I H+
Sbjct  68   SPCASCKLLRRRCAKECIFAPYFPPDDPHKFAIVHK  103



>ref|XP_009388947.1| PREDICTED: LOB domain-containing protein 4 [Musa acuminata subsp. 
malaccensis]
Length=174

 Score = 61.6 bits (148),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  135  LSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            +SPCAACK+LRRRC + CV APYFP  EP KF I HR
Sbjct  11   VSPCAACKLLRRRCTQECVFAPYFPADEPHKFAIVHR  47



>ref|XP_010484574.1| PREDICTED: LOB domain-containing protein 36 [Camelina sativa]
 ref|XP_010484575.1| PREDICTED: LOB domain-containing protein 36 [Camelina sativa]
Length=320

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +P KF   H+
Sbjct  6    SPCAACKFLRRKCTQECVFAPYFPPDQPQKFAFVHK  41



>ref|XP_010687953.1| PREDICTED: LOB domain-containing protein 36-like [Beta vulgaris 
subsp. vulgaris]
Length=333

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C + CV APYFPP +P +F   H+
Sbjct  6    SPCAACKFLRRKCTQECVFAPYFPPDQPQRFANVHK  41



>ref|XP_009349366.1| PREDICTED: LOB domain-containing protein 6-like [Pyrus x bretschneideri]
Length=247

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C   CV APYFPP +P KF   H+
Sbjct  8    SPCAACKFLRRKCQAECVFAPYFPPDQPHKFANVHK  43



>ref|XP_009336227.1| PREDICTED: LOB domain-containing protein 6-like [Pyrus x bretschneideri]
Length=247

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK LRR+C   CV APYFPP +P KF   H+
Sbjct  8    SPCAACKFLRRKCQAECVFAPYFPPDQPHKFANVHK  43



>gb|AAM64523.1| unknown [Arabidopsis thaliana]
Length=193

 Score = 61.6 bits (148),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCA+CK+LRRRC + C+LAPYFPP +P KF I H+
Sbjct  7    SPCASCKLLRRRCAKDCILAPYFPPDDPHKFAIVHK  42



>ref|XP_010459193.1| PREDICTED: LOB domain-containing protein 3-like [Camelina sativa]
Length=164

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            G  +SPCA CK+LRR+CV+ CV APYFP  EP KF I H+
Sbjct  9    GRTVSPCAGCKLLRRKCVKDCVFAPYFPSKEPYKFAIVHK  48



>emb|CDP04292.1| unnamed protein product [Coffea canephora]
Length=191

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  141  PCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            PCAACK LRRRC + CVLAPYFP +EPL+F I H+
Sbjct  24   PCAACKSLRRRCSDNCVLAPYFPSSEPLRFNIVHK  58



>ref|XP_002984853.1| hypothetical protein SELMODRAFT_49084, partial [Selaginella moellendorffii]
 gb|EFJ14103.1| hypothetical protein SELMODRAFT_49084, partial [Selaginella moellendorffii]
Length=110

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK+LRRRC + C+ APYFPP EP KF   H+
Sbjct  1    SPCAACKLLRRRCAQDCIFAPYFPPDEPQKFAFVHK  36



>gb|ABK23871.1| unknown [Picea sitchensis]
Length=180

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACKILRRRC E+CVLAPYFP  +  KF  AHR
Sbjct  14   SPCAACKILRRRCGEKCVLAPYFPSNDLHKFATAHR  49



>ref|XP_010476763.1| PREDICTED: LOB domain-containing protein 3 [Camelina sativa]
 ref|XP_010476764.1| PREDICTED: LOB domain-containing protein 3 [Camelina sativa]
 ref|XP_010476765.1| PREDICTED: LOB domain-containing protein 3 [Camelina sativa]
Length=164

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  126  GVILSPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            G  +SPCA CK+LRR+CV+ CV APYFP  EP KF I H+
Sbjct  9    GRTVSPCAGCKLLRRKCVKDCVFAPYFPSKEPYKFAIVHK  48



>ref|XP_002985907.1| hypothetical protein SELMODRAFT_49085, partial [Selaginella moellendorffii]
 gb|EFJ13084.1| hypothetical protein SELMODRAFT_49085, partial [Selaginella moellendorffii]
Length=110

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  138  SPCAACKILRRRCVERCVLAPYFPPTEPLKFTIAHR  245
            SPCAACK+LRRRC + C+ APYFPP EP KF   H+
Sbjct  1    SPCAACKLLRRRCAQDCIFAPYFPPDEPQKFAFVHK  36



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 514220833636