BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c101760_g1_i1 len=1028 path=[1:0-1027]

Length=1028
                                                                      Score     E

ref|XP_009627799.1|  PREDICTED: organic cation/carnitine transpor...    306   1e-96   
ref|XP_009782422.1|  PREDICTED: organic cation/carnitine transpor...    306   2e-96   
ref|XP_004239844.1|  PREDICTED: organic cation/carnitine transpor...    303   3e-95   
ref|XP_011014246.1|  PREDICTED: organic cation/carnitine transpor...    292   2e-90   
ref|XP_002315082.2|  organic cation transporter-related family pr...    290   1e-89   Populus trichocarpa [western balsam poplar]
ref|XP_004252143.1|  PREDICTED: organic cation/carnitine transpor...    290   1e-89   
ref|XP_006422298.1|  hypothetical protein CICLE_v10004786mg             288   3e-89   
ref|XP_011014256.1|  PREDICTED: organic cation/carnitine transpor...    286   2e-88   
ref|XP_010260769.1|  PREDICTED: organic cation/carnitine transpor...    285   7e-88   
ref|XP_010537821.1|  PREDICTED: organic cation/carnitine transpor...    278   4e-85   
ref|XP_011095828.1|  PREDICTED: organic cation/carnitine transpor...    277   7e-85   
ref|XP_007022787.1|  Organic cation/carnitine transporter 3             278   1e-84   
ref|XP_002265245.3|  PREDICTED: organic cation/carnitine transpor...    277   2e-84   Vitis vinifera
ref|XP_002890162.1|  hypothetical protein ARALYDRAFT_471835             275   9e-84   
ref|XP_002266025.1|  PREDICTED: organic cation/carnitine transpor...    274   1e-83   Vitis vinifera
ref|XP_002520225.1|  sugar transporter, putative                        272   2e-83   Ricinus communis
ref|XP_010063992.1|  PREDICTED: organic cation/carnitine transpor...    273   3e-83   
ref|XP_004293841.1|  PREDICTED: organic cation/carnitine transpor...    272   6e-83   
ref|XP_009392877.1|  PREDICTED: organic cation/carnitine transpor...    270   4e-82   
ref|XP_010476747.1|  PREDICTED: organic cation/carnitine transpor...    268   2e-81   
gb|KEH19342.1|  organic cation/carnitine transporter                    268   2e-81   
ref|XP_010532010.1|  PREDICTED: organic cation/carnitine transpor...    268   6e-81   
ref|XP_006304573.1|  hypothetical protein CARUB_v10011593mg             266   8e-81   
ref|XP_002889241.1|  hypothetical protein ARALYDRAFT_895842             266   2e-80   
ref|XP_010497812.1|  PREDICTED: organic cation/carnitine transpor...    266   2e-80   
ref|XP_010092478.1|  Organic cation/carnitine transporter 3             265   2e-80   
ref|XP_006389896.1|  hypothetical protein EUTSA_v10018401mg             265   3e-80   
ref|NP_173089.1|  organic cation/carnitine transporter 3                265   6e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010474491.1|  PREDICTED: organic cation/carnitine transpor...    262   7e-80   
ref|XP_009128350.1|  PREDICTED: organic cation/carnitine transpor...    264   8e-80   
emb|CDX87388.1|  BnaA07g34850D                                          263   1e-79   
ref|XP_011095769.1|  PREDICTED: organic cation/carnitine transpor...    265   1e-79   
gb|KDP44653.1|  hypothetical protein JCGZ_19689                         263   1e-79   
ref|XP_010092475.1|  Organic cation/carnitine transporter 3             264   1e-79   
emb|CDX88532.1|  BnaC06g39760D                                          264   2e-79   
ref|XP_010476749.1|  PREDICTED: organic cation/carnitine transpor...    263   3e-79   
ref|XP_009106657.1|  PREDICTED: organic cation/carnitine transpor...    262   4e-79   
emb|CDY22274.1|  BnaC02g25780D                                          262   4e-79   
ref|XP_006416822.1|  hypothetical protein EUTSA_v10007377mg             262   5e-79   
ref|XP_002265206.1|  PREDICTED: organic cation/carnitine transpor...    262   8e-79   Vitis vinifera
ref|XP_006301897.1|  hypothetical protein CARUB_v10022372mg             261   9e-79   
ref|NP_178054.1|  organic cation/carnitine transporter 2                261   9e-79   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27594.1|  hypothetical protein MIMGU_mgv1a018738mg                261   1e-78   
ref|XP_009110451.1|  PREDICTED: organic cation/carnitine transpor...    260   2e-78   
ref|XP_010063993.1|  PREDICTED: organic cation/carnitine transpor...    261   2e-78   
ref|XP_010417600.1|  PREDICTED: organic cation/carnitine transpor...    254   9e-78   
gb|KHN21866.1|  Organic cation/carnitine transporter 2                  254   2e-77   
gb|KFK42341.1|  hypothetical protein AALP_AA2G243700                    258   3e-77   
ref|XP_009340129.1|  PREDICTED: organic cation/carnitine transpor...    258   3e-77   
ref|XP_009340128.1|  PREDICTED: organic cation/carnitine transpor...    257   5e-77   
ref|XP_008225999.1|  PREDICTED: organic cation/carnitine transpor...    256   5e-77   
ref|XP_009593309.1|  PREDICTED: organic cation/carnitine transpor...    255   7e-77   
ref|XP_010417601.1|  PREDICTED: organic cation/carnitine transpor...    251   1e-76   
ref|XP_009340545.1|  PREDICTED: organic cation/carnitine transpor...    255   3e-76   
ref|XP_004514443.1|  PREDICTED: organic cation/carnitine transpor...    254   6e-76   
ref|XP_007212860.1|  hypothetical protein PRUPE_ppa021519mg             253   9e-76   
ref|XP_010092477.1|  Organic cation/carnitine transporter 3             252   4e-75   
ref|XP_003528188.1|  PREDICTED: organic cation/carnitine transpor...    252   6e-75   
ref|XP_010429819.1|  PREDICTED: organic cation/carnitine transpor...    250   7e-75   
ref|XP_010092476.1|  Organic cation/carnitine transporter 3             251   8e-75   
ref|XP_010429818.1|  PREDICTED: organic cation/carnitine transpor...    250   2e-74   
ref|XP_010676187.1|  PREDICTED: organic cation/carnitine transpor...    249   3e-74   
gb|EYU33804.1|  hypothetical protein MIMGU_mgv1a019372mg                249   3e-74   
ref|XP_007138201.1|  hypothetical protein PHAVU_009G189000g             249   6e-74   
ref|XP_007214739.1|  hypothetical protein PRUPE_ppa025144mg             248   2e-73   
ref|XP_008225993.1|  PREDICTED: LOW QUALITY PROTEIN: organic cati...    245   1e-72   
ref|XP_009363330.1|  PREDICTED: organic cation/carnitine transpor...    245   2e-72   
ref|XP_008225992.1|  PREDICTED: organic cation/carnitine transpor...    244   4e-72   
gb|KCW71280.1|  hypothetical protein EUGRSUZ_F04367                     243   5e-72   
ref|XP_008371967.1|  PREDICTED: organic cation/carnitine transpor...    244   6e-72   
ref|XP_007211551.1|  hypothetical protein PRUPE_ppa004111mg             244   7e-72   
ref|XP_011087052.1|  PREDICTED: organic cation/carnitine transpor...    243   7e-72   
emb|CDP07167.1|  unnamed protein product                                244   1e-71   
emb|CAN72566.1|  hypothetical protein VITISV_029528                     249   5e-71   Vitis vinifera
ref|XP_006853451.1|  hypothetical protein AMTR_s00032p00186620          238   5e-71   
ref|XP_010932367.1|  PREDICTED: organic cation/carnitine transpor...    238   6e-70   
ref|XP_008813564.1|  PREDICTED: organic cation/carnitine transpor...    238   6e-70   
emb|CDY56805.1|  BnaA02g36180D                                          236   2e-69   
ref|XP_009363323.1|  PREDICTED: organic cation/carnitine transpor...    235   1e-68   
gb|KDO61528.1|  hypothetical protein CISIN_1g039541mg                   234   2e-68   
emb|CDX96817.1|  BnaA08g23600D                                          232   5e-68   
ref|XP_003520216.1|  PREDICTED: organic cation/carnitine transpor...    228   3e-66   
ref|XP_002315081.2|  hypothetical protein POPTR_0010s18150g             228   8e-66   Populus trichocarpa [western balsam poplar]
ref|XP_007211479.1|  hypothetical protein PRUPE_ppa007595mg             222   2e-65   
emb|CDX83951.1|  BnaC08g16940D                                          223   9e-65   
ref|XP_011000458.1|  PREDICTED: organic cation/carnitine transpor...    224   1e-64   
gb|EMT30622.1|  Solute carrier family 22 member 3                       224   1e-64   
ref|XP_010688825.1|  PREDICTED: organic cation/carnitine transpor...    224   2e-64   
ref|XP_003562876.1|  PREDICTED: organic cation/carnitine transpor...    224   2e-64   
ref|XP_002322629.1|  hypothetical protein POPTR_0016s03850g             223   4e-64   Populus trichocarpa [western balsam poplar]
ref|XP_007022779.1|  Organic cation/carnitine transporter 2, puta...    223   4e-64   
ref|XP_008226044.1|  PREDICTED: organic cation/carnitine transpor...    222   1e-63   
gb|AFK48052.1|  unknown                                                 218   1e-63   
ref|XP_004958022.1|  PREDICTED: organic cation/carnitine transpor...    221   3e-63   
gb|ACG29388.1|  carbohydrate transporter/ sugar porter                  221   3e-63   Zea mays [maize]
gb|ACF86499.1|  unknown                                                 221   3e-63   Zea mays [maize]
ref|NP_001147880.1|  carbohydrate transporter/ sugar porter             221   4e-63   Zea mays [maize]
ref|XP_002460855.1|  hypothetical protein SORBIDRAFT_02g036370          220   5e-63   Sorghum bicolor [broomcorn]
ref|XP_003605381.1|  Solute carrier family 22 member                    219   1e-62   
ref|XP_010688824.1|  PREDICTED: organic cation/carnitine transpor...    218   4e-62   
ref|XP_006658692.1|  PREDICTED: organic cation/carnitine transpor...    216   5e-62   
ref|XP_008225995.1|  PREDICTED: organic cation/carnitine transpor...    217   6e-62   
gb|KEH29243.1|  organic cation/carnitine transporter                    216   1e-61   
ref|NP_001240214.1|  uncharacterized protein LOC100819053               216   2e-61   
gb|AES87562.2|  organic cation/carnitine transporter                    216   2e-61   
ref|XP_003605365.1|  Solute carrier family 22 member                    216   3e-61   
gb|EAZ40293.1|  hypothetical protein OsJ_24738                          215   4e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007214516.1|  hypothetical protein PRUPE_ppa015704mg             214   5e-61   
gb|EAZ04337.1|  hypothetical protein OsI_26477                          215   5e-61   Oryza sativa Indica Group [Indian rice]
dbj|BAC83382.1|  putative organic cation transporter                    215   6e-61   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657833.1|  PREDICTED: organic cation/carnitine transpor...    213   5e-60   
ref|XP_003627852.1|  Solute carrier family 22 member                    212   8e-60   
ref|XP_003627841.1|  Solute carrier family 22 member                    211   2e-59   
ref|XP_009363372.1|  PREDICTED: organic cation/carnitine transpor...    209   4e-59   
ref|XP_010045679.1|  PREDICTED: organic cation/carnitine transpor...    209   6e-59   
ref|XP_010688820.1|  PREDICTED: organic cation/carnitine transpor...    207   2e-58   
ref|XP_007133866.1|  hypothetical protein PHAVU_011G215600g             207   3e-58   
ref|XP_003616420.1|  Solute carrier family 22 member                    207   4e-58   
ref|XP_008372143.1|  PREDICTED: organic cation/carnitine transpor...    206   7e-58   
gb|KFK42346.1|  hypothetical protein AALP_AA2G244300                    206   9e-58   
emb|CBI24142.3|  unnamed protein product                                210   2e-57   
ref|XP_009149071.1|  PREDICTED: organic cation/carnitine transpor...    205   3e-57   
ref|XP_002467752.1|  hypothetical protein SORBIDRAFT_01g033410          206   3e-57   Sorghum bicolor [broomcorn]
gb|ACB59210.1|  transporter-related protein                             204   4e-57   Brassica oleracea
ref|XP_004986929.1|  PREDICTED: organic cation/carnitine transpor...    204   7e-57   
gb|AAM78113.1|  At1g79410/T8K14_17                                      200   8e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008661101.1|  PREDICTED: LOW QUALITY PROTEIN: organic cati...    204   1e-56   
emb|CDY35085.1|  BnaA06g10950D                                          203   1e-56   
emb|CDY33333.1|  BnaC05g12500D                                          203   1e-56   
gb|EYU33503.1|  hypothetical protein MIMGU_mgv1a027031mg                197   1e-56   
ref|XP_009149070.1|  PREDICTED: organic cation/carnitine transpor...    203   2e-56   
gb|EAZ40296.1|  hypothetical protein OsJ_24741                          202   3e-56   Oryza sativa Japonica Group [Japonica rice]
ref|NP_173087.1|  organic cation/carnitine transporter 6                202   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001059990.1|  Os07g0562400                                       202   4e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ04340.1|  hypothetical protein OsI_26480                          202   4e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_003616647.1|  Solute carrier family 22 member                    202   4e-56   
ref|NP_001059989.1|  Os07g0562300                                       202   5e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EMT22077.1|  Solute carrier family 22 member 12                      200   6e-56   
ref|XP_009106661.1|  PREDICTED: organic cation/carnitine transpor...    201   7e-56   
ref|XP_002889243.1|  hypothetical protein ARALYDRAFT_477106             201   7e-56   
emb|CDX87384.1|  BnaA07g34890D                                          200   1e-55   
ref|NP_178059.1|  organic cation/carnitine transporter5                 200   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb|EEC70554.1|  hypothetical protein OsI_01709                          201   4e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_004295551.1|  PREDICTED: organic cation/carnitine transpor...    195   7e-55   
emb|CDX88537.1|  BnaC06g39810D                                          197   8e-55   
ref|XP_006389892.1|  hypothetical protein EUTSA_v10018417mg             198   1e-54   
ref|XP_010472795.1|  PREDICTED: organic cation/carnitine transpor...    198   1e-54   
emb|CDY61617.1|  BnaC02g46700D                                          197   1e-54   
ref|XP_006422297.1|  hypothetical protein CICLE_v10006697mg             202   2e-54   
ref|XP_002890161.1|  hypothetical protein ARALYDRAFT_471833             197   2e-54   
ref|XP_009106662.1|  PREDICTED: organic cation/carnitine transpor...    196   5e-54   
ref|XP_006301621.1|  hypothetical protein CARUB_v10022062mg             196   5e-54   
ref|XP_010429822.1|  PREDICTED: organic cation/carnitine transpor...    196   5e-54   
emb|CDY56801.1|  BnaA02g36150D                                          195   8e-54   
ref|XP_006303214.1|  hypothetical protein CARUB_v10011578mg             196   9e-54   
gb|KDO61527.1|  hypothetical protein CISIN_1g041759mg                   195   1e-53   
emb|CDX87383.1|  BnaA07g34900D                                          195   1e-53   
ref|XP_009795682.1|  PREDICTED: organic cation/carnitine transpor...    195   1e-53   
ref|XP_010497803.1|  PREDICTED: organic cation/carnitine transpor...    194   4e-53   
ref|XP_006403333.1|  hypothetical protein EUTSA_v10003188mg             194   5e-53   
ref|XP_011012857.1|  PREDICTED: organic cation/carnitine transpor...    187   7e-53   
ref|XP_010539566.1|  PREDICTED: organic cation/carnitine transpor...    191   3e-52   
ref|XP_009766980.1|  PREDICTED: organic cation/carnitine transpor...    184   7e-52   
ref|XP_010688763.1|  PREDICTED: organic cation/carnitine transpor...    187   1e-51   
emb|CDX88538.1|  BnaC06g39820D                                          189   1e-51   
ref|XP_010688758.1|  PREDICTED: organic cation/carnitine transpor...    187   7e-51   
ref|XP_009104532.1|  PREDICTED: LOW QUALITY PROTEIN: organic cati...    186   3e-50   
ref|XP_006416824.1|  hypothetical protein EUTSA_v10007384mg             186   4e-50   
dbj|BAD54717.1|  putative solute carrier family 22 member 3             186   4e-50   Oryza sativa Japonica Group [Japonica rice]
gb|KFK42345.1|  hypothetical protein AALP_AA2G244200                    185   5e-50   
ref|XP_010532008.1|  PREDICTED: organic cation/carnitine transpor...    185   8e-50   
ref|NP_001172311.1|  Os01g0330500                                       187   8e-50   
ref|XP_010462739.1|  PREDICTED: organic cation/carnitine transpor...    185   8e-50   
gb|EPS74210.1|  hypothetical protein M569_00551                         183   2e-49   
ref|XP_010688757.1|  PREDICTED: organic cation/carnitine transpor...    181   2e-48   
ref|XP_010688821.1|  PREDICTED: organic cation/carnitine transpor...    178   3e-48   
ref|XP_009620576.1|  PREDICTED: organic cation/carnitine transpor...    178   4e-47   
ref|XP_010045676.1|  PREDICTED: organic cation/carnitine transpor...    175   2e-46   
ref|XP_010476745.1|  PREDICTED: LOW QUALITY PROTEIN: organic cati...    173   1e-45   
ref|XP_002465179.1|  hypothetical protein SORBIDRAFT_01g033430          173   2e-45   Sorghum bicolor [broomcorn]
ref|XP_004246113.1|  PREDICTED: organic cation/carnitine transpor...    171   6e-45   
ref|XP_007133865.1|  hypothetical protein PHAVU_011G215500g             166   8e-43   
ref|XP_010688755.1|  PREDICTED: organic cation/carnitine transpor...    161   2e-41   
ref|XP_010688754.1|  PREDICTED: organic cation/carnitine transpor...    161   2e-41   
ref|XP_009340553.1|  PREDICTED: organic cation/carnitine transpor...    160   2e-41   
ref|XP_010535281.1|  PREDICTED: organic cation/carnitine transpor...    157   1e-39   
ref|XP_010270825.1|  PREDICTED: organic cation/carnitine transpor...    157   1e-39   
gb|EEE54473.1|  hypothetical protein OsJ_01577                          155   4e-39   Oryza sativa Japonica Group [Japonica rice]
gb|KDP25005.1|  hypothetical protein JCGZ_23988                         153   3e-38   
gb|EYU22280.1|  hypothetical protein MIMGU_mgv1a004461mg                152   4e-38   
ref|XP_011000788.1|  PREDICTED: organic cation/carnitine transpor...    151   2e-37   
ref|XP_011014754.1|  PREDICTED: organic cation/carnitine transpor...    150   2e-37   
emb|CDY12590.1|  BnaA02g12580D                                          147   3e-37   
ref|XP_008813162.1|  PREDICTED: organic cation/carnitine transpor...    150   3e-37   
gb|AAM67370.1|  unknown                                                 146   6e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CDO98595.1|  unnamed protein product                                148   2e-36   
ref|XP_010471381.1|  PREDICTED: organic cation/carnitine transpor...    148   2e-36   
gb|AFW88028.1|  hypothetical protein ZEAMMB73_834314                    147   2e-36   
ref|XP_010416114.1|  PREDICTED: organic cation/carnitine transpor...    147   2e-36   
ref|XP_002267247.1|  PREDICTED: organic cation/carnitine transpor...    147   3e-36   Vitis vinifera
ref|XP_010428233.1|  PREDICTED: organic cation/carnitine transpor...    147   3e-36   
emb|CDX82092.1|  BnaC02g21980D                                          147   3e-36   
ref|XP_011047773.1|  PREDICTED: organic cation/carnitine transpor...    147   4e-36   
ref|XP_006301012.1|  hypothetical protein CARUB_v10021403mg             146   6e-36   
ref|XP_007021813.1|  Organic cation/carnitine transporter 2, puta...    145   7e-36   
ref|NP_565059.2|  organic cation/carnitine transporter1                 146   7e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002318335.2|  sugar transporter family protein                   146   7e-36   Populus trichocarpa [western balsam poplar]
ref|XP_002887477.1|  sugar transporter family protein                   146   8e-36   
ref|XP_010910050.1|  PREDICTED: organic cation/carnitine transpor...    145   1e-35   
ref|XP_006374264.1|  sugar transporter family protein                   146   1e-35   
ref|XP_010694556.1|  PREDICTED: organic cation/carnitine transpor...    145   2e-35   
ref|XP_009409152.1|  PREDICTED: organic cation/carnitine transpor...    145   2e-35   
emb|CDX72965.1|  BnaC06g34130D                                          144   3e-35   
ref|XP_011072052.1|  PREDICTED: organic cation/carnitine transpor...    144   3e-35   
ref|XP_011072051.1|  PREDICTED: organic cation/carnitine transpor...    144   4e-35   
emb|CDY33334.1|  BnaC05g12490D                                          137   5e-35   
ref|XP_009105974.1|  PREDICTED: organic cation/carnitine transpor...    144   5e-35   
gb|KFK41759.1|  hypothetical protein AALP_AA2G168500                    143   9e-35   
ref|XP_003534097.1|  PREDICTED: organic cation/carnitine transpor...    142   3e-34   
ref|XP_006832993.1|  hypothetical protein AMTR_s01775p00001430          133   4e-34   
gb|AET02317.2|  organic cation/carnitine transporter, putative          140   4e-34   
ref|XP_007152580.1|  hypothetical protein PHAVU_004G142000g             140   6e-34   
ref|XP_006848005.1|  hypothetical protein AMTR_s00029p00167630          140   6e-34   
ref|XP_006390577.1|  hypothetical protein EUTSA_v10018374mg             140   9e-34   
ref|XP_006466118.1|  PREDICTED: organic cation/carnitine transpor...    139   2e-33   
emb|CDY65092.1|  BnaAnng20110D                                          139   2e-33   
ref|XP_010932380.1|  PREDICTED: organic cation/carnitine transpor...    137   4e-33   
ref|XP_009127984.1|  PREDICTED: organic cation/carnitine transpor...    138   5e-33   
ref|XP_006441384.1|  hypothetical protein CICLE_v10019486mg             136   2e-32   
emb|CDX82089.1|  BnaC02g22010D                                          133   1e-31   
ref|XP_006853447.1|  hypothetical protein AMTR_s00032p00183130          126   4e-31   
gb|KDO36826.1|  hypothetical protein CISIN_1g045196mg                   127   2e-30   
gb|KHN24524.1|  Organic cation/carnitine transporter 1                  129   3e-30   
ref|XP_003548308.1|  PREDICTED: organic cation/carnitine transpor...    129   5e-30   
ref|XP_006599714.1|  PREDICTED: organic cation/carnitine transpor...    129   6e-30   
gb|EMS52482.1|  Organic cation transporter protein                      127   2e-29   
gb|KHG00913.1|  Organic cation/carnitine transporter 1 -like protein    124   3e-29   
gb|EMT05263.1|  Organic cation transporter protein                      127   4e-29   
emb|CDY29451.1|  BnaC05g32190D                                          125   5e-29   
ref|XP_009145601.1|  PREDICTED: organic cation/carnitine transpor...    126   6e-29   
emb|CDY19617.1|  BnaA05g20250D                                          125   7e-29   
dbj|BAJ87305.1|  predicted protein                                      125   7e-29   
ref|XP_009355559.1|  PREDICTED: organic cation/carnitine transpor...    126   7e-29   
gb|EMT05261.1|  Solute carrier family 22 member 15-like protein         125   8e-29   
dbj|BAJ91383.1|  predicted protein                                      125   9e-29   
dbj|BAJ90311.1|  predicted protein                                      125   1e-28   
ref|XP_003580618.1|  PREDICTED: organic cation/carnitine transpor...    125   1e-28   
ref|XP_008365852.1|  PREDICTED: organic cation/carnitine transpor...    125   1e-28   
dbj|BAJ89186.1|  predicted protein                                      125   1e-28   
ref|XP_007021161.1|  Organic cation/carnitine transporter4 isoform 3    123   2e-28   
ref|XP_004976919.1|  PREDICTED: organic cation/carnitine transpor...    124   3e-28   
gb|EMT08705.1|  Organic cation transporter protein                      123   3e-28   
ref|XP_006360107.1|  PREDICTED: organic cation/carnitine transpor...    124   4e-28   
ref|XP_009597405.1|  PREDICTED: organic cation/carnitine transpor...    123   5e-28   
ref|XP_004244172.1|  PREDICTED: organic cation/carnitine transpor...    123   6e-28   
ref|XP_009757425.1|  PREDICTED: organic cation/carnitine transpor...    123   6e-28   
ref|XP_010060451.1|  PREDICTED: organic cation/carnitine transpor...    123   6e-28   
ref|XP_007211414.1|  hypothetical protein PRUPE_ppa003853mg             123   6e-28   
ref|XP_001766521.1|  predicted protein                                  122   7e-28   
ref|XP_004303227.1|  PREDICTED: organic cation/carnitine transpor...    123   7e-28   
gb|KCW67225.1|  hypothetical protein EUGRSUZ_F01008                     122   8e-28   
ref|XP_006360146.1|  PREDICTED: organic cation/carnitine transpor...    122   1e-27   
ref|XP_010064424.1|  PREDICTED: LOW QUALITY PROTEIN: organic cati...    122   1e-27   
ref|XP_009594672.1|  PREDICTED: organic cation/carnitine transpor...    122   1e-27   
gb|KEH30762.1|  organic cation/carnitine transporter-like protein       122   1e-27   
emb|CDP05819.1|  unnamed protein product                                122   1e-27   
ref|XP_007021159.1|  Organic cation/carnitine transporter4 isoform 1    122   1e-27   
ref|XP_011095303.1|  PREDICTED: organic cation/carnitine transpor...    122   1e-27   
ref|XP_010694345.1|  PREDICTED: organic cation/carnitine transpor...    123   1e-27   
gb|KCW67024.1|  hypothetical protein EUGRSUZ_F00783                     120   3e-27   
ref|XP_009772349.1|  PREDICTED: organic cation/carnitine transpor...    120   4e-27   
dbj|BAK03641.1|  predicted protein                                      120   4e-27   
ref|NP_001168323.1|  hypothetical protein                               120   5e-27   Zea mays [maize]
ref|XP_010267833.1|  PREDICTED: organic cation/carnitine transpor...    120   7e-27   
ref|XP_009346477.1|  PREDICTED: organic cation/carnitine transpor...    120   7e-27   
ref|XP_010908153.1|  PREDICTED: organic cation/carnitine transpor...    120   7e-27   
ref|XP_004244169.1|  PREDICTED: organic cation/carnitine transpor...    120   1e-26   
ref|XP_010694344.1|  PREDICTED: organic cation/carnitine transpor...    119   1e-26   
ref|XP_011030906.1|  PREDICTED: organic cation/carnitine transpor...    119   2e-26   
ref|XP_008452334.1|  PREDICTED: organic cation/carnitine transpor...    119   2e-26   
gb|EMT05265.1|  Solute carrier family 22 member 15-like protein         118   2e-26   
ref|XP_010519281.1|  PREDICTED: organic cation/carnitine transpor...    119   2e-26   
ref|XP_008366474.1|  PREDICTED: organic cation/carnitine transpor...    119   3e-26   
ref|NP_001053980.2|  Os04g0631100                                       117   3e-26   
gb|KDP39013.1|  hypothetical protein JCGZ_00770                         118   3e-26   
ref|XP_003596552.1|  Solute carrier family 22 member 15-like protein    117   8e-26   
ref|XP_002317556.2|  hypothetical protein POPTR_0011s13400g             115   8e-26   
ref|XP_006582228.1|  PREDICTED: organic cation/carnitine transpor...    117   8e-26   
dbj|BAJ96448.1|  predicted protein                                      116   9e-26   
ref|XP_004149938.1|  PREDICTED: organic cation/carnitine transpor...    117   9e-26   
ref|XP_006387904.1|  hypothetical protein POPTR_0489s002101g            114   9e-26   
ref|XP_004166182.1|  PREDICTED: LOW QUALITY PROTEIN: organic cati...    117   1e-25   
ref|XP_010509193.1|  PREDICTED: organic cation/carnitine transpor...    117   1e-25   
ref|XP_006851152.1|  hypothetical protein AMTR_s00043p00126560          117   1e-25   
ref|XP_002530918.1|  Organic cation transporter, putative               116   1e-25   
emb|CBI20474.3|  unnamed protein product                                116   1e-25   
gb|EMS52483.1|  Solute carrier family 22 member 15-like protein         115   1e-25   
ref|XP_006592889.1|  PREDICTED: organic cation/carnitine transpor...    116   1e-25   
gb|EAZ32093.1|  hypothetical protein OsJ_16284                          116   1e-25   
emb|CAI44640.1|  OSJNBb0015D13.11                                       116   1e-25   
ref|XP_004487632.1|  PREDICTED: organic cation/carnitine transpor...    116   2e-25   
ref|XP_010644315.1|  PREDICTED: organic cation/carnitine transpor...    116   2e-25   
ref|XP_002280309.1|  PREDICTED: organic cation/carnitine transpor...    116   2e-25   
ref|XP_008806783.1|  PREDICTED: organic cation/carnitine transpor...    116   2e-25   
ref|XP_010488054.1|  PREDICTED: organic cation/carnitine transpor...    115   2e-25   
gb|EMS63741.1|  Organic cation transporter-like protein                 115   2e-25   
ref|XP_010488051.1|  PREDICTED: organic cation/carnitine transpor...    115   3e-25   
gb|EYU19192.1|  hypothetical protein MIMGU_mgv1a021132mg                115   3e-25   
ref|XP_009385063.1|  PREDICTED: organic cation/carnitine transpor...    115   4e-25   
ref|XP_010466268.1|  PREDICTED: organic cation/carnitine transpor...    115   5e-25   
ref|XP_006653799.1|  PREDICTED: organic cation/carnitine transpor...    114   5e-25   
ref|XP_006406361.1|  hypothetical protein EUTSA_v10022015mg             114   8e-25   
emb|CAH68069.1|  H0105C05.5                                             114   9e-25   
gb|KHN36750.1|  Organic cation/carnitine transporter 4                  113   9e-25   
gb|AFK44509.1|  unknown                                                 113   1e-24   
ref|XP_004487741.1|  PREDICTED: organic cation/carnitine transpor...    113   1e-24   
ref|XP_006594802.1|  PREDICTED: organic cation/carnitine transpor...    113   2e-24   
ref|XP_010931868.1|  PREDICTED: organic cation/carnitine transpor...    113   2e-24   
ref|XP_010042471.1|  PREDICTED: organic cation/carnitine transpor...    111   3e-24   
gb|KCW67232.1|  hypothetical protein EUGRSUZ_F01018                     110   4e-24   
ref|XP_006592522.1|  PREDICTED: organic cation/carnitine transpor...    112   4e-24   
ref|NP_188702.2|  organic cation/carnitine transporter4                 112   6e-24   
gb|KFK39382.1|  solute carrier family 22 member 15-like                 111   8e-24   
gb|EMT21221.1|  Solute carrier family 22 member 15-like protein         111   1e-23   
ref|XP_002447163.1|  hypothetical protein SORBIDRAFT_06g029640          110   2e-23   
gb|EPS59899.1|  hypothetical protein M569_14905                         109   3e-23   
ref|XP_010826723.1|  PREDICTED: solute carrier family 22 member 5       109   4e-23   
ref|XP_007133031.1|  hypothetical protein PHAVU_011G145400g             110   4e-23   
ref|XP_005682735.1|  PREDICTED: solute carrier family 22 member 5       108   5e-23   
ref|XP_004920385.1|  PREDICTED: solute carrier family 22 member 5...    108   5e-23   
ref|NP_001039967.1|  solute carrier family 22 member 5                  109   6e-23   
ref|XP_005888429.1|  PREDICTED: solute carrier family 22 member 5       109   7e-23   
gb|ELR61786.1|  Solute carrier family 22 member 5                       109   7e-23   
ref|XP_006046112.1|  PREDICTED: solute carrier family 22 member 5       108   8e-23   
ref|XP_006212916.1|  PREDICTED: solute carrier family 22 member 5       108   9e-23   
ref|XP_006360147.1|  PREDICTED: organic cation/carnitine transpor...    108   1e-22   
gb|ELU07976.1|  hypothetical protein CAPTEDRAFT_127727                  107   1e-22   
ref|XP_002934410.1|  PREDICTED: solute carrier family 22 member 5       108   2e-22   
ref|XP_005626575.1|  PREDICTED: solute carrier family 22 member 5...    108   2e-22   
gb|KCW67056.1|  hypothetical protein EUGRSUZ_F00829                     105   2e-22   
ref|XP_003730263.1|  PREDICTED: solute carrier family 22 member 1...    107   2e-22   
ref|XP_002885393.1|  carbohydrate transporter/ sugar porter             107   2e-22   
gb|ELV11439.1|  Solute carrier family 22 member 5                       106   2e-22   
ref|XP_004009430.1|  PREDICTED: solute carrier family 22 member 5       107   2e-22   
gb|ABN09065.1|  General substrate transporter                           105   3e-22   
ref|XP_010064353.1|  PREDICTED: organic cation/carnitine transpor...    105   3e-22   
ref|XP_006166984.1|  PREDICTED: solute carrier family 22 member 5       106   3e-22   
ref|XP_003596554.1|  Solute carrier family 22 member 15-like protein    105   3e-22   
ref|XP_008663632.1|  PREDICTED: organic cation/carnitine transpor...    107   3e-22   
ref|XP_004686566.1|  PREDICTED: solute carrier family 22 member 5       107   3e-22   
ref|XP_007437532.1|  PREDICTED: solute carrier family 22 member 5       105   5e-22   
ref|XP_006872985.1|  PREDICTED: solute carrier family 22 member 5       106   5e-22   
ref|XP_006184169.1|  PREDICTED: solute carrier family 22 member 5       106   5e-22   
ref|NP_001080898.1|  solute carrier family 22 (organic cation/car...    106   6e-22   
gb|EPY81665.1|  solute carrier family 22 member 5                       106   6e-22   
ref|XP_010969887.1|  PREDICTED: solute carrier family 22 member 5       106   7e-22   
ref|XP_005979373.1|  PREDICTED: solute carrier family 22 member 5       105   7e-22   
ref|XP_008689965.1|  PREDICTED: solute carrier family 22 member 5       105   8e-22   
ref|XP_010979568.1|  PREDICTED: solute carrier family 22 member 5       105   8e-22   
gb|KFQ41280.1|  Solute carrier family 22 member 5                       104   9e-22   
emb|CDX79316.1|  BnaC06g19870D                                          100   1e-21   
ref|XP_007087877.1|  PREDICTED: solute carrier family 22 member 5       104   1e-21   
gb|KFU92298.1|  Solute carrier family 22 member 5                       103   1e-21   
ref|XP_006475283.1|  PREDICTED: organic cation/carnitine transpor...    104   2e-21   
ref|XP_006452127.1|  hypothetical protein CICLE_v10007977mg             104   2e-21   
ref|XP_860734.1|  PREDICTED: solute carrier family 22 member 5 is...    105   2e-21   
ref|XP_006927754.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...    104   2e-21   
ref|XP_009999539.1|  PREDICTED: solute carrier family 22 member 5...    103   2e-21   
ref|XP_010092281.1|  Organic cation/carnitine transporter 4             104   2e-21   
gb|ACE77685.1|  solute carrier family 22, member 5 (predicted)          104   2e-21   
ref|XP_004610019.1|  PREDICTED: solute carrier family 22 member 5       104   2e-21   
ref|XP_007941928.1|  PREDICTED: solute carrier family 22 member 5       104   3e-21   
ref|XP_009950584.1|  PREDICTED: solute carrier family 22 member 5...    103   3e-21   
ref|XP_008847569.1|  PREDICTED: solute carrier family 22 member 5...    103   3e-21   
ref|XP_008052852.1|  PREDICTED: solute carrier family 22 member 5       104   3e-21   
ref|XP_004279943.1|  PREDICTED: solute carrier family 22 member 5       104   3e-21   
ref|XP_010017903.1|  PREDICTED: solute carrier family 22 member 5...    103   3e-21   
gb|KFQ12418.1|  Solute carrier family 22 member 5                       102   3e-21   
ref|XP_005147336.1|  PREDICTED: solute carrier family 22 member 5       104   3e-21   
ref|XP_004326818.1|  PREDICTED: solute carrier family 22 member 5       104   3e-21   
ref|XP_007110775.1|  PREDICTED: solute carrier family 22 member 5       103   4e-21   
ref|XP_002912941.1|  PREDICTED: solute carrier family 22 member 5...    103   4e-21   
ref|XP_008948455.1|  PREDICTED: solute carrier family 22 member 5...    101   4e-21   
ref|XP_008591564.1|  PREDICTED: solute carrier family 22 member 5       103   4e-21   
ref|XP_010358303.1|  PREDICTED: solute carrier family 22 member 5...    101   6e-21   
ref|XP_009895209.1|  PREDICTED: solute carrier family 22 member 5...    101   6e-21   
ref|XP_006297422.1|  hypothetical protein CARUB_v10013447mg             103   6e-21   
ref|XP_010183211.1|  PREDICTED: solute carrier family 22 member 5...    100   7e-21   
gb|KFQ24619.1|  Solute carrier family 22 member 5                       101   7e-21   
gb|KFP81446.1|  Solute carrier family 22 member 5                       101   7e-21   
ref|XP_004802729.1|  PREDICTED: solute carrier family 22 member 5       103   8e-21   
ref|XP_004745064.1|  PREDICTED: solute carrier family 22 member 5       103   8e-21   
gb|KFR08175.1|  Solute carrier family 22 member 5                       101   9e-21   
ref|XP_007461393.1|  PREDICTED: solute carrier family 22 member 5       102   1e-20   
ref|XP_001917996.1|  PREDICTED: solute carrier family 22 member 5       102   1e-20   
gb|KFW66196.1|  Solute carrier family 22 member 5                       101   1e-20   
ref|XP_009074369.1|  PREDICTED: solute carrier family 22 member 5...    101   1e-20   
ref|XP_007188611.1|  PREDICTED: solute carrier family 22 member 5       102   1e-20   
ref|XP_008806791.1|  PREDICTED: organic cation/carnitine transpor...    102   1e-20   
ref|XP_008454578.1|  PREDICTED: organic cation/carnitine transpor...    102   1e-20   
ref|XP_006923216.1|  PREDICTED: solute carrier family 22 member 5       102   1e-20   
ref|XP_009930723.1|  PREDICTED: solute carrier family 22 member 5       101   1e-20   
gb|KFO15379.1|  Solute carrier family 22 member 5                       100   2e-20   
ref|XP_003123960.1|  PREDICTED: solute carrier family 22 member 5       102   2e-20   
gb|KFQ86738.1|  Solute carrier family 22 member 5                       100   2e-20   
ref|XP_009462666.1|  PREDICTED: solute carrier family 22 member 5...    100   2e-20   
ref|XP_009321056.1|  PREDICTED: solute carrier family 22 member 5       101   2e-20   
ref|XP_004880003.1|  PREDICTED: solute carrier family 22 member 5       101   2e-20   
ref|NP_001079621.1|  solute carrier family 22 member 15-like            101   2e-20   
gb|KFQ96392.1|  Solute carrier family 22 member 5                       100   2e-20   
ref|XP_001103789.1|  PREDICTED: solute carrier family 22 member 5...    102   2e-20   
ref|XP_010358302.1|  PREDICTED: solute carrier family 22 member 5...    102   2e-20   
ref|XP_005557779.1|  PREDICTED: solute carrier family 22 member 5       101   2e-20   
ref|XP_009575706.1|  PREDICTED: solute carrier family 22 member 5...    100   2e-20   
ref|XP_004152034.1|  PREDICTED: organic cation/carnitine transpor...    101   2e-20   
ref|XP_008012563.1|  PREDICTED: solute carrier family 22 member 5       101   2e-20   
ref|XP_008253215.1|  PREDICTED: solute carrier family 22 member 5       101   2e-20   
gb|KFV64623.1|  Solute carrier family 22 member 5                       100   2e-20   
gb|KFW04584.1|  Solute carrier family 22 member 5                       100   2e-20   
ref|XP_007668008.1|  PREDICTED: solute carrier family 22 member 5...    101   2e-20   
ref|NP_001162227.1|  solute carrier family 22 member 5                  101   2e-20   
gb|KFO54010.1|  Solute carrier family 22 member 5                       100   2e-20   
ref|XP_005523541.1|  PREDICTED: solute carrier family 22 member 5       101   2e-20   
ref|XP_004175461.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...    101   3e-20   
ref|XP_006714739.1|  PREDICTED: solute carrier family 22 member 5...  99.4    3e-20   
ref|XP_010309793.1|  PREDICTED: solute carrier family 22 member 5...    100   3e-20   
ref|XP_008173848.1|  PREDICTED: solute carrier family 22 member 4       100   3e-20   
gb|KFM12101.1|  Solute carrier family 22 member 5                       100   3e-20   
ref|XP_002804555.1|  PREDICTED: solute carrier family 22 member 5       101   3e-20   
ref|XP_003782259.1|  PREDICTED: solute carrier family 22 member 5       101   3e-20   
ref|XP_004836673.1|  PREDICTED: solute carrier family 22 member 5...    101   3e-20   
gb|ACB21281.1|  solute carrier family 22 member 5 (predicted)           101   3e-20   
ref|XP_005335836.1|  PREDICTED: solute carrier family 22 member 5       101   3e-20   
gb|EHH54502.1|  hypothetical protein EGM_15362                          101   3e-20   
ref|XP_009817028.1|  PREDICTED: solute carrier family 22 member 5...    100   3e-20   
gb|KFV90583.1|  Solute carrier family 22 member 5                       100   3e-20   
gb|KFV59308.1|  Solute carrier family 22 member 5                       100   3e-20   
gb|KFP42220.1|  Solute carrier family 22 member 5                       100   3e-20   
ref|XP_008641659.1|  PREDICTED: solute carrier family 22 member 5...    100   3e-20   
gb|KFP81951.1|  Solute carrier family 22 member 5                       100   4e-20   
ref|XP_004384800.1|  PREDICTED: solute carrier family 22 member 5       100   4e-20   
ref|XP_009645493.1|  PREDICTED: solute carrier family 22 member 5...  99.8    4e-20   
ref|XP_009927528.1|  PREDICTED: solute carrier family 22 member 5...  99.8    4e-20   
gb|KFP10127.1|  Solute carrier family 22 member 5                     99.8    5e-20   
ref|XP_003971054.1|  PREDICTED: solute carrier family 22 member 5...    100   5e-20   
ref|XP_010159039.1|  PREDICTED: solute carrier family 22 member 5...  99.8    5e-20   
gb|KFO54011.1|  Solute carrier family 22 member 4                     99.0    5e-20   
gb|KFP95942.1|  Solute carrier family 22 member 5                     99.4    5e-20   
ref|XP_003920666.1|  PREDICTED: solute carrier family 22 member 5       100   5e-20   
ref|XP_009239306.1|  PREDICTED: solute carrier family 22 member 5       100   5e-20   
ref|XP_008641660.1|  PREDICTED: solute carrier family 22 member 4     99.4    6e-20   
ref|XP_005440792.1|  PREDICTED: solute carrier family 22 member 5     99.8    6e-20   
ref|XP_003512258.1|  PREDICTED: solute carrier family 22 member 5...    100   6e-20   
gb|KFP55053.1|  Solute carrier family 22 member 5                     99.4    6e-20   
ref|XP_006995963.1|  PREDICTED: solute carrier family 22 member 5...    100   6e-20   
gb|KFV60286.1|  Solute carrier family 22 member 5                     99.4    6e-20   
ref|XP_009875550.1|  PREDICTED: solute carrier family 22 member 5...  99.8    6e-20   
ref|XP_010411414.1|  PREDICTED: solute carrier family 22 member 5...    100   6e-20   
ref|XP_009972573.1|  PREDICTED: solute carrier family 22 member 5...  99.4    6e-20   
ref|XP_002307985.1|  hypothetical protein POPTR_0006s04050g           94.4    6e-20   
ref|XP_010119293.1|  PREDICTED: solute carrier family 22 member 5...  99.8    7e-20   
ref|XP_008493686.1|  PREDICTED: solute carrier family 22 member 5...    100   7e-20   
dbj|BAD92721.1|  solute carrier family 22 member 5 variant            99.4    7e-20   
gb|KFW91136.1|  Solute carrier family 22 member 5                     99.0    7e-20   
ref|XP_010030287.1|  PREDICTED: organic cation/carnitine transpor...  95.9    7e-20   
ref|XP_007623695.1|  PREDICTED: solute carrier family 22 member 5...    100   7e-20   
ref|XP_005483813.1|  PREDICTED: solute carrier family 22 member 4     99.4    8e-20   
ref|XP_008920971.1|  PREDICTED: solute carrier family 22 member 5...  99.0    8e-20   
ref|XP_010293656.1|  PREDICTED: solute carrier family 22 member 5...  99.0    8e-20   
gb|KFQ83225.1|  Solute carrier family 22 member 5                     99.0    8e-20   
ref|XP_003464581.1|  PREDICTED: solute carrier family 22 member 5       100   8e-20   
gb|KFP65320.1|  Solute carrier family 22 member 5                     99.0    8e-20   
ref|XP_004420274.1|  PREDICTED: solute carrier family 22 member 5       100   9e-20   
gb|EOA93464.1|  Solute carrier family 22 member 5                     99.8    1e-19   
ref|XP_005030763.1|  PREDICTED: solute carrier family 22 member 5     99.8    1e-19   
ref|XP_006734751.1|  PREDICTED: solute carrier family 22 member 5     99.8    1e-19   
ref|XP_009699039.1|  PREDICTED: solute carrier family 22 member 5...  99.0    1e-19   
gb|KFW79980.1|  Solute carrier family 22 member 5                     98.6    1e-19   
ref|XP_005418905.1|  PREDICTED: solute carrier family 22 member 5     99.0    1e-19   
ref|XP_005483631.1|  PREDICTED: solute carrier family 22 member 5     99.8    1e-19   
ref|XP_003512257.1|  PREDICTED: solute carrier family 22 member 2...  99.8    1e-19   
ref|XP_003259985.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...  99.8    1e-19   
ref|XP_003217437.2|  PREDICTED: solute carrier family 22 member 5...  99.8    1e-19   
ref|XP_008102939.1|  PREDICTED: solute carrier family 22 member 5...  99.8    1e-19   
ref|XP_008226799.1|  PREDICTED: LOW QUALITY PROTEIN: organic cati...  99.4    1e-19   
ref|XP_005242867.1|  PREDICTED: solute carrier family 22 member 5     99.0    1e-19   
ref|XP_006532715.1|  PREDICTED: solute carrier family 22 member 5...  96.7    1e-19   
gb|EAW62339.1|  solute carrier family 22 (organic cation transpor...  99.4    1e-19   
ref|XP_008989619.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...  99.4    1e-19   
ref|XP_008952968.1|  PREDICTED: solute carrier family 22 member 5     99.0    2e-19   
ref|XP_004042517.1|  PREDICTED: solute carrier family 22 member 5...  99.4    2e-19   
ref|XP_010167283.1|  PREDICTED: solute carrier family 22 member 5...  98.2    2e-19   
ref|NP_003051.1|  solute carrier family 22 member 5                   99.0    2e-19   
gb|AAH12325.1|  Solute carrier family 22 (organic cation/carnitin...  99.0    2e-19   
ref|XP_009089883.1|  PREDICTED: solute carrier family 22 member 5...  99.0    2e-19   
ref|XP_005923135.1|  PREDICTED: solute carrier family 22 member 5...  99.0    2e-19   
ref|XP_004561796.1|  PREDICTED: solute carrier family 22 member 5...  99.0    2e-19   
gb|KFZ59246.1|  Solute carrier family 22 member 5                     98.2    2e-19   
ref|XP_005418906.1|  PREDICTED: solute carrier family 22 member 4     98.2    2e-19   
ref|XP_005272112.1|  PREDICTED: solute carrier family 22 member 5...  99.0    2e-19   



>ref|XP_009627799.1| PREDICTED: organic cation/carnitine transporter 3-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/282 (55%), Positives = 216/282 (77%), Gaps = 1/282 (0%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            S+WR LYL+T +P I+YS++V+   RESPRWLYLRG  ++FV T+K++    +  +++  
Sbjct  188  STWRVLYLWTCLPTILYSILVHFFVRESPRWLYLRGNKEEFVLTLKSITT-RSSLTLSFF  246

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
              F D +DQ   + +  + LYSA+K+L+ K WA +RL++VM +  G+GLVYYG+PLGVG 
Sbjct  247  GSFIDFEDQEHNNSESTISLYSAIKMLVEKNWAFKRLISVMLIGFGVGLVYYGMPLGVGN  306

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +PFNLY S TLNA+SELPAS+VT  LI KL R+ +++G  +LSG+C++GC +      K 
Sbjct  307  LPFNLYFSVTLNALSELPASMVTFFLIGKLTRKKSLLGFAILSGICSIGCAIVKDNSFKE  366

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +Q+G E+V+FF+ACT+FN+LLIYT+ELFPTCVRNSAV+M RQA+V+GGA SP+LVA GR 
Sbjct  367  LQMGFELVSFFSACTSFNVLLIYTVELFPTCVRNSAVSMVRQALVLGGAFSPILVAFGRN  426

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            NR++SYGVFG++  +C LF++ LPET G  L DT+DEEE KE
Sbjct  427  NRWFSYGVFGMSIGICGLFVLCLPETKGRTLSDTMDEEEYKE  468



>ref|XP_009782422.1| PREDICTED: organic cation/carnitine transporter 3-like [Nicotiana 
sylvestris]
Length=473

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/281 (55%), Positives = 218/281 (78%), Gaps = 1/281 (0%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LYL+T IP I+YS++V+   RESPRWLY+RG  ++FV T+K++    +  +++   
Sbjct  189  SWRVLYLWTCIPTILYSILVHFFVRESPRWLYVRGNKEEFVLTLKSITT-RSSLTLSFFG  247

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
             F D +DQ   + +  ++LYSA+K+L+ K WA +RL++VM +  G+GLVYYG+PLGVG +
Sbjct  248  SFIDFEDQEHNNSESTINLYSAIKMLVEKNWAFKRLISVMLIGFGVGLVYYGMPLGVGNL  307

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV  547
            PFNLYLS TLNA+SELPAS+VT  LI KL R+ +++G  +LSG+C++GC +     LK +
Sbjct  308  PFNLYLSVTLNALSELPASMVTFFLIGKLTRKKSLLGFAILSGICSIGCAIVKDNSLKEL  367

Query  548  QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGN  727
            Q+G E+V+FF+ACT+FN+LLIYT+ELFPTCVRNSAV+M RQ++V+GGA SP+LVA GR N
Sbjct  368  QMGFELVSFFSACTSFNVLLIYTVELFPTCVRNSAVSMVRQSLVLGGAFSPILVAFGRKN  427

Query  728  RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            R++SYGVFG++  +C LF++ LPET G  L DT+D+EE KE
Sbjct  428  RWFSYGVFGMSIGICGLFVLCLPETKGRTLSDTMDDEEYKE  468



>ref|XP_004239844.1| PREDICTED: organic cation/carnitine transporter 3-like [Solanum 
lycopersicum]
Length=479

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/285 (54%), Positives = 214/285 (75%), Gaps = 2/285 (1%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrs--sit  178
            SSWR +YL+T IP I+YS++V+ +  ESPRWLY+RG  ++FV T+K++    + +     
Sbjct  191  SSWRVMYLWTCIPTILYSILVHFLVCESPRWLYVRGNKEEFVSTLKSITTRSSLTLSFFG  250

Query  179  rttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGV  358
                F D +     +    ++LYSA+K+LI + WA RRL++VM V  GIG+VYYG+PLGV
Sbjct  251  SFFEFEDQEHDNKSNESSTINLYSAIKMLIERNWAFRRLISVMLVGFGIGMVYYGMPLGV  310

Query  359  GEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
            G +PFNLYLS TLNA+SELPAS+VT  LI KL R+ +++   +LSG+C++GCVV   ++ 
Sbjct  311  GNLPFNLYLSVTLNALSELPASIVTFFLIGKLTRKKSLLAFAMLSGICSIGCVVVQNDDF  370

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
            K +Q+G E+++FF+ACT FN+LLIYT+ELFPTCVRNSAV+M RQA+V+GGAISP+LVA G
Sbjct  371  KVLQMGFELLSFFSACTGFNVLLIYTVELFPTCVRNSAVSMVRQALVLGGAISPMLVAFG  430

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            R NR++SYGVFG+   +C LF++ LPET G  L DT+DEEE  E+
Sbjct  431  RKNRWFSYGVFGICIAICGLFVLCLPETKGRTLSDTMDEEEYNES  475



>ref|XP_011014246.1| PREDICTED: organic cation/carnitine transporter 3-like [Populus 
euphratica]
Length=511

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 155/286 (54%), Positives = 204/286 (71%), Gaps = 7/286 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LYL+T +P I YS++V+ + RESPRWL++RG  ++ V  +K++A       +  
Sbjct  227  GSSWRTLYLWTSVPTIFYSMLVHFLVRESPRWLFVRGRKEEAVTILKSIATAGGSGILMS  286

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                  N D G       +D YSA+K+L+ K WA RRLLTVM V  GIG+VYYG+PLG+G
Sbjct  287  F----SNLDFG--KEAWNVDTYSAIKILLKKKWACRRLLTVMAVVFGIGMVYYGMPLGLG  340

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLYLS T NA+SELPASLVT  L+DKL R+ +++    LSGVC++  V  +GE   
Sbjct  341  NLSFNLYLSVTFNALSELPASLVTFFLVDKLNRKDSLLVFTTLSGVCSILSVA-MGETSA  399

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             +Q+GLE+V+FF+ACTAFNI LIYTLELFPTCVRNSA++MARQ++V GG  SP+LVA+G 
Sbjct  400  NLQMGLELVSFFSACTAFNISLIYTLELFPTCVRNSAISMARQSLVFGGMFSPVLVAVGS  459

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGN  859
             NRF SYG+FG+   +C LF++ LPET G  +CDT+DEEE     N
Sbjct  460  KNRFLSYGIFGMVIGICGLFVICLPETRGRTICDTMDEEEYNSTNN  505



>ref|XP_002315082.2| organic cation transporter-related family protein [Populus trichocarpa]
 gb|EEF01253.2| organic cation transporter-related family protein [Populus trichocarpa]
Length=511

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 205/286 (72%), Gaps = 7/286 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LYL+T +P I YS++V+ + RESPRWL++RG  ++ V  +K++A   +   +  
Sbjct  227  GSSWRTLYLWTSVPTIFYSILVHFLVRESPRWLFVRGRKEEAVTILKSIATAGSSGILMS  286

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             +     ++         +D YSA+K+L+ K WA RRLLTVM V  GIG+VYYG+PLG+G
Sbjct  287  FSNLEFGKESW------NVDTYSAIKILLKKKWACRRLLTVMAVVFGIGMVYYGMPLGLG  340

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLYLS T NA+SELPASLVT  L+DKL R+ +++    LSGVC++  VV +GE   
Sbjct  341  NLSFNLYLSVTFNALSELPASLVTFFLVDKLNRKDSLLVFTTLSGVCSILSVV-MGETSA  399

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             +Q+GLE+V+FF ACTAFNI LI+TLELFPTCVRNSA++MARQ++V GG  SP+LVA+G 
Sbjct  400  NLQMGLELVSFFCACTAFNISLIHTLELFPTCVRNSAISMARQSLVFGGMFSPVLVAVGS  459

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGN  859
             NRF SYG+FG+   +C LF++ LPET G  +CDT+DEEE     N
Sbjct  460  KNRFLSYGIFGMVIGICGLFVIFLPETRGRTICDTMDEEEYNSTNN  505



>ref|XP_004252143.1| PREDICTED: organic cation/carnitine transporter 3-like [Solanum 
lycopersicum]
Length=523

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 158/291 (54%), Positives = 215/291 (74%), Gaps = 17/291 (6%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWR LYL T  P ++YS++VY+   ESPRWLYLRG  ++FV+T++ +A          
Sbjct  227  GNSWRVLYLLTCFPVVLYSMVVYIFVHESPRWLYLRGHKEEFVKTLRRIAN------RGT  280

Query  182  ttiFSDNQDQGL-IDLDEQM---------DLYSALKLLINKGWALRRLLTVMWVALGIGL  331
                S +  +GL +DL++ M         D+YSA++LL+ +GW LRRL+TV+ +  G+G+
Sbjct  281  RGKLSSSFFEGLFVDLEKAMFVSASRGDLDVYSAIRLLVERGWCLRRLMTVVLIGFGVGM  340

Query  332  VYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlg  511
            VYYG+PLGVG++ F++YLS TLNA+SELP+SL+   LI K+ R+ +++G  +LSG+C++G
Sbjct  341  VYYGMPLGVGDLGFDIYLSITLNAISELPSSLIAFFLIGKMNRKGSLLGFSLLSGICSVG  400

Query  512  cvvFVGEE-LKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGG  688
            C +  G E LK  Q+GLE+V+FF ACTAFN+LLIYTLELFPTCVRN AV+MARQ++VVGG
Sbjct  401  CALVEGSEGLKWFQMGLEMVSFFGACTAFNVLLIYTLELFPTCVRNCAVSMARQSLVVGG  460

Query  689  AISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEE  841
            A+SP+LVALGR N  +SYGVFG+ S    LF V LPET G  LCDT+DEEE
Sbjct  461  ALSPILVALGRNNSLFSYGVFGVCSATFGLFTVWLPETKGRLLCDTMDEEE  511



>ref|XP_006422298.1| hypothetical protein CICLE_v10004786mg [Citrus clementina]
 ref|XP_006493743.1| PREDICTED: organic cation/carnitine transporter 3-like [Citrus 
sinensis]
 gb|ESR35538.1| hypothetical protein CICLE_v10004786mg [Citrus clementina]
 gb|KDO61526.1| hypothetical protein CISIN_1g040646mg [Citrus sinensis]
Length=509

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 156/293 (53%), Positives = 210/293 (72%), Gaps = 22/293 (8%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR +YL+T IP I+Y ++V  + RESPRWL+++G  ++ V  IK+++          
Sbjct  222  GSSWRRIYLYTSIPTILYCILVRFLVRESPRWLFIQGRKEEAVSIIKSIST---------  272

Query  182  ttiFSDNQDQGLIDLDE--------QMDLYSALKLLINKGWALRRLLTVMWVALGIGLVY  337
                S+NQ   ++D +          +DLYSA+K+L+ K WALRRL  +M    GIG+VY
Sbjct  273  ----SENQRSLIMDFNNVSFEQETWNVDLYSAIKILVEKKWALRRLSAIMVTGFGIGMVY  328

Query  338  YGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcv  517
            YG+PLG+G + FNLYLS T NA+SELPASL+T  LI KL+R+S+++G  ++SGVC++ CV
Sbjct  329  YGMPLGLGSLSFNLYLSVTFNALSELPASLITFFLIGKLKRKSSLLGFTIMSGVCSVLCV  388

Query  518  vFVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAIS  697
            V +G+   +V+IGLE+VAFF+ACTAF++LLIYTLELFPTCVRNSA++M RQA+V GG  S
Sbjct  389  V-MGKIWTSVEIGLELVAFFSACTAFSLLLIYTLELFPTCVRNSAISMVRQALVFGGVFS  447

Query  698  PLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            P+LVA GR N F SYG+FGL   LC LF++ LPET    L DT+DEEE KE  
Sbjct  448  PVLVAAGRQNNFLSYGIFGLVIGLCGLFVIGLPETRDTQLSDTMDEEEYKERA  500



>ref|XP_011014256.1| PREDICTED: organic cation/carnitine transporter 3-like [Populus 
euphratica]
Length=511

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/286 (55%), Positives = 206/286 (72%), Gaps = 7/286 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LYL+T +P I YS++V+ + RESPRWL++RG  ++ V  +K++A   T  S   
Sbjct  227  GSSWRTLYLWTSVPTIFYSMLVHFLVRESPRWLFVRGRKEEAVTILKSIA---TAGSSGI  283

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
               FS N D G       +D YSA+K+L+ K WA RRLLTVM    GIG+VYYG+PLG+G
Sbjct  284  LMSFS-NLDFG--KESWNVDTYSAIKILLKKKWACRRLLTVMAGVFGIGMVYYGMPLGLG  340

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLYLS T NA+SELPASLVT  L+DKL R+ +++    LSGVC++  VV +GE   
Sbjct  341  NLSFNLYLSATFNALSELPASLVTFFLVDKLNRKDSLLVFTTLSGVCSILSVV-MGETSA  399

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             +Q+GLE+V+FF+ACTAFNI LI+TLELFPTCVRNSA++MARQ++V GG  SP+LVA+G 
Sbjct  400  NLQMGLELVSFFSACTAFNISLIHTLELFPTCVRNSAISMARQSLVFGGMFSPVLVAVGS  459

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGN  859
             NR  SYG+FG+   +C LF++ LPET G  +CDT+DEEE     N
Sbjct  460  KNRLLSYGIFGMVIGICGLFVICLPETRGRTICDTMDEEEYNSTNN  505



>ref|XP_010260769.1| PREDICTED: organic cation/carnitine transporter 3-like [Nelumbo 
nucifera]
Length=523

 Score =   285 bits (730),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 157/284 (55%), Positives = 207/284 (73%), Gaps = 9/284 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LYL+T +P I Y +I++   RESPRWL ++G   + +ET++T+     +SS   +
Sbjct  237  SSWRTLYLWTSVPAIFYCIIIHFAVRESPRWLLVKGRKDEAIETLRTITT-RNQSSFRLS  295

Query  185  tiFSDNQDQGLIDLDEQMD--LYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGV  358
              FS     G+  + E  D  LYSA+K L+ K WA RRL+ VM V  GIG+VYYG+PLGV
Sbjct  296  VSFS-----GISIVPETFDGNLYSAIKALVEKKWAFRRLMAVMTVGFGIGMVYYGMPLGV  350

Query  359  GEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
            G + FNLYLS T NA+SELP+SL+T  LI KL RRS+++   ++SG+C++ CVV VGE  
Sbjct  351  GNLAFNLYLSVTFNALSELPSSLLTFFLIGKLNRRSSLLVFTIISGICSIMCVV-VGESR  409

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
            + +Q+ +E+V+FF+ACTAF++LLIYTLELFPTCVRNSA++M RQA+V GG  SP+LVA G
Sbjct  410  QVLQVAVELVSFFSACTAFSVLLIYTLELFPTCVRNSALSMVRQALVFGGVFSPVLVAAG  469

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            R + F SYGVFGL    C LF+V LPET GG LCDT+DE+E KE
Sbjct  470  RKDGFLSYGVFGLVIGCCGLFVVCLPETRGGTLCDTMDEQEYKE  513



>ref|XP_010537821.1| PREDICTED: organic cation/carnitine transporter 3 [Tarenaya hassleriana]
Length=545

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 152/288 (53%), Positives = 205/288 (71%), Gaps = 10/288 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G SWR LYL+T IP I+Y  +V++  RESPRWL ++G  ++ V  ++++A P  R+    
Sbjct  244  GRSWRVLYLWTSIPTIVYCFLVWIFVRESPRWLLVKGRKEEAVSILRSIAAPTDRNGGLV  303

Query  182  ttiFSD---NQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPL  352
            T  FS+    Q++G       +D+Y+A+K L+ K W+LRRL  VM V  GIG+VYYG+PL
Sbjct  304  TMSFSNLPFEQEEG-----SNLDVYAAMKSLVQKKWSLRRLSAVMAVGFGIGVVYYGMPL  358

Query  353  GVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGE  532
             +  + FNLYL  TLNA+SELPASL+T   IDKL RR+ ++G   LSG+ ++  VV    
Sbjct  359  ALTNLNFNLYLGVTLNALSELPASLITFFFIDKLSRRNALIGFTALSGISSILIVVLDHF  418

Query  533  ELKA--VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
            ++    +QI LE+V+FF+AC+AFN+ LIYT+ELFPTCVRNSA+AM RQA+V+GG  SP++
Sbjct  419  DISHGLLQIVLELVSFFSACSAFNMELIYTIELFPTCVRNSAIAMVRQALVLGGVFSPVM  478

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            VA GR N F+SYG+FGLA  L  LF+V LPET G  LCDT+DEEESKE
Sbjct  479  VAAGRDNHFWSYGLFGLAIGLFGLFVVGLPETRGSVLCDTMDEEESKE  526



>ref|XP_011095828.1| PREDICTED: organic cation/carnitine transporter 3-like [Sesamum 
indicum]
Length=526

 Score =   277 bits (709),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 156/284 (55%), Positives = 216/284 (76%), Gaps = 7/284 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR +YL+T +P ++YS+ V+ + RESPRWL+++G  ++F ET++++A P  RSS+T+
Sbjct  240  GSSWRLIYLWTCVPSVLYSIAVFFLVRESPRWLFIKGRKEEFAETLRSIAAPSNRSSLTQ  299

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            +  F    D G  +  ++ D++SALK+L+ KGW+ RRL+ VM V  GIG++YYG+PLG+G
Sbjct  300  SF-FGRCADWG--EKKQEADVFSALKILVEKGWSCRRLVAVMVVGFGIGIIYYGMPLGLG  356

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + F+LYLS TLNA+SE PASL+T LLI KL R+ +V+GL + SGVC++ C   V    K
Sbjct  357  NLSFDLYLSVTLNALSEFPASLLTFLLIGKLDRKGSVLGLSLFSGVCSVCC---VLVRWK  413

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             +QI LE+++FF+ACTAF+I+LIYT+ELFPTCVRNSAVAM RQA+V+GGA+SP+LVA GR
Sbjct  414  VLQIILELMSFFSACTAFDIVLIYTIELFPTCVRNSAVAMVRQALVLGGALSPVLVAAGR  473

Query  722  GNR-FYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             N    SYGVFG+   +C LF+V LPET G  L DT++EEE K 
Sbjct  474  TNGLLMSYGVFGVTISICGLFVVCLPETRGRVLSDTMEEEERKN  517



>ref|XP_007022787.1| Organic cation/carnitine transporter 3 [Theobroma cacao]
 gb|EOY14312.1| Organic cation/carnitine transporter 3 [Theobroma cacao]
Length=580

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 198/283 (70%), Gaps = 7/283 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LYL+  +P I Y ++V  +  ESPRWL++RG  ++ V T+K+MA          
Sbjct  288  GSSWRTLYLWISVPTIFYCILVRFLVHESPRWLFVRGRKEEAVSTLKSMAQANQSILTMS  347

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             +      +         +DLYS +K+L+NK WA RRL  VM    GIG+VYYG+PLG+G
Sbjct  348  FSNVPIEPE------SWNVDLYSTVKILLNKRWAFRRLAAVMIAGFGIGMVYYGMPLGLG  401

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+YLS T NA+SELP+SL+T  L+ KL RR +++G  VLSG+C++ CVV +G+   
Sbjct  402  NLSFNIYLSVTFNALSELPSSLITFFLMGKLNRRGSLLGFTVLSGICSVLCVV-IGQVWP  460

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             +QIGLE+V+FF+ACTAFN+ LIYTLELFPTCVRNSA+++ RQA+V GG  SP+LVA GR
Sbjct  461  GLQIGLELVSFFSACTAFNVELIYTLELFPTCVRNSAISIVRQALVFGGVFSPVLVAAGR  520

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             N F SYGVFGLA   C L ++ LPET G  +CDT+DEEE KE
Sbjct  521  KNGFLSYGVFGLAIGFCALPVLGLPETRGATMCDTMDEEEQKE  563



>ref|XP_002265245.3| PREDICTED: organic cation/carnitine transporter 3-like [Vitis 
vinifera]
Length=549

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/284 (51%), Positives = 201/284 (71%), Gaps = 6/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWRYLYL+T +P  +Y V+V+   RESPRWL +RG  ++ V T+K++      S     
Sbjct  257  SSWRYLYLWTSVPASLYCVLVHFFVRESPRWLLVRGRKEEAVATLKSIGAVNNSSFTLSF  316

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     +++        + LYS + +L+ K WALRRL  VM V  G+G+VYYG+PL +G 
Sbjct  317  SGLPFEEEE-----TTNLHLYSVISILLEKRWALRRLSAVMTVGFGVGMVYYGMPLALGN  371

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +PFNLY + T NA+SELPASL+    I++L R+S+V+   + SGVC++ CVV +GEE  +
Sbjct  372  LPFNLYWNVTFNALSELPASLIAFFFIERLNRKSSVLVFTMTSGVCSIMCVV-MGEEWAS  430

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            ++IGLE+V+FF+ CTAF+ILLIYT+ELFPTCVRNSA+AM RQA+V GG   P++V +GRG
Sbjct  431  LKIGLELVSFFSTCTAFDILLIYTIELFPTCVRNSAMAMVRQALVFGGVFCPVIVEIGRG  490

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            N + SYGVFG+  + C LF+  LPET GG LCDT++EEE+K+  
Sbjct  491  NGYLSYGVFGVVIISCGLFVGCLPETKGGTLCDTMEEEENKQRA  534



>ref|XP_002890162.1| hypothetical protein ARALYDRAFT_471835 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66421.1| hypothetical protein ARALYDRAFT_471835 [Arabidopsis lyrata subsp. 
lyrata]
Length=518

 Score =   275 bits (702),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 142/287 (49%), Positives = 194/287 (68%), Gaps = 6/287 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWRYLY++T IP +IY  ++ +  RESPRWL ++G  ++ V  ++++A     +    
Sbjct  234  GNSWRYLYVWTSIPTLIYCCLIRIFVRESPRWLIVKGRKEEAVSILQSIAS-NAITMSFT  292

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
               F   +DQ     +   D+Y ALK+L+ K W+ RRLL  M V  GIG+VYYG+PL + 
Sbjct  293  NLCFDIEEDQS----NSNPDVYDALKILVRKSWSFRRLLAAMVVGFGIGMVYYGMPLALT  348

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLYL    NA+SE PA L+T   IDK+ RR  ++G   LSG+ +    V +G++L 
Sbjct  349  NLNFNLYLGVVFNALSEFPAFLITFFFIDKINRRDALIGFTALSGISSALIAV-LGQQLG  407

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            A+QI LE+V+FF+ACTAFN+ LIYT+E+FPTCVRNSA+AM RQA+V GG  SP++VA GR
Sbjct  408  ALQIVLELVSFFSACTAFNMTLIYTIEMFPTCVRNSAIAMVRQALVFGGVFSPVMVAAGR  467

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNR  862
             N+F+SYG+FGL   LC LF+  LPET G  LCDT+DEEE K    R
Sbjct  468  ENQFWSYGLFGLVIALCGLFVFGLPETRGSVLCDTMDEEEYKTLAKR  514



>ref|XP_002266025.1| PREDICTED: organic cation/carnitine transporter 3-like [Vitis 
vinifera]
Length=520

 Score =   274 bits (701),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 150/288 (52%), Positives = 206/288 (72%), Gaps = 12/288 (4%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWRYLYL+T +P + Y V+V+   RESPRWL +RG  ++ V T+K++      ++ + 
Sbjct  234  GSSWRYLYLWTSVPALSYCVLVHFFVRESPRWLLVRGRKEEAVATLKSIG---AVNNSSF  290

Query  182  ttiFSDNQDQGLIDLDEQ---MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPL  352
            T  FS     GL   DE+   + L S + +L+ K WALRRL  VM V  G+G+VYYG+PL
Sbjct  291  TLSFS-----GLPFEDEETTNLHLCSVISILLEKRWALRRLSAVMTVGFGVGMVYYGMPL  345

Query  353  GVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGE  532
             +G +PFNLY + T NA+SELPASL+    I++L R+S+V+   + SGVC++ CVV +GE
Sbjct  346  ALGNLPFNLYWNVTFNALSELPASLIAFFFIERLNRKSSVLVFTMTSGVCSIMCVV-MGE  404

Query  533  ELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
            E  +++IGLE+V+FF+ CTAF+ILLIYT+ELFPTCVRNSA+AM RQA+V GG   P++V 
Sbjct  405  EWASLKIGLELVSFFSTCTAFDILLIYTIELFPTCVRNSAMAMVRQALVFGGVFCPVIVE  464

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            +G GN + SYGVFG+  + C LF+  LPET GG LCDT++EEE+KE  
Sbjct  465  IGMGNGYLSYGVFGVVIISCGLFVGCLPETKGGTLCDTMEEEENKERA  512



>ref|XP_002520225.1| sugar transporter, putative [Ricinus communis]
 gb|EEF42158.1| sugar transporter, putative [Ricinus communis]
Length=480

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 145/282 (51%), Positives = 199/282 (71%), Gaps = 7/282 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR+LYL+T IP I Y ++V+L  RESPRWL +RG   + +  + ++A  +     +  
Sbjct  196  SSWRHLYLWTSIPTIFYCILVHLWVRESPRWLLIRGRKDEAMGILTSIAAIDGSCLTSNF  255

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            + F   Q+         +D+YSA+K+L+ K WA RRL TVM V  G GLVYYG+PLG+G 
Sbjct  256  SDFRFEQES------WNVDIYSAIKILLEKRWAFRRLSTVMVVGFGTGLVYYGMPLGLGT  309

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FNLYLS   NA+SELPA+L+T  LI+KL R+ +++    LSGVC++ CV  +G+    
Sbjct  310  LDFNLYLSVMFNALSELPAALITFFLINKLNRKCSLLVFSSLSGVCSILCV-LLGKLSSK  368

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +QIGLE+++FF ACT FNILLIYT+ELFPTCVRNSA++M RQA+V GG  SP+LVA GR 
Sbjct  369  IQIGLEMISFFCACTGFNILLIYTIELFPTCVRNSAISMVRQALVFGGVFSPVLVAAGRE  428

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            +   SYGVFGL   +C +F++ LPET+G  +CDT++EEE K+
Sbjct  429  SALLSYGVFGLVIGICGVFVICLPETMGETICDTMEEEEHKQ  470



>ref|XP_010063992.1| PREDICTED: organic cation/carnitine transporter 3-like [Eucalyptus 
grandis]
Length=524

 Score =   273 bits (699),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 190/286 (66%), Gaps = 8/286 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LY++T +P I Y V+V+ +  ESPRWL+L G  +  VET+K++A P        
Sbjct  237  GSSWRVLYIWTSVPAIGYCVLVHFLVCESPRWLFLMGRREKAVETLKSIASPGASILTKG  296

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                S  +D         MD++SA+K L+ K WA  RL  VM V  GIG+VYYG+PLGVG
Sbjct  297  FFAISLEEDP-----LNNMDIFSAIKALLEKRWAFCRLCAVMLVGFGIGMVYYGMPLGVG  351

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + F+LY S TLNA++ELP++L+T +LI KL RRS+ V              +  G   +
Sbjct  352  NLHFDLYSSVTLNALAELPSTLLTFVLIGKLNRRSS-VLFFTTLSGICSVMCILEGRVWQ  410

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG-  718
             ++IGLE+V+FF+ CTA ++LLIYTLELFPTCVRNSA +M RQA+V+GG  SPLLVA   
Sbjct  411  KLRIGLELVSFFSGCTAVSVLLIYTLELFPTCVRNSATSMVRQALVLGGVFSPLLVAAAA  470

Query  719  -RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             RG+   SYGVFGL    C LF++ LPET GG+LCDT+DEEE KEN
Sbjct  471  RRGDGMLSYGVFGLVIGCCGLFVMCLPETRGGNLCDTMDEEERKEN  516



>ref|XP_004293841.1| PREDICTED: organic cation/carnitine transporter 3-like [Fragaria 
vesca subsp. vesca]
Length=512

 Score =   272 bits (696),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 147/285 (52%), Positives = 195/285 (68%), Gaps = 11/285 (4%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY  T IP + YS++V+ + RESPRWL++RG  +D +  +K ++P          +
Sbjct  230  SWRTLYFLTSIPTLFYSILVHFLVRESPRWLFVRGRKEDAISALKCISPS----ITMSFS  285

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
              S  Q+         +DLYSA+ +L+ + WA RRL  VM    GIG+VYYG+PL +G +
Sbjct  286  SLSFEQET------WNVDLYSAIGVLVKRKWAFRRLSAVMGTGFGIGMVYYGMPLALGSL  339

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV  547
             FNLYLS TLNA+SELPASLV   LI KL RRS+++   +LSGVC++  V+        +
Sbjct  340  DFNLYLSVTLNALSELPASLVAFFLIGKLNRRSSLLVFTILSGVCSILSVLKGFNPWAEL  399

Query  548  QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGN  727
            QIGLE+V+FF+AC+AFN+LLI+T+ELFPTCVRNSA++M RQA+V+GG  SP+L A GR N
Sbjct  400  QIGLELVSFFSACSAFNVLLIFTIELFPTCVRNSALSMVRQAVVLGGVFSPMLAAAGRAN  459

Query  728  -RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGN  859
                SYGVFG+   LC LF+V LPET G  +CDT+DEEE KE  N
Sbjct  460  GGVVSYGVFGVVVGLCGLFVVCLPETRGRGICDTMDEEEHKETAN  504



>ref|XP_009392877.1| PREDICTED: organic cation/carnitine transporter 2-like [Musa 
acuminata subsp. malaccensis]
Length=511

 Score =   270 bits (690),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 195/286 (68%), Gaps = 9/286 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LYL+T +P   YSV+++ + +ESPRWL +RG   + ++T+K++A        + 
Sbjct  231  GSSWRALYLWTSVPSACYSVLLFFLIKESPRWLLVRGRRDEAIQTLKSIASTNDDVINSS  290

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             +     +D G++D+      +SA+K+L  K WALRRL+  M    GIG+VYYG+PL VG
Sbjct  291  FSKLIVAEDTGIVDI------FSAMKILWQKKWALRRLMATMIAGFGIGMVYYGMPLNVG  344

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             +  NLYLS T NA++ELP+SL+TL LI KL RR + V    + G  ++ CV+      K
Sbjct  345  NLGSNLYLSVTFNALAELPSSLITLFLIGKLNRRCSTVTFTTMGGAFSVLCVLVTS---K  401

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
              Q+  E+V+FF+ACTAFN+LLIYT+ELFPTCVRNSA++M RQA+V+GG  +P+LVA GR
Sbjct  402  LWQMASEVVSFFSACTAFNVLLIYTIELFPTCVRNSAISMVRQALVLGGVFAPVLVAEGR  461

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGN  859
               F S+GVFG     C LF+VSLPET G  +CDT++EEE K+N +
Sbjct  462  KRSFLSFGVFGFVIGCCGLFIVSLPETRGRSICDTMEEEEVKQNAS  507



>ref|XP_010476747.1| PREDICTED: organic cation/carnitine transporter 3 isoform X1 
[Camelina sativa]
 ref|XP_010476748.1| PREDICTED: organic cation/carnitine transporter 3 isoform X2 
[Camelina sativa]
Length=516

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/282 (50%), Positives = 196/282 (70%), Gaps = 6/282 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWRYLY++T IP +IY  +V +  RESPRWL ++G  ++ V  ++++A     +  + 
Sbjct  226  GNSWRYLYVWTSIPTLIYCSLVRIFVRESPRWLIVKGRKEEAVSILQSIAS-NAITVSST  284

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
               F   ++Q  ++     D+Y ALK+L+ K W L+RLL  M +  GIG+VYYG+PL + 
Sbjct  285  NLCFDVQENQSELN----PDIYDALKILVRKSWLLKRLLVAMALGFGIGMVYYGMPLALT  340

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLYL    NA+SE PA L+T  LIDK+ RR  ++G   LSG+ +      +G++L 
Sbjct  341  NLNFNLYLGVVFNALSEFPAFLITFFLIDKINRRDALIGFTALSGISSALIAA-LGQKLG  399

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            ++Q+ LE+V+FF+ACTAFN+ LIYT+ELFPTCVRNSA+AM RQA+V GG  SP++VA GR
Sbjct  400  SLQMVLELVSFFSACTAFNMTLIYTIELFPTCVRNSAMAMVRQALVFGGVFSPVMVAAGR  459

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
             N+F+SYG+FGL   LC LF+V LPET G  LCDT+DEEE K
Sbjct  460  ENQFWSYGLFGLVIGLCGLFVVGLPETRGSVLCDTMDEEEYK  501



>gb|KEH19342.1| organic cation/carnitine transporter [Medicago truncatula]
Length=526

 Score =   268 bits (686),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/283 (49%), Positives = 189/283 (67%), Gaps = 5/283 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LYL+T IP I Y ++V +  +ESPRWL L+G  ++ + T+K +      +     
Sbjct  242  SSWRNLYLWTSIPTIFYCMLVKIFVQESPRWLLLKGKEEEAIATLKYITSITQSNLNLSI  301

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
               S ++++  +++D    L+ ALKLL+ K W+ RRLL +M +  GIG+VYYG+PLG+G 
Sbjct  302  NNMSSHEEENNLNVD----LFYALKLLLQKKWSSRRLLLIMALGFGIGVVYYGMPLGLGN  357

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FNLYLS T NA+SE+P+SLVT   IDK +RR   + +  +            GE    
Sbjct  358  LSFNLYLSVTFNALSEIPSSLVTFFFIDKFKRR-IALFVFCIISGVLSIMSTIEGELWSK  416

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +QIG E+++FF+ACT+F+I LIYT ELFPTCVRNSA++MAR A+V GGA SPLLV  GRG
Sbjct  417  MQIGFELISFFSACTSFSIYLIYTTELFPTCVRNSALSMARLAVVFGGAFSPLLVGAGRG  476

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            N+F  YGVFGLA     +F V LPET G  LCDT+DEEE+K+ 
Sbjct  477  NKFLCYGVFGLAIGFSGVFGVFLPETKGRVLCDTMDEEENKDK  519



>ref|XP_010532010.1| PREDICTED: organic cation/carnitine transporter 2 [Tarenaya hassleriana]
Length=556

 Score =   268 bits (685),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 205/303 (68%), Gaps = 30/303 (10%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWR LYL+T IP IIYSV+V +  RESPRWL ++G  ++ V  ++++A P        
Sbjct  253  GNSWRNLYLWTSIPTIIYSVLVRIFVRESPRWLLVKGRKEEAVSILQSIASP--------  304

Query  182  ttiFSDNQDQGLIDLD------EQ------MDLYSALKLLINKGWALRRLLTVMWVALGI  325
                +DN + G +++       EQ      +++Y+A+K+L+ K WALRRL  VM VA GI
Sbjct  305  ----TDNNNGGRVNVSFSSLPFEQEPEGPNVNIYAAVKILVQKRWALRRLSAVMAVAFGI  360

Query  326  GLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcn  505
            GLVYYG+PL +  + FN+YLS   NA+ +LPA+L+T  L+DKL R+  ++G   + GV +
Sbjct  361  GLVYYGMPLALSNLNFNVYLSAAFNALMDLPANLITFFLVDKLSRKKALIGFTAMGGVSS  420

Query  506  lgcvvFVGEELK----AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQA  673
            L    F+   L     A Q+ LE+V++F+AC+AFN+ LIYT+ELFP CVRNSA+AMARQA
Sbjct  421  LLI--FIQHNLTLHNGASQLVLELVSYFSACSAFNMELIYTIELFPACVRNSAIAMARQA  478

Query  674  MVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            +V+GG  SP++VA GR N F+SYG+FGL  ++  LF++ LPET G  LCDT+DEEE KE 
Sbjct  479  LVLGGVFSPVMVAAGRRNVFWSYGLFGLIILVSGLFVIGLPETRGSVLCDTMDEEEYKER  538

Query  854  GNR  862
              R
Sbjct  539  TQR  541



>ref|XP_006304573.1| hypothetical protein CARUB_v10011593mg [Capsella rubella]
 gb|EOA37471.1| hypothetical protein CARUB_v10011593mg [Capsella rubella]
Length=512

 Score =   266 bits (681),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 140/281 (50%), Positives = 195/281 (69%), Gaps = 6/281 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWRYLY++T IP + Y V+V +  RESPRWL ++G  ++ V  +K++A     +  +  
Sbjct  229  NSWRYLYVWTSIPTLSYCVLVRIFVRESPRWLIVKGRKEEAVSILKSIAS-NAITVSSTN  287

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
              F   ++Q  ++     D+Y ALK+L+ K W L+RLL  M V  GIG+VYYG+PL +  
Sbjct  288  LCFDLEENQSELN----PDVYDALKILVRKSWLLKRLLVAMAVGFGIGMVYYGMPLALTN  343

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FNLYL    NA+SE PA L+T  LIDK+ RR  ++G   LSG+ +      +G+++ +
Sbjct  344  LNFNLYLGVVFNALSEFPAFLITFFLIDKINRRDALIGFTALSGISSALIAA-LGQQIGS  402

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +QI LE+V+FF+ACTAFN+ LIYT+ELFPTCVRNSA+AM RQA+V GG  SP++VA GR 
Sbjct  403  LQIVLELVSFFSACTAFNMTLIYTIELFPTCVRNSAMAMVRQALVFGGVFSPVMVAAGRE  462

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            N+F+SYG+FGL   LC LF+V LPET G  LCDT++EEE K
Sbjct  463  NQFWSYGLFGLVIGLCGLFVVGLPETRGSVLCDTMEEEEYK  503



>ref|XP_002889241.1| hypothetical protein ARALYDRAFT_895842 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65500.1| hypothetical protein ARALYDRAFT_895842 [Arabidopsis lyrata subsp. 
lyrata]
Length=526

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/296 (47%), Positives = 203/296 (69%), Gaps = 10/296 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP---PEtrss  172
            GSSWR LY++T IP IIY V+V     ESPRWL++RG  ++ +  +K +A     +    
Sbjct  226  GSSWRILYVWTSIPTIIYCVLVRFFVCESPRWLFVRGRKEEAISILKRVASIPSTDVNIG  285

Query  173  itrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPL  352
               +  FS    +   +    +++++ +K+L+ K WAL+RL  VM +A GIGLVYYG+PL
Sbjct  286  GAISMSFSSLPFEDEEEKPNNVNIFTTMKVLVEKRWALKRLSAVMAIAFGIGLVYYGMPL  345

Query  353  GVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGE  532
             +  + FN+YLS   NA+ +LPA+L+TL L+DKL RR+ ++G   L GV ++    F  +
Sbjct  346  ALSNLDFNIYLSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGGVSSVLI--FALQ  403

Query  533  ELK-----AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAIS  697
             ++     A+Q+ LE++++F+AC+AFN+ +IYT+ELFPTCVRNSA+AMARQA+V+GG  S
Sbjct  404  NMRIGNHGALQLALELISYFSACSAFNMEMIYTIELFPTCVRNSAIAMARQALVLGGVFS  463

Query  698  PLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV  865
            P++VA GR N F+S+G+FGLA  L  LF V LPET G DLCDT+DEEE K+  ++V
Sbjct  464  PIMVAAGRKNAFWSFGLFGLAIALLGLFAVGLPETRGSDLCDTMDEEECKDRRSKV  519



>ref|XP_010497812.1| PREDICTED: organic cation/carnitine transporter 3-like [Camelina 
sativa]
Length=516

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/282 (49%), Positives = 196/282 (70%), Gaps = 6/282 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWRYLY++T IP +IY  +V +  RESPRWL ++G  ++ V  ++++A     +  + 
Sbjct  226  GNSWRYLYVWTSIPTLIYCSLVRIFVRESPRWLIVKGRKEEAVSILQSIAS-NAITVSST  284

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
               F+  ++Q  ++     D+Y A K+L+ K W L+RLL  M +  GIG+VYYG+PL + 
Sbjct  285  NLCFAVQENQSELN----PDIYDASKILVRKRWLLKRLLVAMALGFGIGMVYYGMPLALT  340

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLYL    NA+SE PA L+T  LIDK+ RR  ++G   LSG+ +      +G+++ 
Sbjct  341  NLNFNLYLGVVFNALSEFPAFLITFFLIDKINRRDALIGFTALSGISSALIAA-LGQQIG  399

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            ++QI LE+V+FF+ACTAFN+ LIYT+E+FPTCVRNSA+AM RQA+V GG  SP++VA GR
Sbjct  400  SLQIVLELVSFFSACTAFNMTLIYTIEMFPTCVRNSAMAMVRQALVFGGVFSPVMVAAGR  459

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
             N+F+SYG+FGL   LC LF+V LPET G  LCDT+DEEE K
Sbjct  460  ENQFWSYGLFGLVIGLCGLFVVGLPETRGSVLCDTMDEEEYK  501



>ref|XP_010092478.1| Organic cation/carnitine transporter 3 [Morus notabilis]
 gb|EXB51244.1| Organic cation/carnitine transporter 3 [Morus notabilis]
Length=505

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/282 (51%), Positives = 192/282 (68%), Gaps = 4/282 (1%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LY++T +P I Y V++  V RESPRWL+++G  +D + T+K ++       +T 
Sbjct  220  GSSWRNLYIWTSVPTIFYCVVIRFVVRESPRWLFVQGRAEDAIATLKGLSQTNHHEILTM  279

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                S    +   D    + LYSA+K+L+ K W  RRLL VM +  GIG+VYYG+PL +G
Sbjct  280  KYFSSMPLGE---DRTPNVSLYSAIKILVEKKWCFRRLLAVMTIGFGIGMVYYGMPLALG  336

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
            ++ FNLYLS T NA+SELP+SLVT L++ K+ R+S+++   ++SG+ +L CV   G    
Sbjct  337  DLSFNLYLSVTFNALSELPSSLVTYLVVGKMNRKSSLLLFSIISGIFSLMCV-LKGRAWT  395

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             +QIG EIV+FF+ACTA NILL++T+ELFPTCVRNSA++M RQA+V GG   PLL A G+
Sbjct  396  RLQIGFEIVSFFSACTADNILLLFTVELFPTCVRNSALSMVRQALVFGGVFGPLLAAAGK  455

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
             N   SYGVFG+      LF V LPET G  LCDTIDEEE K
Sbjct  456  RNGLLSYGVFGVVIACLSLFAVYLPETRGRALCDTIDEEEHK  497



>ref|XP_006389896.1| hypothetical protein EUTSA_v10018401mg [Eutrema salsugineum]
 gb|ESQ27182.1| hypothetical protein EUTSA_v10018401mg [Eutrema salsugineum]
Length=521

 Score =   265 bits (678),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/289 (48%), Positives = 202/289 (70%), Gaps = 6/289 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWR LY++T IP IIY  +V     ESPRWL++RG  ++ +  +K +A  +  + I+ 
Sbjct  226  GNSWRVLYIWTSIPTIIYCFLVRFFVCESPRWLFVRGRREEAISILKRVASTDGGALISM  285

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            +     +Q++   +    +++Y+A+K+L+ K WAL+RL  VM VA GIGLVYYG+PL + 
Sbjct  286  SFSSLPSQEE---EEKPSVNIYAAMKVLLGKRWALKRLSAVMAVAFGIGLVYYGMPLALS  342

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+YLS   NA+ +LPA+L+TL L+DKL RR+ ++G   L GV ++         + 
Sbjct  343  NLDFNVYLSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGGVSSVLIFALQNMRIG  402

Query  542  ---AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
                +Q+GLE++++F+AC+AFN+ LIYT+ELFPTCVRNSA+AM RQA+V+GG  SP++VA
Sbjct  403  NHGGLQLGLELISYFSACSAFNMELIYTIELFPTCVRNSAIAMTRQALVLGGVFSPVMVA  462

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGN  859
             GR N F+S+G+FGLA  L  LF+V LPET G DLCDT+DEEE K+  N
Sbjct  463  AGRKNGFWSFGLFGLAIGLLGLFVVGLPETRGSDLCDTMDEEECKDRRN  511



>ref|NP_173089.1| organic cation/carnitine transporter 3 [Arabidopsis thaliana]
 sp|Q9SA38.1|OCT3_ARATH RecName: Full=Organic cation/carnitine transporter 3; Short=AtOCT3 
[Arabidopsis thaliana]
 gb|AAD34691.1|AC006341_19 Is a member of the PF|00083 sugar transporter family [Arabidopsis 
thaliana]
 gb|AAL79578.1| At1g16390/F3O9_19 [Arabidopsis thaliana]
 gb|AAN38700.1| At1g16390/F3O9_19 [Arabidopsis thaliana]
 gb|AEE29445.1| organic cation/carnitine transporter 3 [Arabidopsis thaliana]
Length=518

 Score =   265 bits (676),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 140/287 (49%), Positives = 190/287 (66%), Gaps = 6/287 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWR LY++T IP +IY  +V    RESPRWL ++G  ++ V  ++++A     +    
Sbjct  234  GNSWRNLYVWTSIPTLIYCCLVRSFVRESPRWLIVKGRKEEAVSILQSIAS-NAITMSFT  292

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
               F    DQ         D+Y ALK+L+ K W+ RRLL  M V  GIG+VYYG+PL + 
Sbjct  293  NLCFEVENDQS----KSNPDVYDALKILVRKSWSFRRLLAAMVVGFGIGMVYYGMPLALT  348

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLYL    NA+SE PA L+T   IDK+ RR  ++G   LSG+ +    V +G++L 
Sbjct  349  NLNFNLYLGVVFNALSEFPAFLITFFFIDKINRRDALIGFTALSGISSALIAV-LGQQLG  407

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            ++QI LE+V+FF+ACTAFN+ LIYT+E+FPTCVRNSA++M RQA+V GG  SP++VA GR
Sbjct  408  SLQIVLELVSFFSACTAFNMTLIYTIEMFPTCVRNSAISMVRQALVFGGVFSPVMVAAGR  467

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNR  862
             N+F+SYG+FGL   LC LF+  LPET G  LCDT+DEEE K    R
Sbjct  468  ENQFWSYGLFGLIIGLCGLFVFGLPETRGSVLCDTMDEEEYKTLAKR  514



>ref|XP_010474491.1| PREDICTED: organic cation/carnitine transporter 2, partial [Camelina 
sativa]
Length=430

 Score =   262 bits (669),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 136/294 (46%), Positives = 202/294 (69%), Gaps = 7/294 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LY++T IP IIY V+V  +  ESPRWL++RG  ++ +  +K +A   + + +  
Sbjct  127  GSSWRILYIWTSIPTIIYCVLVRFLVCESPRWLFVRGRREEAISILKRVASIPSSTDVNI  186

Query  182  ttiFSDNQDQGLIDLDEQ----MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIP  349
                S +      + +EQ    +++++ +K L+ K WAL+RL  VM +A GIGLVYYG+P
Sbjct  187  GGAISMSFSSLPFEEEEQKPSNVNIFTTMKALVEKRWALKRLSAVMAIAFGIGLVYYGMP  246

Query  350  LGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG  529
            L +  + FN+YLS   NA+ +LPA+L+TL L+DKL RR+ ++G   L G+ ++       
Sbjct  247  LALSNLDFNIYLSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGGISSVLIFALQN  306

Query  530  EELK---AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISP  700
              ++   A+Q+ LE++++F+AC+AFN+ +IYT+ELFPTCVRNSA+AMARQA+V+GG  SP
Sbjct  307  MRIRNHGALQLALELISYFSACSAFNMEMIYTIELFPTCVRNSAIAMARQALVLGGVFSP  366

Query  701  LLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNR  862
            ++VA GR N  +S+G+FGLA  L  LF V LPET G DLCDT+DEEE K+  ++
Sbjct  367  IMVAAGRKNGVWSFGLFGLAIGLMGLFAVGLPETRGSDLCDTMDEEECKDQRSK  420



>ref|XP_009128350.1| PREDICTED: organic cation/carnitine transporter 2 [Brassica rapa]
Length=519

 Score =   264 bits (675),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 139/290 (48%), Positives = 198/290 (68%), Gaps = 7/290 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWR LY++T +P IIY V+V     ESPRWL++RG  ++ +  +K +A          
Sbjct  224  GNSWRILYIWTSVPTIIYCVLVRYFVCESPRWLFVRGRREEAISILKRVASIPMSDGTMS  283

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             +     +++   D    +++Y+A+K+L+ K WALRRL  VM VA GIGLVYYG+PL + 
Sbjct  284  FSSLPTEEEE---DEKPSVNIYAAMKVLVEKRWALRRLTAVMAVAFGIGLVYYGMPLALS  340

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+Y+S   NA+ +LPA+L+TL L+DKL RR+ ++G   L GV ++         + 
Sbjct  341  NLDFNVYMSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGGVSSVLIFALQNMRIG  400

Query  542  ---AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
               A+Q+ LE++++F AC+AFNI +IYT+ELFPTCVRNSA+AM RQA+V+GG  SP++VA
Sbjct  401  SHGALQLVLELISYFCACSAFNIEMIYTIELFPTCVRNSAIAMTRQALVLGGVFSPIMVA  460

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE-NGN  859
             GR N F+S+G+FGLA  L  LF V+LPET G DLCDT+DEEE K+  GN
Sbjct  461  AGRKNGFWSFGLFGLAIGLLGLFAVALPETRGSDLCDTMDEEECKDRQGN  510



>emb|CDX87388.1| BnaA07g34850D [Brassica napus]
Length=486

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 134/286 (47%), Positives = 199/286 (70%), Gaps = 10/286 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWR LY++T +P ++Y V+V     ESPRWL++RG  ++ +  +K +A  +    +  
Sbjct  195  GNSWRILYIWTSVPTMVYCVMVRFFVCESPRWLFVRGRREEAISILKRVASSDVTMILPF  254

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                   ++Q  ID    +++Y+A+K+L+ K WAL+RL TVM VA GIGLVYYG+PL + 
Sbjct  255  -------EEQENIDEKPSVNIYAAMKVLVEKRWALKRLSTVMAVAFGIGLVYYGMPLALS  307

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+Y+S   NA+ +LPA+L+TL L+DKL R++ ++G   L G+ ++         +K
Sbjct  308  NLDFNVYMSAAFNALMDLPANLITLFLVDKLSRKNALIGFTALGGISSVLIFALQNMRIK  367

Query  542  ---AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
               A+Q+ LE++++F AC+AFN+ +IYT+ELFPTCVRNSA+AMARQA+V+GG  SP++VA
Sbjct  368  NHGALQLVLELMSYFCACSAFNMEMIYTIELFPTCVRNSAIAMARQALVLGGVFSPIMVA  427

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             GR N  +S+G+FGLA  L  LF V LPET G DLCDT+DEEE ++
Sbjct  428  AGRKNGVWSFGLFGLAIGLLGLFTVGLPETRGSDLCDTMDEEECRD  473



>ref|XP_011095769.1| PREDICTED: organic cation/carnitine transporter 3-like [Sesamum 
indicum]
Length=548

 Score =   265 bits (676),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 213/284 (75%), Gaps = 7/284 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G SWR +YL+T +P + YS+ V++  RESPRWL+++G   +F ET++++A P +RSS+T+
Sbjct  262  GYSWRLIYLWTCVPTMFYSIAVFIGVRESPRWLFIKGRKDEFAETLRSIAAPASRSSLTQ  321

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            +     ++ +   +  ++ D++SALK+L+ KGW+ RRL+ VM V  G G++YYG+PLG+G
Sbjct  322  SFFGRCSEWE---EKKQETDIFSALKILMAKGWSCRRLVVVMVVGFGHGIIYYGMPLGLG  378

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + F+LYLS TLNA+SE PASL+  +LI KL R+ +V+GL +LSGVC++ C   V    K
Sbjct  379  NLSFDLYLSVTLNALSEFPASLLAFVLIGKLNRKGSVLGLSLLSGVCSVSC---VLVRWK  435

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            A+QIGLE+++F +ACTAF+I+ IYTLELFPTCVRNSAVAMARQ++V+GGA+  +LVA+GR
Sbjct  436  ALQIGLELMSFLSACTAFDIVSIYTLELFPTCVRNSAVAMARQSLVLGGALGSVLVAVGR  495

Query  722  GNR-FYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
                  SYGVFG+   +C LF+V LPET G  LCDT++EEE K 
Sbjct  496  KKGLLLSYGVFGMTISICGLFVVCLPETKGRVLCDTMEEEERKN  539



>gb|KDP44653.1| hypothetical protein JCGZ_19689 [Jatropha curcas]
Length=513

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 191/287 (67%), Gaps = 16/287 (6%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LYL+T  P I Y ++++ +  ESPRWL+++G  ++ V  + ++   E        
Sbjct  231  SSWRNLYLWTCAPTIFYCILLHFLVHESPRWLFIKGRREEAVSILTSIGQSER-------  283

Query  185  tiFSDNQDQGLIDLD-EQ----MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIP  349
                D   + L DL+ EQ    +D+YSA+K+L  K WA RRL  VM +  G G +YYG+P
Sbjct  284  ---KDLNQELLSDLEFEQESWNVDIYSAIKILTQKRWAFRRLSAVMIIGFGTGFIYYGMP  340

Query  350  LGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG  529
            LG+G   FNLYLS T NA+SELPASL+    IDKL+R+ +++    +S VC++ C    G
Sbjct  341  LGLGAQNFNLYLSVTFNALSELPASLIPFFFIDKLKRKYSLLVFNSVSCVCSILCA-IAG  399

Query  530  EELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLV  709
            +    +QIGLE+V+FF+ACT FNILLIY+LELFPT VRNSA++M RQA+V+GG  SP LV
Sbjct  400  KMSANLQIGLELVSFFSACTGFNILLIYSLELFPTSVRNSAISMVRQALVLGGVFSPQLV  459

Query  710  ALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            A  R N F SYG+FGL    C LF++ LPET G  LCDT++E+E KE
Sbjct  460  AAARKNEFLSYGMFGLVIGTCVLFVICLPETKGKTLCDTMEEQEHKE  506



>ref|XP_010092475.1| Organic cation/carnitine transporter 3 [Morus notabilis]
 gb|EXB51241.1| Organic cation/carnitine transporter 3 [Morus notabilis]
Length=526

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/284 (48%), Positives = 185/284 (65%), Gaps = 10/284 (4%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY++T +P I YS+ VY +  ESPRWL++RG  +D V+ +  ++  +       +
Sbjct  237  SSWRNLYVWTSVPTIFYSMAVYFLVYESPRWLFVRGRKEDAVKNMAQISNNQNIIMSFSS  296

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
              F +            +DLYSA+K+L+ K WA RRL  VM +  G G+VYYG+PL +G+
Sbjct  297  MAFEEET--------WNVDLYSAIKILVKKKWAFRRLSAVMAIGFGTGMVYYGMPLALGD  348

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FNLYLS   NA+SELP+SLVT  L++ L R+S+ +              V  G+    
Sbjct  349  LDFNLYLSIAFNALSELPSSLVTFFLVENLNRKSS-LLFFTSLSGICSIMSVLRGKIWTR  407

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +QIG E+V+FF+ACTAF++LLI+T+ELFPTCVRNSAVAM RQA+V GG  SP+L A GRG
Sbjct  408  LQIGFELVSFFSACTAFDMLLIFTIELFPTCVRNSAVAMVRQALVFGGVFSPVLAAAGRG  467

Query  725  NR-FYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            +  F SYGVFG+      LF+V LPET G  +CDT+DEEE K+ 
Sbjct  468  SDGFVSYGVFGIVIGCFGLFVVCLPETRGRGICDTMDEEEHKDK  511



>emb|CDX88532.1| BnaC06g39760D [Brassica napus]
Length=534

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 202/288 (70%), Gaps = 14/288 (5%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWR LYL+T +P ++Y V+V     ESPRWL++RG  ++ +  +K +A  +   S+  
Sbjct  243  GNSWRVLYLWTSVPTMVYCVMVRFFVCESPRWLFVRGRREEAISILKRVASSDVAMSLPF  302

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                   ++Q  ID    +++Y+A+K+L+ K WAL+RL TVM VA GIGLVYYG+PL + 
Sbjct  303  -------EEQENIDEKPSVNIYAAMKVLVEKRWALKRLSTVMVVAFGIGLVYYGMPLALS  355

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+Y+S   NA+ +LPA+L+TL L+DKL RR+ ++G   L GV ++    F  + L+
Sbjct  356  NLDFNVYMSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGGVSSVLI--FALQNLR  413

Query  542  -----AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
                 A+Q+ LE++++F AC+AFN+ +IYT+ELFPTCVRNSA+AMARQA+V+GG  SP++
Sbjct  414  INNHGALQLVLELMSYFCACSAFNVEMIYTIELFPTCVRNSAIAMARQALVLGGVFSPVM  473

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            VA GR N  +S+G+FGLA  L  LF V LPET G DLCDT+DEEE ++
Sbjct  474  VAAGRKNGVWSFGLFGLAIGLLGLFTVGLPETRGSDLCDTMDEEECRD  521



>ref|XP_010476749.1| PREDICTED: organic cation/carnitine transporter 3 isoform X3 
[Camelina sativa]
Length=536

 Score =   263 bits (672),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 142/297 (48%), Positives = 196/297 (66%), Gaps = 16/297 (5%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssit-  178
            G+SWRYLY++T IP +IY  +V +  RESPRWL ++G  ++ V  ++++A      S T 
Sbjct  226  GNSWRYLYVWTSIPTLIYCSLVRIFVRESPRWLIVKGRKEEAVSILQSIASNAITVSSTN  285

Query  179  ---------rttiFSDNQDQGLIDLDEQM-----DLYSALKLLINKGWALRRLLTVMWVA  316
                      +   + +      D+ E       D+Y ALK+L+ K W L+RLL  M + 
Sbjct  286  LSVSILQSIASNAITVSSTNLCFDVQENQSELNPDIYDALKILVRKSWLLKRLLVAMALG  345

Query  317  LGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsg  496
             GIG+VYYG+PL +  + FNLYL    NA+SE PA L+T  LIDK+ RR  ++G   LSG
Sbjct  346  FGIGMVYYGMPLALTNLNFNLYLGVVFNALSEFPAFLITFFLIDKINRRDALIGFTALSG  405

Query  497  vcnlgcvvFVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAM  676
            + +      +G++L ++Q+ LE+V+FF+ACTAFN+ LIYT+ELFPTCVRNSA+AM RQA+
Sbjct  406  ISSALIAA-LGQKLGSLQMVLELVSFFSACTAFNMTLIYTIELFPTCVRNSAMAMVRQAL  464

Query  677  VVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            V GG  SP++VA GR N+F+SYG+FGL   LC LF+V LPET G  LCDT+DEEE K
Sbjct  465  VFGGVFSPVMVAAGRENQFWSYGLFGLVIGLCGLFVVGLPETRGSVLCDTMDEEEYK  521



>ref|XP_009106657.1| PREDICTED: organic cation/carnitine transporter 2 [Brassica rapa]
Length=517

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/286 (47%), Positives = 200/286 (70%), Gaps = 10/286 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWR LY++T +P ++Y V+V     ESPRWL++RG  ++ +  +K +A  +   S+  
Sbjct  226  GNSWRILYIWTSVPTMVYCVMVRFFVCESPRWLFVRGRREEAISILKRVASSDVTMSLPF  285

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                   ++Q  ID    +++Y+A+K+L+ K WAL+R+ TVM VA GIGLVYYG+PL + 
Sbjct  286  -------EEQENIDEKPSVNIYAAMKVLVEKRWALKRVSTVMAVAFGIGLVYYGMPLALS  338

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+Y+S   NA+ +LPA+L+TL L+DKL R++ ++G   L G+ ++         +K
Sbjct  339  NLDFNVYMSAAFNALMDLPANLITLFLVDKLSRKNALIGFTALGGISSVLIFALQNMRIK  398

Query  542  ---AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
               A+Q+ LE++++F AC+AFN+ +IYT+ELFPTCVRNSA+AMARQA+V+GG  SP++VA
Sbjct  399  NHGALQLVLELMSYFCACSAFNMEMIYTIELFPTCVRNSAIAMARQALVLGGVFSPIMVA  458

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             GR N  +S+G+FGLA  L  LF V LPET G DLCDT+DEEE ++
Sbjct  459  AGRKNGVWSFGLFGLAIGLLGLFTVGLPETRGSDLCDTMDEEECRD  504



>emb|CDY22274.1| BnaC02g25780D [Brassica napus]
Length=518

 Score =   262 bits (670),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/292 (48%), Positives = 206/292 (71%), Gaps = 10/292 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP-PEtrssit  178
            G+SWR LY++T +P IIY V+V     ESPRWL++RG  ++ +  +K +A  P +  +++
Sbjct  224  GNSWRILYIWTSVPTIIYCVLVRYFVCESPRWLFVRGRREEAISILKRVASIPMSDGTMS  283

Query  179  rttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGV  358
             +++ ++ +D+        +++Y+A+K+L+ K WALRRL  VM VA GIGLVYYG+PL +
Sbjct  284  FSSLPTEEEDE-----KPSVNIYAAMKVLVEKRWALRRLTAVMAVAFGIGLVYYGMPLAL  338

Query  359  GEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
              + FN+Y+S   NA+ +LPA+L+TL L+DKL RR+ ++G   L GV ++         +
Sbjct  339  SNLDFNVYMSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGGVSSVLIFALPNMRI  398

Query  539  KA---VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLV  709
             +   +Q+ LE++++F AC+AFNI +IYT+ELFPTCVRNSA+AM RQA+V+GG  SP++V
Sbjct  399  GSHGTLQLVLELISYFCACSAFNIEMIYTIELFPTCVRNSAIAMTRQALVLGGVFSPIMV  458

Query  710  ALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE-NGNR  862
            A GR N F+S+G+FGLA  L  LF V+LPET G DLCDT+DEEE K+  GN 
Sbjct  459  AAGRKNGFWSFGLFGLAIGLLGLFAVALPETRGSDLCDTMDEEECKDRQGNN  510



>ref|XP_006416822.1| hypothetical protein EUTSA_v10007377mg [Eutrema salsugineum]
 gb|ESQ35175.1| hypothetical protein EUTSA_v10007377mg [Eutrema salsugineum]
Length=518

 Score =   262 bits (669),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/283 (49%), Positives = 191/283 (67%), Gaps = 6/283 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWRY+Y+ T IP +IY  +V +  RESPRWL ++G  ++ +  ++++A     +    
Sbjct  233  GNSWRYMYVLTSIPTLIYCSLVGVFVRESPRWLIVKGRKEEAISILQSIAS-NAITMSFS  291

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                   +D+         D++ ALK+L+ K W+LRRLL VM V  GIG+VYYG+PL + 
Sbjct  292  NLSLDVQEDRS----KSNPDVFDALKILVRKPWSLRRLLAVMAVGFGIGMVYYGMPLALT  347

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLYL    NA+SELPA L+T   IDK+ RR  ++G   L+GV ++     VG+ + 
Sbjct  348  NLNFNLYLGVVFNALSELPAFLITFFFIDKINRRDALIGFTALTGVSSVLIAA-VGQRIG  406

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            ++QI LE+V+FF+ CTAFN+ LIYT+ELFPTCVRNSA+AM RQA+V GG  SP++VA GR
Sbjct  407  SLQIVLELVSFFSVCTAFNMTLIYTIELFPTCVRNSAIAMVRQALVFGGVFSPVMVAAGR  466

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             N+F+SYG+FGL   L  LF+V LPET G  LCDT+DEEE K 
Sbjct  467  ENQFWSYGLFGLIIGLFGLFVVGLPETRGSVLCDTMDEEEYKN  509



>ref|XP_002265206.1| PREDICTED: organic cation/carnitine transporter 2-like [Vitis 
vinifera]
Length=526

 Score =   262 bits (669),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 140/292 (48%), Positives = 202/292 (69%), Gaps = 23/292 (8%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY++T IP I Y +++  +  ESPRWL+++G  ++ + T++ +AP E        
Sbjct  244  SSWRLLYVWTSIPAIFYCLLIRFLVCESPRWLFMQGRKEEALATLEKLAPME--------  295

Query  185  tiFSDNQDQGLIDL----------DEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLV  334
                +N     +DL            +M+L+ ++K+L+ K WA RRLL VM +A GIG++
Sbjct  296  ----NNTSLKSLDLCLSGALLKQEKMKMNLHLSIKMLLEKRWASRRLLAVMVIAFGIGIM  351

Query  335  YYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgc  514
            YYG+PLGVG + +NLYLS TLN ++E+P+SL+T+  I K  RRS+V+ L  +SGV ++ C
Sbjct  352  YYGMPLGVGNLAYNLYLSVTLNVLAEMPSSLITMFYIGKWSRRSSVLALTTISGVSSIMC  411

Query  515  vvFVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAI  694
            VV VG  +K +Q+GLE+++FF ACT F++L+IYTLELFPTCVR+ AVAM RQA++  G +
Sbjct  412  VV-VGHGMKELQVGLELISFFCACTVFSVLMIYTLELFPTCVRSLAVAMVRQALMSSGTV  470

Query  695  SPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            S +L+A G+ N F SYGVFGL  + C LF+V LPET G  LCDT++E+E KE
Sbjct  471  STILIAAGKTNAFLSYGVFGLLILCCGLFVVCLPETKGLSLCDTMEEQEHKE  522



>ref|XP_006301897.1| hypothetical protein CARUB_v10022372mg [Capsella rubella]
 gb|EOA34795.1| hypothetical protein CARUB_v10022372mg [Capsella rubella]
Length=523

 Score =   261 bits (668),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 133/292 (46%), Positives = 202/292 (69%), Gaps = 10/292 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWR LY++T IP I+Y V+V     ESPRWL++RG  ++ +  +K +A  +  +    
Sbjct  227  GNSWRILYVWTSIPTIVYCVLVRFFVCESPRWLFVRGRREEAISILKRVASTDAHAISMS  286

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             +     +++   +     ++++A+K+L+ K WAL+RL  VM +A GIGLVYYG+PL + 
Sbjct  287  FSSLPFQEEE---EKPSNGNIFTAMKVLVEKRWALKRLSAVMAIAFGIGLVYYGMPLALS  343

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+YLS   NA+ +LPA+L+TL L+DKL RR+ ++G   L G+ ++    F  + ++
Sbjct  344  NLDFNIYLSAAFNALMDLPANLITLFLVDKLSRRNALLGFTALGGISSVLI--FALQNMR  401

Query  542  -----AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
                 A+Q+ LE++++F+AC+AFN+ +IYT+ELFPTCVRNSA+AMARQA+V+GG  SP++
Sbjct  402  IGNHGALQLALELISYFSACSAFNMEMIYTIELFPTCVRNSAIAMARQALVLGGVFSPIM  461

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNR  862
            VA GR N  +S+G+FGLA  L  LF V LPET G DLCDT+DEEE K+  ++
Sbjct  462  VAAGRKNGIWSFGLFGLAIGLLGLFAVGLPETRGSDLCDTMDEEECKDQRSK  513



>ref|NP_178054.1| organic cation/carnitine transporter 2 [Arabidopsis thaliana]
 sp|O64515.1|OCT2_ARATH RecName: Full=Organic cation/carnitine transporter 2; Short=AtOCT2 
[Arabidopsis thaliana]
 gb|AAC17057.1| Similar to liver-specific transport protein gb|L27651 from Rattus 
norviegicus [Arabidopsis thaliana]
 gb|AEE36234.1| organic cation/carnitine transporter 2 [Arabidopsis thaliana]
Length=527

 Score =   261 bits (668),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 139/299 (46%), Positives = 202/299 (68%), Gaps = 15/299 (5%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP-PE------  160
            GSSWR LY +T IP IIY V+V     ESPRWL++RG  ++ +  +K +A  P       
Sbjct  226  GSSWRILYAWTSIPTIIYCVLVRFFVCESPRWLFVRGRREEAISILKRVASIPSTDVSSG  285

Query  161  -trssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVY  337
               S    +  F +++++        +++++ +K+L+ K WAL+RL  VM +A GIGLVY
Sbjct  286  GAISMSFSSLPFEEDEEKP----STNVNIFTTMKVLVEKRWALKRLSAVMAIAFGIGLVY  341

Query  338  YGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcv  517
            YG+PL +  + FN+YLS   NA+ +LPA+L+TL L+DKL RR+ ++G   L GV ++   
Sbjct  342  YGMPLALSNLDFNIYLSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGGVSSVLIF  401

Query  518  vFVGEELK---AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGG  688
                  +    A+Q+ LE++++F+AC+AFN+ +IYT+ELFPTCVRNSA+AMARQA+V+GG
Sbjct  402  ALHNMRIGNHGALQLALELISYFSACSAFNMEMIYTIELFPTCVRNSAIAMARQALVLGG  461

Query  689  AISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV  865
              SP++VA GR N F+S+G+FGLA  L  LF V LPET G DLCDT+DEEE K+  ++V
Sbjct  462  VFSPIMVAAGRKNAFWSFGLFGLAIGLLGLFAVGLPETRGSDLCDTMDEEECKDRRSKV  520



>gb|EYU27594.1| hypothetical protein MIMGU_mgv1a018738mg, partial [Erythranthe 
guttata]
Length=519

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/285 (52%), Positives = 211/285 (74%), Gaps = 4/285 (1%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G SWR +Y++T +P + YS+ V+ + RESPRWLY++G  ++F ET++++A P T  S   
Sbjct  235  GYSWRLMYIWTCVPSVFYSLSVFFLIRESPRWLYIKGRKEEFAETLRSIAAP-TNRSSLT  293

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             + F    + G     E+ D++SA+K+L+++ W+ RRL+ V  V  GIG++YYG+PLG+G
Sbjct  294  QSFFGRCTEWGDDQKPEETDIFSAVKILLSRRWSRRRLVAVTVVGFGIGMIYYGMPLGLG  353

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + F+LYLS TLNA+SE PAS +T +LI KL R+ +++GL +LSG+C++GC   V    +
Sbjct  354  NLSFDLYLSVTLNALSEFPASFLTFVLIGKLDRKGSILGLSLLSGMCSVGC---VVVTWQ  410

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
              QI LE+V+FF+ACTAF+++LIYTLELFPTCVRNSAV+M RQA+V GGA+SP+LVA GR
Sbjct  411  VTQIALELVSFFSACTAFDVVLIYTLELFPTCVRNSAVSMVRQALVFGGALSPVLVAAGR  470

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
             NRF SYGVFG+   +C LF+  LPET G  LCDT++EEE K++ 
Sbjct  471  KNRFLSYGVFGVGVSVCALFVGLLPETRGRVLCDTLEEEERKDDA  515



>ref|XP_009110451.1| PREDICTED: organic cation/carnitine transporter 3 isoform X1 
[Brassica rapa]
Length=510

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/283 (49%), Positives = 195/283 (69%), Gaps = 9/283 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G+SWRYLY++T IP ++Y V+V     ESPRWL ++G  ++ V  ++++       S + 
Sbjct  229  GNSWRYLYVWTSIPTLLYCVLVRFFVWESPRWLIVKGRKEEAVSILQSIGSNAITMSFSD  288

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
              +  D QD          D+Y AL++L+ K W+LRRLL VM V  GIG+VYYG+PL + 
Sbjct  289  LCL--DVQD------SSNPDVYDALRILVKKPWSLRRLLAVMAVGFGIGMVYYGMPLTLS  340

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLYL    NA+SELPA L+T   ++ ++RR  ++G   LSG+ ++     +G+++ 
Sbjct  341  NLNFNLYLGVVFNALSELPAFLITFFFMNTIKRREALIGFTALSGISSVLIAS-LGQQIG  399

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            ++QI LE+V+FF+ACTAFN+ LIYT+ELFPTCVRNSA+AM RQA+V GG  SP++VA GR
Sbjct  400  SLQIVLELVSFFSACTAFNMTLIYTIELFPTCVRNSALAMVRQALVFGGVFSPVMVAAGR  459

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             N+F+SYG+FGL   L  LF+V LPET G  LCDT+DEEESK 
Sbjct  460  ENQFWSYGMFGLVIGLFGLFVVGLPETRGSVLCDTMDEEESKN  502



>ref|XP_010063993.1| PREDICTED: organic cation/carnitine transporter 3-like [Eucalyptus 
grandis]
 gb|KCW71281.1| hypothetical protein EUGRSUZ_F04368 [Eucalyptus grandis]
Length=524

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 192/286 (67%), Gaps = 8/286 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LY++T  P I Y V+V+ +  ESPRWL+  G  ++ +E++K +APP   +    
Sbjct  237  GSSWRILYIWTAAPAIGYCVLVHFLVCESPRWLFGMGRREEAMESLKRIAPPGASALTNG  296

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             +  S N+          MD++SA+K L+ K WA RRL  VM +  G+G+VYYG+PLGVG
Sbjct  297  FSSVSLNEYP-----INNMDIFSAIKALLEKRWAFRRLCAVMLIGFGVGMVYYGMPLGVG  351

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLY   TLNA++ELP++LVT LLI KL RRS+ +              +  G+  +
Sbjct  352  NLDFNLYSIITLNALAELPSTLVTFLLIGKLNRRSS-LLFFTTLSGVFSVMCILEGQVWQ  410

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVAL-G  718
             +QI LE+V+FF+ CTA ++LLI+TLELFPT VRN+A++M RQA+V GG  SPLLVA+ G
Sbjct  411  KLQIVLELVSFFSGCTALDVLLIFTLELFPTSVRNTAMSMVRQAVVFGGVFSPLLVAVAG  470

Query  719  R-GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            R G+   S+GVFGL    C LF++ LPET GG+LCDT+DEEE KE+
Sbjct  471  RTGDSVVSFGVFGLVIGCCGLFVMCLPETRGGNLCDTMDEEERKED  516



>ref|XP_010417600.1| PREDICTED: organic cation/carnitine transporter 2-like isoform 
X1 [Camelina sativa]
Length=379

 Score =   254 bits (650),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 135/307 (44%), Positives = 201/307 (65%), Gaps = 32/307 (10%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LY++T IP +IY ++V     ESPRWL++RG  ++ +  +K +A   +      
Sbjct  75   GSSWRILYVWTSIPTMIYCILVRFFVCESPRWLFVRGRREEAISILKRVASIPS------  128

Query  182  ttiFSDNQDQGLIDLD---------------EQMDLYSALKLLINKGWALRRLLTVMWVA  316
                +D    G I +                  +++++ +K+L+ K WAL+RL  VM +A
Sbjct  129  ----TDVNSGGAISMSFSSLPFEEEEEEKKPSNVNIFTTMKVLVEKRWALKRLSAVMAIA  184

Query  317  LGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsg  496
             GIGLVYYG+PL +  + FN+YLS   NA+ +LPA+L+TL L+DKL RR+ ++G   L G
Sbjct  185  FGIGLVYYGMPLALSNLDFNIYLSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGG  244

Query  497  vcnlgcvvFVGEELK-----AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAM  661
            + ++    F  + ++     A+Q+ LE++++F+AC+AFN+ +IYT+ELFPTCVRNSA+AM
Sbjct  245  ISSVLI--FALQNMRIGNHGALQLALELISYFSACSAFNMEMIYTIELFPTCVRNSAIAM  302

Query  662  ARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEE  841
            ARQA+V+GG  SP++VA GR N  +S+G+FGLA  L  LF V LPET G DLCDT+DEEE
Sbjct  303  ARQALVLGGVFSPIMVAAGRKNGVWSFGLFGLAIGLMGLFAVGLPETRGSDLCDTMDEEE  362

Query  842  SKENGNR  862
             K+  ++
Sbjct  363  CKDQRSK  369



>gb|KHN21866.1| Organic cation/carnitine transporter 2 [Glycine soja]
Length=371

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/291 (47%), Positives = 191/291 (66%), Gaps = 16/291 (5%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSWR LYL+T I  + Y ++V L   ESPRWL +RG T++ VET+K +      +    
Sbjct  83   SSSWRNLYLWTSISTMFYCILVKLFVTESPRWLLVRGKTEEAVETLKCITSITQSNLNLA  142

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                S  ++         +D++SALK+L+ K W+ RRL  +M + +GIGLVYYG+PLG+ 
Sbjct  143  INNMSHKEETW------NVDIFSALKILLQKKWSSRRLSLIMAMGIGIGLVYYGMPLGLQ  196

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLYLS T NA+SELP++L+ L  +DK  RR  ++   +LSGV ++  ++    E+K
Sbjct  197  NLSFNLYLSVTFNALSELPSALIVLFFVDKFNRRVALLLFTILSGVFSVMSIM----EMK  252

Query  542  A------VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
                   +QI  E+V+FF+AC++FN+ LIYT ELFPTCVRNSA++MAR A+V+GG  SPL
Sbjct  253  TSSWTNNIQIVFELVSFFSACSSFNVYLIYTTELFPTCVRNSALSMARLAVVLGGTFSPL  312

Query  704  LVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            LV+  RGN+F  YGVFGL      +F + LPET G  LCDT+DEEE+KE  
Sbjct  313  LVSAARGNKFMCYGVFGLVIGFSGVFGIFLPETKGRALCDTMDEEENKEKN  363



>gb|KFK42341.1| hypothetical protein AALP_AA2G243700 [Arabis alpina]
Length=529

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/292 (47%), Positives = 199/292 (68%), Gaps = 5/292 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMA--PPEtrssi  175
            G SWR LY++T IP IIY V+V     ESPRWL++RG  ++ +  +K +A  P  T  + 
Sbjct  229  GKSWRVLYVWTSIPTIIYCVLVRYFVCESPRWLFVRGRREEAISILKRVASIPKNTDVNN  288

Query  176  trttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLG  355
                  S  + +        +++Y ++K+L+ K WAL+RL  +M VA GIGLVYYG+PL 
Sbjct  289  GGVISMSFEEGEEEEYEKPSVNIYESMKVLVGKRWALKRLSAIMAVAFGIGLVYYGMPLA  348

Query  356  VGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEE  535
            + ++ FN+YLS   NA+ +LPA+L+TL L+DKL RR+ ++G   L GV ++         
Sbjct  349  LSDLDFNIYLSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGGVSSVLIFALQNMR  408

Query  536  LK---AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
            +    A+Q+ LE++++F+AC+AFN+ +IYT+ELFPTCVRNSA+A+ARQA+V+GG  SP++
Sbjct  409  IGNHGALQLALELISYFSACSAFNMEMIYTIELFPTCVRNSAIALARQALVLGGVFSPIM  468

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNR  862
            VA GR N F+S+G+FGLA  L  L +V LPET G DLCDT+DEEE K+  ++
Sbjct  469  VAAGRKNGFWSFGLFGLAIGLLGLCVVGLPETRGSDLCDTMDEEECKDQQSK  520



>ref|XP_009340129.1| PREDICTED: organic cation/carnitine transporter 3-like [Pyrus 
x bretschneideri]
Length=530

 Score =   258 bits (658),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/284 (48%), Positives = 190/284 (67%), Gaps = 3/284 (1%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
              SWR LY +T IP ++YS++V+ +  ESPRWL++RG  +D +ET+K +AP  + ++   
Sbjct  236  AHSWRILYFWTSIPTLLYSIMVHFLVCESPRWLFVRGRKEDAIETLKCIAPVNSTTTKAP  295

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             T  S            ++DLYSA+  L+ + WA RRL  VM +  GIG+VYYG+PL +G
Sbjct  296  LTS-SFISSLSFEQETSKVDLYSAIDALVKRKWAFRRLSAVMAIGYGIGMVYYGMPLALG  354

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvls-gvcnlgcvvFVGEEL  538
             + FNLYLS TLNA+SELPASL+T   IDK+ R+++V+    LS     +  +  +    
Sbjct  355  SLEFNLYLSVTLNALSELPASLITFFFIDKMNRKTSVLVFTSLSGVCNIMSVLKGIHPIW  414

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
              +QIG E+V+FF+AC AF +LLI+T+ELFPTCVRNSA+++ RQA+V+GG  SP+L A G
Sbjct  415  TRLQIGFEVVSFFSACLAFGVLLIFTIELFPTCVRNSALSIVRQAVVLGGVFSPMLAASG  474

Query  719  RGN-RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            R N    SYGVFG+   +C  F+V LPET G  +CDT+DEEE K
Sbjct  475  RANGGVLSYGVFGVVIGVCGCFVVCLPETRGRGICDTMDEEEFK  518



>ref|XP_009340128.1| PREDICTED: organic cation/carnitine transporter 3-like [Pyrus 
x bretschneideri]
Length=530

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 135/284 (48%), Positives = 188/284 (66%), Gaps = 3/284 (1%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
              SWR LY +T IP ++YS++V+ +  ESPRWL++RG  +D +ET+K +AP  + ++   
Sbjct  236  AHSWRTLYFWTSIPTLLYSIMVHFLVCESPRWLFVRGRKEDAIETLKCIAPVNSTTTKAP  295

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             T  S            ++DLYSA+  L+ + WA RRL  VM +  GIG+VYYG+PL +G
Sbjct  296  LTS-SFISSLSFEQETSKVDLYSAIDALVKRKWAFRRLSAVMAIGYGIGMVYYGMPLALG  354

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRR-STvvglgvlsgvcnlgcvvFVGEEL  538
             + FNLYLS TLNA+SELPASL+T   IDK+ R+ S +V   +      +  +  +    
Sbjct  355  SLEFNLYLSVTLNALSELPASLITFFFIDKMNRKLSVLVFTSLSGVCSFMSVLKGIHPIW  414

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
              +QIG E+V+FF+AC AF +LLI+T+ELFPTCVRNSA+++ RQA+V+GG  SP+L A G
Sbjct  415  TRLQIGFELVSFFSACLAFGVLLIFTIELFPTCVRNSALSIVRQAVVLGGVFSPMLAASG  474

Query  719  RGN-RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            R N    SYGVFG+   +C  F+V LPET G  +CDT+DEEE K
Sbjct  475  RANGGVLSYGVFGVVIGVCGCFVVCLPETRGRGICDTMDEEEFK  518



>ref|XP_008225999.1| PREDICTED: organic cation/carnitine transporter 3-like [Prunus 
mume]
Length=513

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 141/290 (49%), Positives = 198/290 (68%), Gaps = 10/290 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY++T +PGI+Y V+V+L   ESP+WL+ RG   + V T+  +      S     
Sbjct  231  SSWRTLYMWTSVPGILYCVLVFLFVSESPKWLFTRGRKDEAVATLGRLGHWNHSSLNLYL  290

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +         L++   ++DL+S+LK L  K WA RR L +M V  G+G+VYYG+PLGVG 
Sbjct  291  SSIP------LLEESAEVDLFSSLKNLFEKKWAFRRTLALMSVGFGVGMVYYGMPLGVGN  344

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FN+YLS TLNA+SE+P+  +TL  I K  R+S+++   ++SGVC++ C   V    K 
Sbjct  345  LGFNIYLSLTLNAMSEIPSFALTLFFIGKWYRKSSLLTFMMISGVCSIMC---VVVSSKW  401

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +QIGLEIV+FF+A TAF+IL+IYTLELFPTCVRNSA +M RQ +V+G   SP+L++ GR 
Sbjct  402  LQIGLEIVSFFSANTAFSILMIYTLELFPTCVRNSATSMVRQGLVIGAIFSPVLISAGRN  461

Query  725  -NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV*T  871
             N F+SYGVFG+  + C +F+ SLPET G  LCDT+DE+E KE  +++ T
Sbjct  462  YNEFFSYGVFGVVIICCGVFVFSLPETKGVALCDTMDEQERKEVADQINT  511



>ref|XP_009593309.1| PREDICTED: organic cation/carnitine transporter 3-like [Nicotiana 
tomentosiformis]
Length=477

 Score =   255 bits (652),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 195/287 (68%), Gaps = 40/287 (14%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR +YL+T +P + YS +V+   RESPRWLY+ G                       
Sbjct  220  GSSWRLIYLWTCLPAVFYSFLVHFFVRESPRWLYVIG-----------------------  256

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                           +E ++LYSA+K+L+ K WA RRL+ VM V  G G+VYYG+PL V 
Sbjct  257  -------------QKEEVINLYSAIKMLLEKNWAFRRLVMVMCVGFGFGMVYYGMPLAVE  303

Query  362  EMPFN-LYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEE-  535
             + FN LYLS TLNA+SELPASL T  LI KL R+ +++G  +LSG+C++GC +  G++ 
Sbjct  304  NLAFNNLYLSNTLNALSELPASLATFFLIGKLSRKGSLLGFAMLSGICSIGCCIVEGDKY  363

Query  536  LKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVAL  715
             K +Q+GLE++++F+ACTA ++LLIY LELFPTCVRNSAVAM RQ +V GGA+SP++VA+
Sbjct  364  FKLLQMGLELISYFSACTAVDVLLIYALELFPTCVRNSAVAMVRQTLVFGGALSPIVVAI  423

Query  716  GRGN--RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            GR N  +++SYGVFGL+ + C LF+V LPET G  LCDT++E ESKE
Sbjct  424  GRNNNVKWFSYGVFGLSIITCGLFVVWLPETKGTTLCDTMEEGESKE  470



>ref|XP_010417601.1| PREDICTED: organic cation/carnitine transporter 2-like isoform 
X2 [Camelina sativa]
Length=379

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/307 (44%), Positives = 200/307 (65%), Gaps = 32/307 (10%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LY++T IP +IY ++V     ESPRWL++RG  ++ +  +K +A   +      
Sbjct  75   GSSWRILYVWTSIPTMIYCILVRFFVCESPRWLFVRGRREEAISILKRVASIPS------  128

Query  182  ttiFSDNQDQGLIDLD---------------EQMDLYSALKLLINKGWALRRLLTVMWVA  316
                +D    G I +                  +++++ +K+L+ K WAL+RL  VM +A
Sbjct  129  ----TDVNSGGAISMSFSSLPFEEEEEEKKPSNVNIFTTMKVLVEKRWALKRLSAVMAIA  184

Query  317  LGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsg  496
             GIGLVYY +PL +  + FN+YLS   NA+ +LPA+L+TL L+DKL RR+ ++G   L G
Sbjct  185  FGIGLVYYRMPLALSNLDFNIYLSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGG  244

Query  497  vcnlgcvvFVGEELK-----AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAM  661
            + ++    F  + ++     A+Q+ LE++++F+AC+AFN+ +IYT+ELFPTCVRNSA+AM
Sbjct  245  ISSVLI--FALQNMRIGNHGALQLALELISYFSACSAFNMEMIYTIELFPTCVRNSAIAM  302

Query  662  ARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEE  841
            ARQA+V+GG  SP++VA GR N  +S+G+FGLA  L  LF V LPET G DLCDT+DEEE
Sbjct  303  ARQALVLGGVFSPIMVAAGRKNGVWSFGLFGLAIGLMGLFAVGLPETRGSDLCDTMDEEE  362

Query  842  SKENGNR  862
             K+  ++
Sbjct  363  CKDQRSK  369



>ref|XP_009340545.1| PREDICTED: organic cation/carnitine transporter 3-like [Pyrus 
x bretschneideri]
Length=530

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 135/284 (48%), Positives = 189/284 (67%), Gaps = 3/284 (1%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
              SWR LY +T IP ++YS++V+ +  ESPRWL++RG  +D +ET+K +AP  + ++   
Sbjct  236  AHSWRILYFWTSIPTLLYSIMVHCLVCESPRWLFVRGRKEDAIETLKCIAPVNSTTTKAP  295

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             T  S            ++DLYSA+  L+ + WA RRL  VM +  GIG+VYYG+PL +G
Sbjct  296  LTS-SFISSLSFEQETSKVDLYSAIDALVKRKWAFRRLSAVMAIGYGIGMVYYGMPLALG  354

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvls-gvcnlgcvvFVGEEL  538
             + FNLYLS TLNA+SELPASL+T   IDK+ R+++V+    LS     +  +  +    
Sbjct  355  SLEFNLYLSVTLNALSELPASLITFFFIDKMNRKTSVLVFTSLSGVCNIMSVLKGIHPIW  414

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
              +QIG E+V+FF+AC AF +LLI+T+ELFPTCVRNSA+++ RQA+V+GG  SP+L A G
Sbjct  415  TRLQIGFEVVSFFSACLAFGVLLIFTIELFPTCVRNSALSIVRQAVVLGGVFSPMLAASG  474

Query  719  RGN-RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            R N     YGVFG+   +C  F+V LPET G  +CDT+DEEE K
Sbjct  475  RANGGVLPYGVFGVVIGVCGCFVVCLPETRGRGICDTMDEEEFK  518



>ref|XP_004514443.1| PREDICTED: organic cation/carnitine transporter 3-like isoform 
X1 [Cicer arietinum]
Length=537

 Score =   254 bits (650),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 133/281 (47%), Positives = 185/281 (66%), Gaps = 5/281 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LYL+T IP I Y ++V +  +ESPRWL +RG  ++ + T+K +      +     
Sbjct  253  SSWRNLYLWTSIPTIFYCMLVKIFVQESPRWLLVRGQKEEAIATLKYITSITQSNLNLAI  312

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
               S +Q++  +++D    ++ ALK+L+ K WA RRL+ +M + LGIG+VYYG+PLG+G 
Sbjct  313  NNISPHQEENNLNVD----MFYALKMLLEKKWASRRLILIMAMGLGIGVVYYGMPLGLGN  368

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FN+YL  T NA+SELP+SL+T   IDK RRR   + +  L            G+    
Sbjct  369  LSFNIYLGVTFNAISELPSSLITFFFIDKFRRR-IALLVFCLISGICSVMSTIEGKIWSQ  427

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +QIG E+++FF+ACT+F + LIYT ELFPTCVRNSA++MAR A+V GGA SPLLV+ GR 
Sbjct  428  MQIGFELISFFSACTSFGVYLIYTTELFPTCVRNSALSMARLAVVFGGAFSPLLVSAGRA  487

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            N    YGVFGLA  +  +F V LPET   +L DT+DEEE+K
Sbjct  488  NMVLCYGVFGLAIGVSGVFGVFLPETKDRELSDTMDEEENK  528



>ref|XP_007212860.1| hypothetical protein PRUPE_ppa021519mg, partial [Prunus persica]
 gb|EMJ14059.1| hypothetical protein PRUPE_ppa021519mg, partial [Prunus persica]
Length=510

 Score =   253 bits (647),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 139/290 (48%), Positives = 196/290 (68%), Gaps = 10/290 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY++T +PGI+Y V+V+L   ESP+WL+ RG   + V T+  +      S     
Sbjct  228  SSWRTLYMWTSVPGILYCVLVFLFVSESPKWLFTRGRKDEAVATLGRLGHWNHSSLNLYL  287

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +         L++   ++DL+S++K L  K WA RR L +M V  G+G+VYYG+PLGVG 
Sbjct  288  SSIP------LLEESAEVDLFSSVKNLFEKKWAFRRTLALMSVGFGVGMVYYGMPLGVGN  341

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FN+YLS TLNA+SE+P+  +TL  I K  R+S+++   + SGVC++ C V      K 
Sbjct  342  LGFNIYLSLTLNAMSEIPSFALTLFFIGKWNRKSSLLTFMMTSGVCSIMCAVVSS---KW  398

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +QIGLEIV+FF+A TAF+IL+IYTLELFPTCVRNSA +M RQ +V+G   SP+L++ GR 
Sbjct  399  MQIGLEIVSFFSANTAFSILMIYTLELFPTCVRNSATSMVRQGLVIGAIFSPVLISAGRN  458

Query  725  -NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV*T  871
             N F+SYGVFG+  + C +F+  LPET G  LCDT+DE+E KE  +++ T
Sbjct  459  YNEFFSYGVFGVVIICCGVFVFPLPETKGVALCDTMDEQERKEVTDQINT  508



>ref|XP_010092477.1| Organic cation/carnitine transporter 3 [Morus notabilis]
 gb|EXB51243.1| Organic cation/carnitine transporter 3 [Morus notabilis]
Length=520

 Score =   252 bits (644),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 140/291 (48%), Positives = 196/291 (67%), Gaps = 10/291 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LY++T IP I YS+ V+ +  ESPRWL++RG  +   E +K+MA  +  +    
Sbjct  229  GSSWRNLYIWTSIPAIFYSLAVHFLVCESPRWLFVRGRKE---EAVKSMA--QISNDQNI  283

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
               F  N           +DLYSA+K+L+ + WA RRL TVM +  GIG+VYYG+PL +G
Sbjct  284  IMSFPSNM--AFEQETWNVDLYSAIKILVERKWAFRRLSTVMAIGFGIGMVYYGMPLALG  341

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
            ++ FNLYLS   NA+SELP+S VT  L++K+ R+S+++    LSG+C++  V+       
Sbjct  342  DLDFNLYLSVVFNALSELPSSFVTFFLVEKVNRKSSLLFFTSLSGICSVMSVLRGKLIFT  401

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG-  718
             +QIG E+++FF+ACTA  +L+I+T+ELFPTCVRNSAVAM RQA+V GG  SP+L A G 
Sbjct  402  RLQIGFELLSFFSACTAAEMLMIFTIELFPTCVRNSAVAMLRQALVFGGVFSPVLAAAGR  461

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE--NGNRV  865
            R + F SY VFG+      LF+V LPET G  +CDT+DEEE+K+  N +R+
Sbjct  462  RSDGFVSYVVFGIVIGCFGLFVVCLPETRGTAICDTMDEEENKDKINASRI  512



>ref|XP_003528188.1| PREDICTED: organic cation/carnitine transporter 3-like [Glycine 
max]
Length=534

 Score =   252 bits (643),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 137/288 (48%), Positives = 191/288 (66%), Gaps = 10/288 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LYL+T I  ++Y ++V L   ESPRWL +RG T++ VET+K +      +     
Sbjct  245  SSWRNLYLWTSISTMLYCILVKLFVTESPRWLLVRGKTEEAVETLKCITSITQSNLNLAI  304

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
               S  ++         +D++SALK+L+   W+ RRL ++M + +GIGLVYYG+PLG+  
Sbjct  305  NNMSHEEETC------DVDIFSALKILLQNKWSSRRLSSIMAMGIGIGLVYYGMPLGLQN  358

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FNLYLS   NA+SELP++L+ L  IDK  RR T++   +LSG+ ++   V V +   +
Sbjct  359  LSFNLYLSVIFNALSELPSALIVLFFIDKFNRRITLLLFTILSGLFSVMSTVQVSKSSSS  418

Query  545  ----VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
                VQI  E+V+FF+ACT+FN+ LIYT ELFPTCVRNSA++MAR A+V+GG  SPLLV+
Sbjct  419  WNNNVQIVFELVSFFSACTSFNVYLIYTTELFPTCVRNSALSMARLAVVLGGMFSPLLVS  478

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
             GRGN+F  YGVFGL      +F + LPET G   CD++DEEE+KE  
Sbjct  479  AGRGNKFLCYGVFGLVIGFSGVFGIFLPETKGRAFCDSMDEEENKEKN  526



>ref|XP_010429819.1| PREDICTED: organic cation/carnitine transporter 2-like isoform 
X2 [Camelina sativa]
Length=475

 Score =   250 bits (638),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 133/295 (45%), Positives = 199/295 (67%), Gaps = 8/295 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMA--PPEtrssi  175
            GSSWR LY++T +P I+Y V+V     ESPRWL++RG  ++ +  +K +A  P  T  +I
Sbjct  171  GSSWRILYIWTSVPTIVYCVLVRFFVCESPRWLFVRGRREEAISILKRVASIPSSTDVNI  230

Query  176  trttiFSDNQ---DQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
                  S +    ++   +    + +++ +K+L+ K WAL+RL  VM +A GIGLVYYG+
Sbjct  231  GGAISMSFSSLPFEEEEEEKPSNVSIFTTMKVLVEKRWALKRLSAVMAIAFGIGLVYYGM  290

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
            PL +  + FN+YLS   NA+ +LPA+L+TL L+DKL RR+ ++G   L G+ ++      
Sbjct  291  PLALSNLDFNIYLSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGGISSVLIFALQ  350

Query  527  GEELK---AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAIS  697
               ++   A+Q+ LE++++F+AC+AFN+ +IYT+ELFPTCVRNSA+AMARQA+V+GG  S
Sbjct  351  NMRIRNHGALQLALELISYFSACSAFNMEMIYTIELFPTCVRNSAIAMARQALVLGGVFS  410

Query  698  PLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNR  862
            P++VA GR N  +S+G+FGLA     LF V LPET G  LCDT+DEEE K+  ++
Sbjct  411  PIMVAAGRKNGVWSFGLFGLAIGFMGLFAVGLPETRGSVLCDTMDEEECKDQRSK  465



>ref|XP_010092476.1| Organic cation/carnitine transporter 3 [Morus notabilis]
 gb|EXB51242.1| Organic cation/carnitine transporter 3 [Morus notabilis]
Length=520

 Score =   251 bits (641),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 139/291 (48%), Positives = 195/291 (67%), Gaps = 10/291 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LY++T IP I YS+ V+ +  ESPRWL++RG  +   E +K+MA  +  +    
Sbjct  229  GSSWRNLYIWTSIPAIFYSLAVHFLVCESPRWLFVRGRKE---EAVKSMA--QISNDQNI  283

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
               F  N           +DLYSA+K+L+ + WA RRL TVM +  GIG+VYYG+PL +G
Sbjct  284  IMSFPSNM--AFEQETWNVDLYSAIKILVERKWAFRRLSTVMAIGFGIGMVYYGMPLALG  341

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
            ++ FNLYLS   NA+SELP+S VT  L++K+ R+S+++    LSG+C++  V+       
Sbjct  342  DLDFNLYLSVVFNALSELPSSFVTFFLVEKVNRKSSLLFFTSLSGICSVMSVLRGKLIFT  401

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG-  718
             +QIG E+++FF+ACTA  +L+I+T+E FPTCVRNSAVAM RQA+V GG  SP+L A G 
Sbjct  402  RLQIGFELLSFFSACTAAEMLMIFTIEFFPTCVRNSAVAMLRQALVFGGVFSPVLAAAGR  461

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE--NGNRV  865
            R + F SY VFG+      LF+V LPET G  +CDT+DEEE+K+  N +R+
Sbjct  462  RSDGFVSYVVFGIVIGCFGLFVVCLPETRGTAICDTMDEEENKDKINASRI  512



>ref|XP_010429818.1| PREDICTED: organic cation/carnitine transporter 2-like isoform 
X1 [Camelina sativa]
Length=530

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 196/304 (64%), Gaps = 26/304 (9%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LY++T +P I+Y V+V     ESPRWL++RG  ++ +  +K +A   +      
Sbjct  226  GSSWRILYIWTSVPTIVYCVLVRFFVCESPRWLFVRGRREEAISILKRVASIPSS-----  280

Query  182  ttiFSDNQDQGLIDLD--------------EQMDLYSALKLLINKGWALRRLLTVMWVAL  319
                +D    G I +                 + +++ +K+L+ K WAL+RL  VM +A 
Sbjct  281  ----TDVNIGGAISMSFSSLPFEEEEEEKPSNVSIFTTMKVLVEKRWALKRLSAVMAIAF  336

Query  320  GIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgv  499
            GIGLVYYG+PL +  + FN+YLS   NA+ +LPA+L+TL L+DKL RR+ ++G   L G+
Sbjct  337  GIGLVYYGMPLALSNLDFNIYLSAAFNALMDLPANLITLFLVDKLSRRNALIGFTALGGI  396

Query  500  cnlgcvvFVGEELK---AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQ  670
             ++         ++   A+Q+ LE++++F+AC+AFN+ +IYT+ELFPTCVRNSA+AMARQ
Sbjct  397  SSVLIFALQNMRIRNHGALQLALELISYFSACSAFNMEMIYTIELFPTCVRNSAIAMARQ  456

Query  671  AMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            A+V+GG  SP++VA GR N  +S+G+FGLA     LF V LPET G  LCDT+DEEE K+
Sbjct  457  ALVLGGVFSPIMVAAGRKNGVWSFGLFGLAIGFMGLFAVGLPETRGSVLCDTMDEEECKD  516

Query  851  NGNR  862
              ++
Sbjct  517  QRSK  520



>ref|XP_010676187.1| PREDICTED: organic cation/carnitine transporter 3-like [Beta 
vulgaris subsp. vulgaris]
Length=515

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/282 (47%), Positives = 194/282 (69%), Gaps = 8/282 (3%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LYL+T  P +IY V+V +  +ESPRWL ++G  Q+ ++ +K +A      S    +
Sbjct  233  SWRALYLWTSAPALIYCVLVMVFVKESPRWLLIQGRRQEAMDALKNIA--TLHQSSLTLS  290

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
             F + +        +  D+YSA+++++++ WA+RRL+TV W+ +GIG+VYYG+PL +G +
Sbjct  291  FFGEEE----APRGDDTDVYSAMRVMVSRPWAIRRLITVSWMCVGIGVVYYGMPLALGNL  346

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV  547
            PFNLY S TLNA+SELP S +T +LI++L RR  ++G  ++SGV ++  V  +   L  +
Sbjct  347  PFNLYFSVTLNALSELPGSFLTFVLINRLDRRPAIIGFTLVSGVLSILVV--LAGNLMGL  404

Query  548  QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGN  727
            Q+GLEI++F  A +  N++LI+T+ELFPTCVRNSAV+MARQA+V GGA +P LVA GR N
Sbjct  405  QVGLEILSFLCAVSGLNLMLIFTIELFPTCVRNSAVSMARQALVFGGAFAPPLVAAGRQN  464

Query  728  RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             F +YGVFG+   +C +F   LPET G  L DT+DEEE K  
Sbjct  465  PFIAYGVFGVVIGVCGMFAFFLPETRGTALADTMDEEEDKAQ  506



>gb|EYU33804.1| hypothetical protein MIMGU_mgv1a019372mg, partial [Erythranthe 
guttata]
Length=513

 Score =   249 bits (637),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 140/281 (50%), Positives = 198/281 (70%), Gaps = 3/281 (1%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR +YL+T +P ++YS++VY    ESPRWL+ +G  Q+F +++KT+A PE +SS+T +
Sbjct  235  SSWRLIYLWTCVPCVLYSLLVYFAVEESPRWLFFKGRRQEFEKSLKTLASPENQSSLTES  294

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
              F ++ D G+ +   + +L+SAL +L+ + WA RRL+    VA G+GL+Y G+PL +G 
Sbjct  295  F-FCNSVDWGVEEKPREYNLFSALGILLKRPWAFRRLILTAAVAFGLGLMYTGMPLSLGN  353

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  NL+LS  +NA+SELPAS+  +LL+ KL RR +++GL VLSGVC+  C   V    K 
Sbjct  354  LSVNLHLSVAVNALSELPASVAAILLVGKLNRRGSILGLAVLSGVCSAACAAAV--TWKG  411

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +Q+ LE+V+FF  C AF++ +IY LELFPTCVRNSAVAM RQA+ VGG +SP+LVA GR 
Sbjct  412  LQVSLELVSFFCTCAAFDVFMIYALELFPTCVRNSAVAMVRQAVAVGGVVSPVLVAAGRK  471

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            N +  YGV G    +  LF+V LPET G   CDT++EEE K
Sbjct  472  NGWVFYGVCGGIVCVSGLFVVWLPETRGRTPCDTMEEEELK  512



>ref|XP_007138201.1| hypothetical protein PHAVU_009G189000g [Phaseolus vulgaris]
 gb|ESW10195.1| hypothetical protein PHAVU_009G189000g [Phaseolus vulgaris]
Length=521

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 135/284 (48%), Positives = 191/284 (67%), Gaps = 7/284 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSWR LYL+T I  IIY ++V +   ESPRWL +RG  ++ V T+K +      +    
Sbjct  238  NSSWRNLYLWTSITTIIYCILVKVFVTESPRWLLVRGRREEAVATLKCITSVTQSNVDLA  297

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                S  ++         +DL+SALK+L+ K W+ RRL+++M + +GIGLVYYG+PLG+ 
Sbjct  298  INNMSHKEETW------NVDLFSALKILLQKKWSSRRLVSIMAMGIGIGLVYYGMPLGLQ  351

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLYLS T NA+SELP++L+    IDK  RR  ++   +LSGV ++  V+ V +   
Sbjct  352  NLSFNLYLSVTFNALSELPSALIVFFFIDKFDRRPALLLFTILSGVFSVMSVIEV-KPWT  410

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             +QI  E+++FF+AC++FN+ LIYT ELFPTCVRNSA++MAR A+V+GGA SP+LV+ GR
Sbjct  411  NLQIVFELISFFSACSSFNVYLIYTTELFPTCVRNSALSMARLAVVLGGAFSPMLVSAGR  470

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             N+F  YGVFGL      ++ + LPET G  LCDT+DEEE+KE 
Sbjct  471  ENKFLCYGVFGLVIGFSGIYGIFLPETRGRALCDTLDEEENKEK  514



>ref|XP_007214739.1| hypothetical protein PRUPE_ppa025144mg, partial [Prunus persica]
 gb|EMJ15938.1| hypothetical protein PRUPE_ppa025144mg, partial [Prunus persica]
Length=523

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 191/285 (67%), Gaps = 3/285 (1%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
              SWR LY  T IP  +Y ++V+ +  ESPRWL+LRG  ++ + T+K +AP    S+ T 
Sbjct  236  AHSWRTLYFCTSIPTFLYCIMVHFLVHESPRWLFLRGRKEEAIATLKHIAPINATSTKTP  295

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             T  S   +         +DLYSA+K+L+   WA RRL  VM +  G+G+VYYG+PL +G
Sbjct  296  LTS-SFFSNLSFEQETRNVDLYSAIKVLVKSRWAFRRLSAVMAIGFGVGMVYYGMPLALG  354

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL-  538
             + FNLYLS T N +SELPASL+TL+ I K+ R+++++    LSGV ++  V+     + 
Sbjct  355  SLDFNLYLSVTFNGLSELPASLITLVCIAKMNRKTSLLVFTSLSGVFSIMSVLKGTHPIW  414

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
              +QI  E+V+FF+AC+A N+LLI+T+ELFPTCVRNSAV+M RQA+V+GG  SP+L A G
Sbjct  415  TTLQIVFELVSFFSACSALNVLLIFTVELFPTCVRNSAVSMVRQAVVLGGVFSPMLAAAG  474

Query  719  RGN-RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            R N  F SYGVFG+   +  LF+V L ET G  +CDT+DEEE K+
Sbjct  475  RVNGGFLSYGVFGVVVGIFGLFVVCLQETRGRGICDTMDEEEYKQ  519



>ref|XP_008225993.1| PREDICTED: LOW QUALITY PROTEIN: organic cation/carnitine transporter 
3-like [Prunus mume]
Length=524

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/290 (46%), Positives = 190/290 (66%), Gaps = 13/290 (4%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP-----PEtr  166
              SWR LY  T IP  +Y ++V  +  ESPRWL++RG  ++ + T+K +AP      +T 
Sbjct  236  AHSWRTLYFCTSIPTFLYCIMVRFLVHESPRWLFVRGRKEEAIATLKHIAPINGTSTKTP  295

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
             + +  +  S  Q+ G       +DLYSA+K+L+ + WA RRL  +M +  G+G+VYYG+
Sbjct  296  LTSSFFSNLSFEQETG------NVDLYSAIKVLVKRRWAFRRLSALMAMGFGVGMVYYGM  349

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvls-gvcnlgcvvF  523
            PL +G + FN+YLS T N +SELPASL+TL+ I K+ R+++++    LS     +  +  
Sbjct  350  PLALGSLDFNIYLSVTFNGLSELPASLITLVFIAKMNRKTSLLVFTSLSGVFSIMSVLKG  409

Query  524  VGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
            +      +QI  E+V+FF+AC+A NILLI+T+ELFPTCVRNSAV+M RQA+V+GG  SP+
Sbjct  410  IHPIWTTIQIVFELVSFFSACSALNILLIFTVELFPTCVRNSAVSMVRQAVVLGGVFSPM  469

Query  704  LVALGRGN-RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            L A GR N  F SYGVFG+   L  LF+V L ET G  +CDT+DEEE K+
Sbjct  470  LAAAGRVNGGFLSYGVFGVVVGLFGLFVVCLQETRGRGICDTMDEEEYKQ  519



>ref|XP_009363330.1| PREDICTED: organic cation/carnitine transporter 3-like [Pyrus 
x bretschneideri]
Length=530

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/292 (48%), Positives = 194/292 (66%), Gaps = 13/292 (4%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP-----PEtr  166
              SWR LY +T IP ++YSV V+ + RESPRWL++RG  +D +ET+K +AP      +T 
Sbjct  236  AHSWRTLYFWTSIPTLLYSVTVHFLVRESPRWLFVRGRKEDAIETLKYIAPVNSTTTKTA  295

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
             + +  +  S   + G       +DLYSA+  L+ + WA RRL  VM +  GIG+VYYG+
Sbjct  296  LTSSFISSLSFEHETG------NVDLYSAINALVKRKWAFRRLSAVMAIGCGIGMVYYGM  349

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvls-gvcnlgcvvF  523
            PL +G + F+LYL  TLNA+SELPASL+    IDK+ R+++++   VLS     +  +  
Sbjct  350  PLALGSLEFDLYLGVTLNALSELPASLIAFFFIDKMNRKTSILVYTVLSGFCSIMSVLKG  409

Query  524  VGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
            +      +QIG E+V+FF+AC AFN+LL++T+ELFPTCVRNSA++M RQA+V+GG  SP+
Sbjct  410  IHPIWTGLQIGFELVSFFSACLAFNVLLLFTIELFPTCVRNSALSMVRQAVVLGGVFSPM  469

Query  704  LVALGRGN-RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            L A GR N  F SYGVFG+   +C  F+V LPET G  +CDT+DEEE KE  
Sbjct  470  LAAAGRDNGGFLSYGVFGVVVGVCGWFVVCLPETRGRGICDTMDEEEYKETA  521



>ref|XP_008225992.1| PREDICTED: organic cation/carnitine transporter 3-like [Prunus 
mume]
Length=529

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 132/289 (46%), Positives = 195/289 (67%), Gaps = 7/289 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
              SWR LY++T IP ++YS++V+ + RESPRWL++RG  +D + T+K +AP ++ ++ T 
Sbjct  236  AHSWRSLYIWTSIPTLLYSIMVHFLVRESPRWLFVRGRKEDAIATLKCIAPIDSATTKTP  295

Query  182  ttiFSDNQDQGLIDLDE--QMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLG  355
               F+ +    L    E   +DLYS++ +L+ + WA RRL  VM +  G G+VYYG+PL 
Sbjct  296  ---FTSSFISSLSFEQETWNVDLYSSISVLVERRWAFRRLSAVMAMGFGTGMVYYGMPLA  352

Query  356  VGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvls-gvcnlgcvvFVGE  532
            +G + FNLYLS T NA+SELPASL+    ID++ R+++++    L      +  +  +  
Sbjct  353  LGSLNFNLYLSVTFNALSELPASLIAFFFIDQMNRKTSLLVFTSLCGICSIMSVLKGMNP  412

Query  533  ELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
                +QIG E+V+FF+AC+AFN+LLI+ +ELFPTCVRNSA++M RQA+V+GG  SP+L A
Sbjct  413  IWTRLQIGFELVSFFSACSAFNVLLIFMIELFPTCVRNSALSMVRQAVVLGGVFSPMLAA  472

Query  713  LGRGN-RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
             GR N  F SYGVFG+   +C LF + LPET G  +CDT+DE+E K+  
Sbjct  473  AGRANGGFLSYGVFGVVVGVCGLFALCLPETRGCGICDTMDEQEYKDTA  521



>gb|KCW71280.1| hypothetical protein EUGRSUZ_F04367, partial [Eucalyptus grandis]
Length=500

 Score =   243 bits (621),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 133/269 (49%), Positives = 175/269 (65%), Gaps = 8/269 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LY++T +P I Y V+V+ +  ESPRWL+L G  +  VET+K++A P        
Sbjct  237  GSSWRVLYIWTSVPAIGYCVLVHFLVCESPRWLFLMGRREKAVETLKSIASPGASILTKG  296

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                S  +D         MD++SA+K L+ K WA  RL  VM V  GIG+VYYG+PLGVG
Sbjct  297  FFAISLEEDP-----LNNMDIFSAIKALLEKRWAFCRLCAVMLVGFGIGMVYYGMPLGVG  351

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + F+LY S TLNA++ELP++L+T +LI KL RRS+ V              +  G   +
Sbjct  352  NLHFDLYSSVTLNALAELPSTLLTFVLIGKLNRRSS-VLFFTTLSGICSVMCILEGRVWQ  410

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG-  718
             ++IGLE+V+FF+ CTA ++LLIYTLELFPTCVRNSA +M RQA+V+GG  SPLLVA   
Sbjct  411  KLRIGLELVSFFSGCTAVSVLLIYTLELFPTCVRNSATSMVRQALVLGGVFSPLLVAAAA  470

Query  719  -RGNRFYSYGVFGLASVLCCLFLVSLPET  802
             RG+   SYGVFGL    C LF++ LPET
Sbjct  471  RRGDGMLSYGVFGLVIGCCGLFVMCLPET  499



>ref|XP_008371967.1| PREDICTED: organic cation/carnitine transporter 3 [Malus domestica]
Length=530

 Score =   244 bits (622),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 138/292 (47%), Positives = 193/292 (66%), Gaps = 13/292 (4%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP-----PEtr  166
              SWR LY +T IP ++YS+ V+ + RESPRWL++RG  +D +ET+K +AP      +T 
Sbjct  236  AHSWRTLYFWTSIPTLLYSITVHFLVRESPRWLFVRGXKEDAIETLKCIAPVNSTTTKTA  295

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
             + +  +  S   + G       +DLYSA+  L+ + WA RRL  VM +  GIG+VYYG+
Sbjct  296  LTSSFISRLSFEHETG------NVDLYSAINALVKRKWAFRRLSAVMAIGCGIGMVYYGM  349

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvls-gvcnlgcvvF  523
            PL +G +  +LYL  TLNA+SELPASL+    IDK+ R+++++   VLS     +  +  
Sbjct  350  PLALGSLKXDLYLGVTLNALSELPASLIAFFFIDKMNRKTSILVYTVLSGFCSIMSVLKG  409

Query  524  VGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
            +      +QIG E+V+FF+AC AFN+LL++T+ELFPTCVRNSA++M RQA+VVGG  SP+
Sbjct  410  IHPIWTGLQIGFELVSFFSACLAFNVLLLFTIELFPTCVRNSALSMVRQAVVVGGVFSPM  469

Query  704  LVALGRGN-RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            L A GR N  F SYGVFG+   +C  F+V LPET G  +CDT+DEEE KE  
Sbjct  470  LAAAGRDNGGFLSYGVFGVVVGVCGWFVVCLPETRGRGICDTMDEEEYKETA  521



>ref|XP_007211551.1| hypothetical protein PRUPE_ppa004111mg [Prunus persica]
 gb|EMJ12750.1| hypothetical protein PRUPE_ppa004111mg [Prunus persica]
Length=529

 Score =   244 bits (622),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 133/289 (46%), Positives = 193/289 (67%), Gaps = 7/289 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
              SWR LY++T IP ++YS+ V+ + RESPRWL++RG  +D + T+K +AP ++ +S T 
Sbjct  236  AHSWRSLYIWTSIPTLLYSITVHFLVRESPRWLFVRGRKEDAIATLKCIAPIDSATSKTP  295

Query  182  ttiFSDNQDQGLIDLDE--QMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLG  355
               F+ +    L    E   +D+YSA+ +L+ + WA RRL  VM +  G G+VYYG+PL 
Sbjct  296  ---FTSSFISSLSFEQETWNVDIYSAISVLVERRWAFRRLSAVMAIGFGTGMVYYGMPLA  352

Query  356  VGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvls-gvcnlgcvvFVGE  532
            +G + FNLYLS T NA+SELPASL+    ID++ R+++++    L      +  +  +  
Sbjct  353  LGSLNFNLYLSVTFNALSELPASLIAFFFIDQMNRKTSLLVFTSLCGICSIMSVLKGMNP  412

Query  533  ELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
                +QIG E+V+FF+AC+AFN+LLI+ +ELFPTCVRNSA++M RQA+V+GG  SP+L A
Sbjct  413  IWTRLQIGFELVSFFSACSAFNVLLIFMIELFPTCVRNSALSMVRQAVVLGGVFSPMLAA  472

Query  713  LGRGN-RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
             GR N  F SYGVFG+   +C LF   LPET G  +CDT+DE+E K+  
Sbjct  473  AGRANGGFLSYGVFGVVVGVCGLFAFCLPETRGRGICDTMDEQEYKDTA  521



>ref|XP_011087052.1| PREDICTED: organic cation/carnitine transporter 3-like [Sesamum 
indicum]
Length=515

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 188/278 (68%), Gaps = 5/278 (2%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR +YL+T +P + YS++VY    ESPRWL+++G  Q+F +T+++M+ PE  S++T + 
Sbjct  234  SWRLIYLWTCVPCVFYSLLVYFSVHESPRWLFIKGKKQEFAKTLRSMSAPEHWSTLTESF  293

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
              S + + G  +  E++ + SAL +L+ K WA +RL  V     GIG++YYGIPLG+  +
Sbjct  294  -LSHSMEWGETE-SEELGICSALAILLQKSWAFQRLAVVTLAGFGIGMIYYGIPLGLSNL  351

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV  547
             F++YLS T NA+SELP +L    ++ KLRR+ TVVGL +LSG+C     +      K +
Sbjct  352  SFDVYLSATFNALSELPVTLAMFFVMGKLRRKGTVVGLALLSGICCPASALV---RWKGL  408

Query  548  QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGN  727
            QI LEIV+FF A  AF++LLIYTLELFPTCVRNSAV+M RQA + GG + P L A+GR  
Sbjct  409  QIALEIVSFFMARAAFDVLLIYTLELFPTCVRNSAVSMVRQASLFGGVLGPALAAVGRKK  468

Query  728  RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEE  841
               SYGVFG    +C L +  LPET G  LCDT++EEE
Sbjct  469  GLLSYGVFGATISVCGLLIAWLPETKGRVLCDTMEEEE  506



>emb|CDP07167.1| unnamed protein product [Coffea canephora]
Length=560

 Score =   244 bits (622),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 136/305 (45%), Positives = 186/305 (61%), Gaps = 23/305 (8%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP-PEtrssit  178
            GSSWR LY ++  P ++YS++V+  A ESPRWLY+RG  Q+F+ T+K +A  P  +    
Sbjct  244  GSSWRVLYFWSCAPTVLYSILVHFFAYESPRWLYVRGRKQEFLSTLKRIATVPTPQLLDI  303

Query  179  rttiFSDNQDQGLIDLDEQMDLYSALKLLIN------------KGWALRRLLTVMWVALG  322
             ++ FS+N +        ++D+  A +   N            K WA RRL  VM +  G
Sbjct  304  TSSCFSNNTNSSSGTTGCELDIDDATRNAANFWNSSSYYALWEKPWAFRRLAAVMAIGFG  363

Query  323  IGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRR---------STvv  475
             G+VYYG+PLG+G + FNLYLS TLNA+SE PA+ +T  LI  L R+         S V 
Sbjct  364  TGMVYYGMPLGLGNLSFNLYLSVTLNALSEFPAAFMTFFLIATLNRKGLVLGLSVASGVC  423

Query  476  glgvlsgvcnlgcvvFVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAV  655
               ++     +    +      A+Q+ LE+ +FF+ACT FN+L+I+TLELFPT VRNSA+
Sbjct  424  SCLIIVVEQVINSNSYYYWWRNALQMVLELASFFSACTGFNVLMIFTLELFPTSVRNSAL  483

Query  656  AMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDE  835
            +M RQA+V GG  SPLLVA GR N F SYGVFG+   +  LF+  LPET G  LCDT+DE
Sbjct  484  SMVRQAVVFGGLFSPLLVAAGR-NGFLSYGVFGVTIAVSGLFVGCLPETRGAALCDTLDE  542

Query  836  EESKE  850
            +E KE
Sbjct  543  QEHKE  547



>emb|CAN72566.1| hypothetical protein VITISV_029528 [Vitis vinifera]
Length=945

 Score =   249 bits (635),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 139/274 (51%), Positives = 193/274 (70%), Gaps = 12/274 (4%)
 Frame = +2

Query  44   GIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLID  223
            GI+   +V+   RESPRWL +RG  ++ V T+K++      ++ + T  FS     GL  
Sbjct  673  GIVVLCLVHFFVRESPRWLLVRGRKEEAVATLKSIG---AVNNSSFTLSFS-----GLPF  724

Query  224  LDEQ---MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTT  394
             DE+   + L S + +L+ K WALRRL  VM V  G+G+VYYG+PL +G +PFNLY + T
Sbjct  725  EDEETTNLHLCSVISILLEKRWALRRLSAVMTVGFGVGMVYYGMPLALGNLPFNLYWNVT  784

Query  395  LNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIGLEIVAF  574
             NA+SELPASL+    I++L R+S+V+   + SGVC++ CVV +GEE  +++IGLE+V+F
Sbjct  785  FNALSELPASLIAFFFIERLNRKSSVLVFTMTSGVCSIMCVV-MGEEWASLKIGLELVSF  843

Query  575  FTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFG  754
            F+ CTAF+ILLIYT+ELFPTCVRNSA+AM RQA+V GG   P++V +G GN + SYGVFG
Sbjct  844  FSTCTAFDILLIYTIELFPTCVRNSAMAMVRQALVFGGVFCPVIVEIGMGNGYLSYGVFG  903

Query  755  LASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            +  + C LF+  LPET GG LCDT++EEE+KE  
Sbjct  904  VVIISCGLFVGCLPETKGGTLCDTMEEEENKERA  937



>ref|XP_006853451.1| hypothetical protein AMTR_s00032p00186620, partial [Amborella 
trichopoda]
 gb|ERN14918.1| hypothetical protein AMTR_s00032p00186620, partial [Amborella 
trichopoda]
Length=390

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 191/310 (62%), Gaps = 36/310 (12%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSWR LYL   +P   YS++V+   +ESPRWL +RG  ++ ++ +++MA    +S    
Sbjct  83   NSSWRVLYLMISLPTFFYSILVHFFVKESPRWLLVRGREEEALKILRSMARLNGKSI---  139

Query  182  ttiFSDNQDQGLIDLDE--QMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLG  355
                 D   + L   +E   +++YSA+K+L  K WA RRLL +M V  G+GLVYYG+PLG
Sbjct  140  -----DFNIEALCIEEEAWNVNVYSAMKILWEKKWAFRRLLAIMVVNFGVGLVYYGMPLG  194

Query  356  VGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEE  535
             G + FNLYLS T NA++E P++L+T  LI +L RR  ++ L ++SGV ++ CV F+  E
Sbjct  195  AGNLDFNLYLSVTFNALAEFPSALLTFFLISRLNRRCAMITLSMVSGVFSILCV-FLSRE  253

Query  536  LKA-------------------------VQIGLEIVAFFTACTAFNILLIYTLELFPTCV  640
             K                           Q+G E VAFF+ CTAFNI++IY LELFPT V
Sbjct  254  RKGGLSLSKERTWDVLVSIERKGDIKNGWQMGAEFVAFFSCCTAFNIVIIYCLELFPTSV  313

Query  641  RNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLC  820
            RNSA+++ R A+V  G  SPLLV LGR N F+S+GVFGL  + C +F + LPET G   C
Sbjct  314  RNSALSLVRLAIVFAGIFSPLLVVLGRENAFWSFGVFGLVIICCGMFSLLLPETRGRPFC  373

Query  821  DTIDEEESKE  850
            DT++E+E KE
Sbjct  374  DTMEEQECKE  383



>ref|XP_010932367.1| PREDICTED: organic cation/carnitine transporter 2-like [Elaeis 
guineensis]
Length=518

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 186/276 (67%), Gaps = 9/276 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LYL+T +P   YS+++Y + +ESPRWL +RG  ++ V  +K +A        + 
Sbjct  236  GSSWRTLYLWTSVPSFCYSILLYFLVQESPRWLLVRGRREEAVHILKNIAASNGNVITSS  295

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             +     +D       E + +++A+K+L  K WA RRL+ +M VA G+G+VYYG+PL VG
Sbjct  296  FSTLVTPEDV------ENVGIFTAMKILWEKRWAFRRLIAIMTVAFGVGMVYYGMPLNVG  349

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             +  N+YLS T NA++ELP+SL+T   I+   RRS+ + L  LSG+C++ C   V  +++
Sbjct  350  NLTSNIYLSVTYNALAELPSSLITFFCIENFNRRSSSLILTTLSGMCSILC---VFMKIE  406

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             +++ +E+V+FF+ACTAFN+ LIY++ELFPTC+RNSA+++ RQA+ +GG ++P+LV  GR
Sbjct  407  GLKMAVEVVSFFSACTAFNVALIYSIELFPTCLRNSAISIVRQAITLGGTLAPILVGEGR  466

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
             N   S+GVFGL    C LF   LPET G  +CDT+
Sbjct  467  RNSSLSFGVFGLVIAGCGLFSACLPETRGTTICDTM  502



>ref|XP_008813564.1| PREDICTED: organic cation/carnitine transporter 2-like [Phoenix 
dactylifera]
Length=526

 Score =   238 bits (608),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 184/275 (67%), Gaps = 9/275 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LYL+T IP   YS+++Y + +ESPRWL +RG  ++ +  +K++A        + 
Sbjct  235  GSSWRTLYLWTSIPSFCYSILLYFLVQESPRWLLVRGRREEAIHILKSIAVSNGNVITSS  294

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             +    ++D G       + +++A+K+L  K WA RRL+ +  VA G+G+VYYG+PL VG
Sbjct  295  FSTLVTSEDVG------NVGIFTAMKILWEKRWAFRRLMAITTVAFGLGMVYYGMPLNVG  348

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             +  N+YLS T NA++ELP+SL+T   I+   RRS+ + L  LSGVC++ CV    E LK
Sbjct  349  NLTSNIYLSVTYNALAELPSSLITFFCIENFNRRSSSLILTTLSGVCSILCVFLKIEGLK  408

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
               + +E+V+FF+ACTA N+ LIY++ELFPTCVRNSA+++ RQA+V+GG  +P+LV  GR
Sbjct  409  ---LAVEVVSFFSACTALNVALIYSIELFPTCVRNSAISLVRQALVLGGVFAPILVVEGR  465

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDT  826
             N F S+G+FGL    C LF   LPET G  +CDT
Sbjct  466  RNSFLSFGLFGLVIGCCGLFAACLPETRGRSICDT  500



>emb|CDY56805.1| BnaA02g36180D [Brassica napus]
Length=467

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 179/264 (68%), Gaps = 7/264 (3%)
 Frame = +2

Query  83   ESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLIDLDEQMDLYSALKL  262
             SPRWL++RG  ++ +  +K +A           +     +++   D    +++Y+A+K+
Sbjct  199  RSPRWLFVRGRREEAISILKRVASIPLSDGTMSFSSLPTEEEE---DGKPSVNIYAAMKV  255

Query  263  LINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLL  442
            L+ K WALRRL  VM VA GIGLVYYG+PL +  + FN+Y+S   NA+ +LPA+L+TL L
Sbjct  256  LVEKRWALRRLTAVMAVAFGIGLVYYGMPLALSNLDFNVYMSAAFNALMDLPANLITLFL  315

Query  443  IDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK---AVQIGLEIVAFFTACTAFNILLIY  613
            +DKL RR+ ++G   L GV ++         +    A+Q+ LE++++F AC+AFNI +IY
Sbjct  316  VDKLSRRNALIGFTALGGVSSVLIFALQNMRIGSHGALQLVLELISYFCACSAFNIEMIY  375

Query  614  TLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSL  793
            T+ELFPTCVRNSA+AM RQA+V+GG  SP++VA GR N F+S+G+FGLA  L  LF V+L
Sbjct  376  TIELFPTCVRNSAIAMTRQALVLGGVFSPIMVAAGRKNGFWSFGLFGLAIGLLGLFAVAL  435

Query  794  PETLGGDLCDTIDEEESKE-NGNR  862
            PET G DLCDT+DEEE K+  GN 
Sbjct  436  PETRGSDLCDTMDEEECKDRQGNN  459



>ref|XP_009363323.1| PREDICTED: organic cation/carnitine transporter 3-like [Pyrus 
x bretschneideri]
Length=530

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/287 (47%), Positives = 189/287 (66%), Gaps = 3/287 (1%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
              SWR LY +T IP ++YS+ V+ +  ESPRWL++RG  +D +ET+K +AP  + +S T 
Sbjct  236  AHSWRTLYFWTSIPTLLYSITVHFLVHESPRWLFVRGRKEDAIETLKCIAPVNSTTSKTE  295

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             T  S             +D YSA+  L+ + WA RRL  VM +  GIG+VYYG+PL +G
Sbjct  296  LTS-SFISSLSFEHETWNVDFYSAINALVKRKWAFRRLSAVMAIGCGIGMVYYGMPLALG  354

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvls-gvcnlgcvvFVGEEL  538
             + F+LYL  TLNA+ ELPASL+T   IDK+ R+++++   VLS     +  +  +    
Sbjct  355  SLEFDLYLGVTLNALIELPASLITFFFIDKMNRKTSILVYTVLSGFCSIMSVLKGIHPIW  414

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
              +QIG E+V+FF+AC A N+LL++T+ELFPTCVRNSA+++ RQA+V+GG  SP+L A G
Sbjct  415  TGLQIGFELVSFFSACLACNVLLLFTIELFPTCVRNSALSVVRQAVVLGGTFSPMLAAAG  474

Query  719  RGNR-FYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            R N  F SYGVFG+   +C  F+V LPET G  +CDT+DEEE KE  
Sbjct  475  RDNSGFLSYGVFGVVVGVCGGFVVCLPETRGRGICDTMDEEEYKETA  521



>gb|KDO61528.1| hypothetical protein CISIN_1g039541mg [Citrus sinensis]
Length=521

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 191/289 (66%), Gaps = 2/289 (1%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSW+ LY++T IP I+  +I+Y    ESPRWL++ G   + +  +K +A      S   
Sbjct  233  GSSWKMLYVWTSIPSIVCCIIIYPFISESPRWLFIHGHEAEAMAVLKRLASRSNYQSDYG  292

Query  182  ttiFS-DNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGV  358
                   N      ++  ++DLYS+LK L N+ WALRRLLT+M +A GIG+VY+G+ LGV
Sbjct  293  LESCCLSNMPPKAKNVIPKLDLYSSLKDLFNRKWALRRLLTIMALAFGIGVVYFGLLLGV  352

Query  359  GEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
            G + FN+YLS   N + ++PA L+T +LI++  R+S+++   +LSG C+  CV  +G+E 
Sbjct  353  GNLSFNIYLSLAFNGLLDIPAYLLTFILIERWSRKSSILTFCILSGTCSAICVA-IGDEQ  411

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
            + +QIGLE+ +FF+AC AFN+LL++  ELF TCVRNS  ++ RQA+ +G A SP+L++ G
Sbjct  412  EVLQIGLELASFFSACVAFNVLLVFGTELFTTCVRNSTTSLVRQAVNLGAAFSPVLISAG  471

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV  865
            R N F S+GVFGL       F+V LPET+G  LCDT+D++E  + G  +
Sbjct  472  RQNEFLSFGVFGLVVFCFGFFVVFLPETIGVTLCDTLDQQEYFKTGGEL  520



>emb|CDX96817.1| BnaA08g23600D [Brassica napus]
Length=458

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 127/258 (49%), Positives = 178/258 (69%), Gaps = 13/258 (5%)
 Frame = +2

Query  83   ESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLIDLDEQM--DLYSAL  256
            +SPRWL ++G  ++ V  ++++           T  FSD      +D+ E    D+Y AL
Sbjct  204  QSPRWLIVKGRKEEAVSILQSIGS------NAITMSFSDL----CLDVQESSNPDVYDAL  253

Query  257  KLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTL  436
            ++L+ K W+LRRLL VM V  GIG+VYYG+PL +  + FNLYL    NA+SELPA L+T 
Sbjct  254  RILVKKPWSLRRLLAVMAVGFGIGMVYYGMPLTLSNLNFNLYLGVVFNALSELPAFLITF  313

Query  437  LLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIGLEIVAFFTACTAFNILLIYT  616
              ++ ++RR  ++G   LSG+ ++     +G++L ++QI LE+V+FF+ACTAFN+ LIYT
Sbjct  314  FFMNTIKRREALIGFTALSGISSVLIAS-LGQQLGSLQIVLELVSFFSACTAFNMTLIYT  372

Query  617  LELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLP  796
            +ELFPTCVRNSA+AM RQA+V GG  SP++VA GR N+F+SYG+FGL   L  LF+V LP
Sbjct  373  IELFPTCVRNSALAMVRQALVFGGVFSPVMVAAGRENQFWSYGMFGLVIGLFGLFVVGLP  432

Query  797  ETLGGDLCDTIDEEESKE  850
            ET G  LCDT+DEEE+K 
Sbjct  433  ETRGSVLCDTMDEEETKN  450



>ref|XP_003520216.1| PREDICTED: organic cation/carnitine transporter 3-like [Glycine 
max]
Length=515

 Score =   228 bits (582),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/285 (45%), Positives = 190/285 (67%), Gaps = 11/285 (4%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G SWR LYL+T +P I+Y  +V+    ESPRWL +RG  ++ ++ +K +           
Sbjct  237  GFSWRNLYLWTSLPSILYCGLVHFFVPESPRWLLIRGKKEEAMKILKNINTS----ITHS  292

Query  182  ttiFSDNQDQGLIDLDEQM---DLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPL  352
            +  F+ ++    + L+E++   DL+SALK+++ K W+ RR+LT+  + LGIGLVYYG+PL
Sbjct  293  SLKFAISR----LSLEEEVWNADLFSALKIMLQKKWSSRRILTITAMGLGIGLVYYGMPL  348

Query  353  GVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGE  532
            G+G + FNLYLS T NA+SE+ ++ +T +L+DK  RRS +  L ++SGV ++   +    
Sbjct  349  GLGILSFNLYLSVTFNALSEILSAFLTYVLLDKFNRRSMIFILTIISGVSSVLATMEGVI  408

Query  533  ELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
             ++ +QI  E+++F  ACTA +++LIYT ELFPT +RNSA+++ RQ + +GGA SP+LVA
Sbjct  409  IMRRLQIVFELISFSCACTACDVVLIYTTELFPTSIRNSALSLVRQTVALGGAFSPVLVA  468

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
             GR +RF  YGV GLA     +F V LPET G   CDT+DEEES 
Sbjct  469  AGREHRFLCYGVLGLAIGCSGIFGVCLPETKGKAFCDTMDEEESN  513



>ref|XP_002315081.2| hypothetical protein POPTR_0010s18150g [Populus trichocarpa]
 gb|EEF01252.2| hypothetical protein POPTR_0010s18150g [Populus trichocarpa]
Length=517

 Score =   228 bits (580),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 128/286 (45%), Positives = 178/286 (62%), Gaps = 6/286 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GS WRYLY++T IP I+Y +I Y    ESPRWL +RG   + V  +  M P +  SS   
Sbjct  234  GSPWRYLYIYTSIPAIVYCIIAYFFVSESPRWLCMRGREAEAVAILNKMVPTKNISSSIL  293

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             + +     + L      +D+YS++K L+ + WAL+RLL  M +  G+G+VYYG+ LGVG
Sbjct  294  KSAY-----KPLDHEQSNLDIYSSMKSLLERRWALKRLLAAMTLGFGVGMVYYGMFLGVG  348

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+YLS TL A   +P+ L+   +I++  RRS+VV  G+ SGVC++ C   +GEELK
Sbjct  349  SLGFNIYLSVTLTASLTIPSILLLPYVIERFNRRSSVVAFGIASGVCSIVCA-IIGEELK  407

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             VQI + + + F +C A N+L IYT ELFPTCVR SA +M RQA+  G    PLLV+  R
Sbjct  408  TVQIIMSLASAFCSCAALNVLQIYTTELFPTCVRISATSMFRQAINFGPIFVPLLVSAAR  467

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGN  859
             N    YGVFG   + C  F++ LPET G  L + +DE+E K+N N
Sbjct  468  RNNSVVYGVFGSVEISCIFFVIFLPETRGLSLSNAMDEQEKKDNAN  513



>ref|XP_007211479.1| hypothetical protein PRUPE_ppa007595mg [Prunus persica]
 gb|EMJ12678.1| hypothetical protein PRUPE_ppa007595mg [Prunus persica]
Length=362

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 186/284 (65%), Gaps = 2/284 (1%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T IP I+Y +++     ESPRWLY+ G  ++ +  ++  + P   S +   
Sbjct  76   NSWRALYLCTSIPAILYCILLQFFVTESPRWLYMHGFVEEAIAILEKSSAPNYPSELKLL  135

Query  185  tiFSDNQDQGLIDLDEQMDL-YSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             + +    +G+ +  +  +  Y ++K L  K WA++R LTVM +  GIG+VYYG+PLGVG
Sbjct  136  LVSTGMPSEGVEETSKTKNHPYKSMKDLFAKRWAMKRTLTVMVLGFGIGMVYYGMPLGVG  195

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+YLS   NA+ E+P+  +T +++++  R+ +V+   ++SG+C + C + VG   K
Sbjct  196  NLGFNIYLSVMFNALLEIPSYPITCIILERWSRKYSVLAFCLVSGICGILCAI-VGNGQK  254

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             ++IGLE+ +FF + TA+N++ ++T+ELFPTCVRNSA ++ RQ+ V+    S +LV++G 
Sbjct  255  GIRIGLELASFFCSRTAWNLISMFTVELFPTCVRNSATSLLRQSYVLSAVFSSILVSVGS  314

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             N F SYGVFGLA      F+  LP+T GG LCDT++E+E KEN
Sbjct  315  NNGFLSYGVFGLAIFFSGFFVACLPDTRGGTLCDTMEEQEGKEN  358



>emb|CDX83951.1| BnaC08g16940D [Brassica napus]
Length=459

 Score =   223 bits (568),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 121/258 (47%), Positives = 175/258 (68%), Gaps = 12/258 (5%)
 Frame = +2

Query  83   ESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLIDLDEQM--DLYSAL  256
            +SPRWL ++G  ++ V  + ++      +       FS+      +D+ E    D+Y AL
Sbjct  204  QSPRWLIVKGRKEEAVSILHSIGSSNAITMS-----FSNL----CLDVQESSNPDVYDAL  254

Query  257  KLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTL  436
            ++L+ K W+ +RLL VM V  GIG+VYYG+PL +  + FNLYL    NA+SELPA L+T 
Sbjct  255  RILVKKPWSFKRLLAVMAVGFGIGMVYYGMPLTLSNLNFNLYLGVVFNALSELPAFLITF  314

Query  437  LLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIGLEIVAFFTACTAFNILLIYT  616
              ++ ++RR  ++G   LSG+ ++     +G ++ ++QI LE+V+FF+ACTAFN+ LIYT
Sbjct  315  FFMNTIKRREALIGFTALSGISSVLIAS-LGRQIGSLQIVLELVSFFSACTAFNMTLIYT  373

Query  617  LELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLP  796
            +ELFPTCVRNSA+AM RQA+V+GG  SP++VA GR N+F+SY +FGL   L  LF+V LP
Sbjct  374  IELFPTCVRNSALAMVRQALVLGGVFSPVMVAAGRENQFWSYVMFGLVIGLFGLFVVGLP  433

Query  797  ETLGGDLCDTIDEEESKE  850
            ET G  LCDT+DEEE+K 
Sbjct  434  ETRGSVLCDTMDEEETKN  451



>ref|XP_011000458.1| PREDICTED: organic cation/carnitine transporter 3-like isoform 
X1 [Populus euphratica]
 ref|XP_011000459.1| PREDICTED: organic cation/carnitine transporter 3-like isoform 
X2 [Populus euphratica]
Length=506

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 184/287 (64%), Gaps = 18/287 (6%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSWR +Y++T IP I+Y V+V+L+  ESPRWL+L+G  +  +  +K + P         
Sbjct  232  NSSWRTIYVWTSIPSILYCVLVHLLVLESPRWLFLQGRKEAGMAILKRLGPA--------  283

Query  182  ttiFSDNQDQGLIDLDEQ---MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPL  352
                S N     I L ++    +LYS +K+L+ + WAL+RLL VM    GIG+VYY +PL
Sbjct  284  ----SLNLCLPYISLKKEAPKTNLYSPIKILLVRKWALQRLLIVMLTGFGIGIVYYSMPL  339

Query  353  GVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGE  532
             VG + FN+YLS   NA++E+P+ ++   ++ K  R+ +++    L G+C++ C++   E
Sbjct  340  AVGNLGFNIYLSVAFNALAEIPSYIIFSFIVSKWSRKGSLLAFTTLGGICSIMCIMNWKE  399

Query  533  ELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
                V IGLE+V++F+ACTAF +L+IYTLELFPTCVRN + +M RQA V G   SP+L++
Sbjct  400  ---VVLIGLELVSYFSACTAFIMLMIYTLELFPTCVRNGSSSMVRQAPVFGAVFSPILIS  456

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             GR N+  SYGVFGL  +   +F+  LPET G  L DT+DE+E KE 
Sbjct  457  AGRSNKVLSYGVFGLVILCSSVFVFCLPETRGVALSDTMDEQEEKEQ  503



>gb|EMT30622.1| Solute carrier family 22 member 3 [Aegilops tauschii]
Length=497

 Score =   224 bits (571),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 185/284 (65%), Gaps = 8/284 (3%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP---PEtrssit  178
            SWR +YL+T +P + YS++ Y + +ESPRWL +RG  QD +ET++ +A        SS +
Sbjct  201  SWRNMYLWTSVPSLCYSILFYFLVQESPRWLLVRGRKQDAIETLQQIASLNGNSITSSFS  260

Query  179  rttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGV  358
                 + N D    +      +++ L  +  + WALRRL  +M  + G+G+VYYG+PL V
Sbjct  261  MLHACTMNNDTA--EESGGDSVFATLHSMWERPWALRRLAAIMTASFGVGMVYYGMPLNV  318

Query  359  GEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
            G +  NLYLS T NA++ELP+S+++ LL+ ++ RRS+V+ L   +GV +L CVV      
Sbjct  319  GNLGSNLYLSVTYNALAELPSSILSWLLMGRINRRSSVIALTGAAGVWSLACVVI---PQ  375

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
             A ++  E+++FF  CTAFN++++Y++ELFPT VRNSAV + RQA+V+GG  +P+LVALG
Sbjct  376  GAARMAAELLSFFATCTAFNVIMMYSIELFPTSVRNSAVGLVRQALVLGGVAAPVLVALG  435

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            R   F S+GVFGL      +F   LPET G  + DT+DEEE KE
Sbjct  436  RERSFLSFGVFGLVVGCFGMFAACLPETRGKGMSDTMDEEEHKE  479



>ref|XP_010688825.1| PREDICTED: organic cation/carnitine transporter 3-like [Beta 
vulgaris subsp. vulgaris]
Length=526

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 179/286 (63%), Gaps = 5/286 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LYL+T IPGI+ S++ Y    ESPRWL+++GLT++ +  ++ +    ++   T  
Sbjct  241  SSWRNLYLWTSIPGIVCSLLCYFFVLESPRWLFMQGLTKESIAVLRKLGSSTSQVYSTVI  300

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                 N  +G          + +LK+LI K WA++RLL  M++A GIGL+Y+G+ LGVG 
Sbjct  301  INNMANLQEG----PNNTSSFESLKILIKKRWAVKRLLASMFLAFGIGLMYFGMFLGVGN  356

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL-K  541
            + FN+YL++T +A+  L + L+T L       R   +    +           VG+ + +
Sbjct  357  LGFNIYLTSTFSALLSLVSYLLTFLYWVPRCNRRISLLGFCVISGATSIIFSVVGKHIHQ  416

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             + I LE+V+ F AC A+N++L+YT+ELFPTCVRNSA ++ RQAM+ G    P+L+ LGR
Sbjct  417  GLLISLELVSLFCACMAYNLVLMYTVELFPTCVRNSASSLVRQAMIFGSVFDPVLILLGR  476

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGN  859
             N+ YSYGVFG+  ++C   ++ LPET G  LCDT++E+E ++N +
Sbjct  477  QNKMYSYGVFGITVLVCGFLVLCLPETRGKVLCDTMEEQELRDNSS  522



>ref|XP_003562876.1| PREDICTED: organic cation/carnitine transporter 2-like [Brachypodium 
distachyon]
Length=545

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 131/293 (45%), Positives = 196/293 (67%), Gaps = 16/293 (5%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +YL+T +P + YS++ Y + +ESPRWL +RG  QD +ET++ +A     S+IT +
Sbjct  236  ASWRNMYLWTSLPALCYSILFYFLVQESPRWLLVRGRKQDAIETLRQIAALNGNSAITSS  295

Query  185  tiFSD----NQDQ----GLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYY  340
                     +Q++              +++AL  +  + WALRRL  +M  + GIG+VYY
Sbjct  296  FSMLHACVMHQEEDAAAASDSSSSSSSVFAALHSMWERPWALRRLAAIMTASFGIGMVYY  355

Query  341  GIPLGVGEM-PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcv  517
            G+PL VG +   NLYLS T NA++ELP+S+++ LL+ ++ RRS+V+ L  L+GV +L C+
Sbjct  356  GMPLNVGNLGGSNLYLSVTYNALAELPSSILSWLLMGRINRRSSVIALTALAGVSSLACL  415

Query  518  vFVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAIS  697
            V  G+ L+   +G E+++FF  CTAFN++++Y++ELFPT VRNSAV M RQA+V+GG  +
Sbjct  416  VIPGQGLR---MGAELLSFFATCTAFNVVMMYSIELFPTSVRNSAVGMVRQALVLGGVAA  472

Query  698  PLLVALGRGNRFYSYGVFGLASVLCC--LFLVSLPETLGGDLCDTIDEEESKE  850
            P+LVALGR   F S+GVFGL  V+ C  +F   LPET G  + DT++EEE KE
Sbjct  473  PVLVALGRQRSFLSFGVFGL--VIGCFGMFAACLPETRGKGMSDTMEEEEQKE  523



>ref|XP_002322629.1| hypothetical protein POPTR_0016s03850g [Populus trichocarpa]
 gb|EEF04390.1| hypothetical protein POPTR_0016s03850g [Populus trichocarpa]
Length=506

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 124/285 (44%), Positives = 183/285 (64%), Gaps = 18/285 (6%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR +Y++T  P I+Y V+V+L+  ESPRWL+L+G  +  +  +K + P           
Sbjct  234  SWRTIYVWTSTPSILYCVLVHLLVLESPRWLFLQGRKEAAMAILKRLGPT----------  283

Query  188  iFSDNQDQGLIDLDEQ---MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGV  358
              S N     I L+++    +LYS +K+L+ + WAL+RLL VM    GIG+VYY +PL V
Sbjct  284  --SLNLCLPYISLEKEAPKTNLYSPIKILLVRKWALQRLLIVMLTGFGIGIVYYSMPLAV  341

Query  359  GEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
            G + FN+YLS   NA++E+P+ ++   ++ K  R+ +++    L G+C++ C++   E  
Sbjct  342  GNLGFNIYLSVAFNALAEIPSYIIFSFIVSKWSRKGSLLAFTTLGGICSIMCIMNWKE--  399

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
              V IGLE+V++F+ACTAF +L+IYTLELFPTCVRN A +M RQA V G   SP+L++ G
Sbjct  400  -VVLIGLELVSYFSACTAFIMLMIYTLELFPTCVRNGASSMVRQAPVFGAVFSPILISAG  458

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            R N+  SYGVFGL  +   +F+  LPET G  L DT+DE+E KE 
Sbjct  459  RSNKVLSYGVFGLVILCSSVFVFCLPETRGVALSDTMDEQEEKEQ  503



>ref|XP_007022779.1| Organic cation/carnitine transporter 2, putative [Theobroma cacao]
 gb|EOY14304.1| Organic cation/carnitine transporter 2, putative [Theobroma cacao]
Length=498

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 131/289 (45%), Positives = 182/289 (63%), Gaps = 19/289 (7%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY +T IP I Y +IVY    ESPRWL+L+G   + +  +K   P          
Sbjct  217  SSWRILYFWTSIPAIAYCIIVYFFVSESPRWLFLQGREVEAMAVLKKFGPVNV-------  269

Query  185  tiFSDNQDQGLID------LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
                D  +  L+D      L  ++D+Y+++K L  + WALRRLL  M +  G+G+VYYG+
Sbjct  270  ----DGFNSYLVDVPLQEELTNKLDMYASMKDLFRRRWALRRLLAAMALGFGVGMVYYGM  325

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
             LGVG +  N YLS TLN + ++PA  +T LLI++ +R ++++   + SGVC++ C    
Sbjct  326  LLGVGNLGINTYLSLTLNGLLDIPAYFLTFLLIERCKRTTSMLTFSIASGVCSIICG--A  383

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
              E K +QIGLE+VAFF++CTAFN++LIY  ELFPT VRNSA +M RQA++ G   SPLL
Sbjct  384  ASEHKGIQIGLELVAFFSSCTAFNVVLIYVTELFPTSVRNSATSMVRQALIFGAVFSPLL  443

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             + GR N F  YGV GL  + C LF+  LPET G  + DT+DE+ES +N
Sbjct  444  TSAGRKNEFLCYGVLGLVILCCGLFVAYLPETRGMAMFDTLDEQESHDN  492



>ref|XP_008226044.1| PREDICTED: organic cation/carnitine transporter 3-like [Prunus 
mume]
Length=534

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 193/297 (65%), Gaps = 9/297 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
              SWR LY  T IP  +Y ++V  +  ESPRWL++RG  ++ + T+K +AP    S+ T 
Sbjct  238  AHSWRTLYFCTSIPTFLYCIMVRFLVHESPRWLFVRGRKEEAIATLKHIAPINGISTKTP  297

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             T  S   +         +DLYSA+ +L  + WA +RL  VM +  G+G+VYYG+PL +G
Sbjct  298  LTS-SFFSNLSFEQETRNVDLYSAINVLAKRRWAFQRLSAVMAIGFGVGMVYYGMPLALG  356

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL-  538
             + FNLYLS T N +SELPASL+TL+ I ++ R+++++    LSGV ++  V+     + 
Sbjct  357  SLDFNLYLSVTFNGLSELPASLITLVFIAEMNRKTSLLVFTSLSGVFSIMSVLKGTHPIW  416

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
              +QI  E+V+FF+AC+A N+LLI+T+ELFPTCVRNSAV+M RQA+V+GG  SP+L A G
Sbjct  417  TTLQIVFELVSFFSACSALNVLLIFTVELFPTCVRNSAVSMVRQAVVLGGVFSPMLAAAG  476

Query  719  RGN-RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV*TLNCLY  886
            R N  F SYGVFG+   +  LF+V L ET G  +CDT+DEEE K+        +CLY
Sbjct  477  RVNGGFLSYGVFGVVVGVFGLFVVCLQETRGRGICDTMDEEEYKQRD------SCLY  527



>gb|AFK48052.1| unknown [Lotus japonicus]
Length=384

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 178/283 (63%), Gaps = 7/283 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SW+  Y++T +P I YS+I YL   ESPRWL ++G  ++ +  +K ++  E    +T +
Sbjct  106  ASWKTNYIWTSVPAICYSIIAYLFVTESPRWLLMQGRQEEAMAMLKGVSSVENGVDLTAS  165

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
             +    + +G +       LYS++  L  + WAL+R++ +M + +GIG+V++G+PL VG 
Sbjct  166  LLKVPAKQKGSV-----FQLYSSIAELFGRSWALKRMVAIMVLGIGIGMVHFGMPLAVGN  220

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + F++YL+   NA+ E+P+ + T  L +  R+ S  + +  +         V VG EL+A
Sbjct  221  LGFDIYLAVVFNALMEIPSCVATYFLENCSRKPS--ILVFSVGSGICCVMCVLVGSELQA  278

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            V++ L + +FF+ACTA+N+ LIY +ELFPT VRN+  ++ RQA+V G   SP L++ GR 
Sbjct  279  VKVALAVASFFSACTAYNVFLIYIIELFPTSVRNTTTSLVRQAIVFGNIFSPFLISAGRK  338

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            N  +SYGVFG+  +  C  L+ LPET G  LCDT+D++E K++
Sbjct  339  NDIFSYGVFGIVIMASCFTLLGLPETKGIALCDTMDQQEKKDS  381



>ref|XP_004958022.1| PREDICTED: organic cation/carnitine transporter 2-like [Setaria 
italica]
Length=541

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/285 (43%), Positives = 183/285 (64%), Gaps = 4/285 (1%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +YL+T +P + YSV++Y +A+ESPRWL +RG  QD ++T++ +A     S  +  
Sbjct  232  ASWRNMYLWTSVPSLCYSVLLYFLAQESPRWLLVRGRKQDAMDTLQQIATLNGNSITSSF  291

Query  185  tiFS--DNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGV  358
            ++      +  G          +  ++    + WALRRL  +M  + G+G+VYYG+PL V
Sbjct  292  SMLHACTMRADGGDAGGGAGGAFGTMRAFWERPWALRRLAAIMTTSFGVGMVYYGMPLNV  351

Query  359  GEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
            G +  NLYLS T NA++ELP+++++L  I K+ RR+TV+ L   +G  +L CV     E 
Sbjct  352  GSLGTNLYLSVTYNAMAELPSAVLSLAFIGKVNRRTTVIALTAAAGAFSLMCVAI--PEG  409

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
             A ++  E+++FF   TAFN++LIY++ELFPT VRNSAV + RQA+V+GG  +P+LVALG
Sbjct  410  SAARMASELLSFFATITAFNLILIYSIELFPTSVRNSAVGLVRQALVLGGVAAPVLVALG  469

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            R   FYS+GVFGL      LF   LPET G  + DT++EEE K+ 
Sbjct  470  RERSFYSFGVFGLCIGCFGLFAACLPETKGRSMSDTMEEEEHKQE  514



>gb|ACG29388.1| carbohydrate transporter/ sugar porter [Zea mays]
Length=532

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 186/276 (67%), Gaps = 3/276 (1%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPE-trssitr  181
            +SWR +YL+T +P + YSV++Y +A+ESPRWL +RG  QD +ET++ +A       + + 
Sbjct  230  ASWRSMYLWTSVPSLCYSVLLYFLAQESPRWLLVRGRKQDAMETLRQIASLNGNSITSSF  289

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            + + + N  +          ++S ++ +  + WALRRL  +M  + G+G+VYYG+PL VG
Sbjct  290  SMLHACNMQEDDGAAGGAAGVFSTMRAMWERPWALRRLAAIMTASFGVGMVYYGMPLNVG  349

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             +  NLYLS T NA++ELP+++++L+ I ++ RRS+VV L V +G  +L CV  V  E  
Sbjct  350  SLGTNLYLSVTYNALAELPSAILSLIFIGRVNRRSSVVALTVAAGAFSLACV--VIPEGS  407

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            A ++  E+++FF+  TAFN++LIY++ELFPT VRNSAV + RQA+V+GG ++P+LVALGR
Sbjct  408  AARMAAELLSFFSTITAFNLILIYSIELFPTSVRNSAVGLVRQALVLGGVVAPVLVALGR  467

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
               F+S+GVFGL      LF   LPET G  + DT+
Sbjct  468  ERSFWSFGVFGLCIGCLGLFAACLPETRGRSMSDTM  503



>gb|ACF86499.1| unknown [Zea mays]
 gb|ACF87890.1| unknown [Zea mays]
 tpg|DAA63126.1| TPA: carbohydrate transporter/ sugar porter [Zea mays]
Length=538

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 122/276 (44%), Positives = 185/276 (67%), Gaps = 3/276 (1%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +YL+T +P + YSV++Y +A+ESPRWL +RG  QD +ET++ +A     S  +  
Sbjct  236  ASWRSMYLWTSVPSLCYSVLLYFLAQESPRWLLVRGRKQDAMETLRQIASLNGNSITSSF  295

Query  185  tiFSD-NQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            ++    N  +          ++S ++ +  + WALRRL  +M  + G+G+VYYG+PL VG
Sbjct  296  SMLHACNMQEDDGAAGGAAGVFSTMRAMWERPWALRRLAAIMTASFGVGMVYYGMPLNVG  355

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             +  NLYLS T NA++ELP+++++L+ I ++ RRS+VV L V +G  +L CV  V  E  
Sbjct  356  SLGTNLYLSVTYNALAELPSAILSLIFIGRVNRRSSVVALTVAAGAFSLACV--VIPEGS  413

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            A ++  E+++FF+  TAFN++LIY++ELFPT VRNSAV + RQA+V+GG ++P+LVALGR
Sbjct  414  AARMAAELLSFFSTITAFNLILIYSIELFPTSVRNSAVGLVRQALVLGGVVAPVLVALGR  473

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
               F+S+GVFGL      LF   LPET G  + DT+
Sbjct  474  ERSFWSFGVFGLCIGCLGLFAACLPETRGRSMSDTM  509



>ref|NP_001147880.1| carbohydrate transporter/ sugar porter [Zea mays]
 gb|ACG28995.1| carbohydrate transporter/ sugar porter [Zea mays]
Length=536

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 186/276 (67%), Gaps = 3/276 (1%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPE-trssitr  181
            +SWR +YL+T +P + YSV++Y +A+ESPRWL +RG  QD +ET++ +A       + + 
Sbjct  234  ASWRNMYLWTSVPSLCYSVLLYFLAQESPRWLLVRGRKQDAMETLRQIASLNGNSITSSF  293

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            + + + N  +          ++S ++ +  + WALRRL  +M  + G+G+VYYG+PL VG
Sbjct  294  SMLHACNMQEDDGAAGGAGGVFSTMRAMWERPWALRRLAAIMTASFGVGMVYYGMPLNVG  353

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             +  NLYLS T NA++ELP+++++L+ I ++ RRS+VV L V +G  +L CV  V  E  
Sbjct  354  SLGTNLYLSVTYNALAELPSAILSLIFIGRVNRRSSVVALTVAAGAFSLACV--VIPEGS  411

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            A ++  E+++FF+  TAFN++LIY++ELFPT VRNSAV + RQA+V+GG ++P+LVALGR
Sbjct  412  AARMAAELLSFFSTITAFNLILIYSIELFPTSVRNSAVGLVRQALVLGGVVAPVLVALGR  471

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
               F+S+GVFGL      LF   LPET G  + DT+
Sbjct  472  ERSFWSFGVFGLCIGCLGLFAACLPETRGRSMSDTM  507



>ref|XP_002460855.1| hypothetical protein SORBIDRAFT_02g036370 [Sorghum bicolor]
 gb|EER97376.1| hypothetical protein SORBIDRAFT_02g036370 [Sorghum bicolor]
Length=537

 Score =   220 bits (561),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 184/276 (67%), Gaps = 3/276 (1%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +YL+T +P + YSV++Y +A+ESPRWL +RG  QD +ET++ +A     S  +  
Sbjct  235  ASWRNMYLWTSVPSLCYSVLLYFLAQESPRWLLVRGRKQDAMETLQQIASLNGNSITSSF  294

Query  185  tiFSD-NQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            ++    N  +          ++S ++ +  + WALRRL  +M    G+G+VYYG+PL VG
Sbjct  295  SMLHACNMQEDDGASGGAGGVFSTMRSMWERPWALRRLAAIMTTGFGVGMVYYGMPLNVG  354

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             +  N+YLS T NA++ELP+++++L+ I ++ RRS+VV L V +G  +L CV  V  E  
Sbjct  355  SLGTNIYLSVTYNALAELPSAILSLIFIGRINRRSSVVALTVAAGALSLACV--VIPEGS  412

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            A ++  E+++FF+  TAFN++LIY++ELFPT VRNSAV + RQA+V+GG ++P+LVALGR
Sbjct  413  AARMAAELLSFFSTITAFNLILIYSIELFPTSVRNSAVGLVRQALVLGGVVAPMLVALGR  472

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
               F+S+GVFGL      LF   LPET G  + DT+
Sbjct  473  ERSFWSFGVFGLCIGCLGLFAACLPETRGRSMSDTM  508



>ref|XP_003605381.1| Solute carrier family 22 member [Medicago truncatula]
 gb|ACJ85794.1| unknown [Medicago truncatula]
 gb|AES87578.1| organic cation/carnitine transporter [Medicago truncatula]
Length=513

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/284 (38%), Positives = 177/284 (62%), Gaps = 7/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSW+ +Y++T IP IIY++I Y    ESPRWL ++G  ++ +  +K M+  E        
Sbjct  235  SSWKSVYIWTSIPAIIYTIIGYFFVTESPRWLLMQGRNKEAIAMLKGMSSEENADLTASL  294

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
             + +  + +  +       LYS++  L  + WAL+R++ +M + +GIG+VY+G+PL VG 
Sbjct  295  LLNAPPKQKTSV-----FQLYSSITKLFERSWALKRMVAIMVLGMGIGMVYFGMPLAVGN  349

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + F++YL+   NA+ E+P+ + T  L ++ R+ S +         C +  V  VG  ++ 
Sbjct  350  LGFDIYLAVVFNALMEIPSCVATYFLENRQRKPSILAFSIASGVCCVMCVV--VGSGVQG  407

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +++GL + +FF+A TA+N+ LIY +ELFPT VRN+  ++ RQA+V G   SP L++ GR 
Sbjct  408  IKVGLALTSFFSATTAYNVFLIYIIELFPTSVRNTTTSLVRQAIVFGNIFSPFLISAGRK  467

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            N  +SYGVFG+  +L C+ L++LPET G  LCDT+D++E K+  
Sbjct  468  NDVFSYGVFGVVIMLSCVTLLALPETKGQALCDTMDQQEKKDKN  511



>ref|XP_010688824.1| PREDICTED: organic cation/carnitine transporter 3-like [Beta 
vulgaris subsp. vulgaris]
Length=516

 Score =   218 bits (554),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 184/284 (65%), Gaps = 5/284 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSWR LYL+T IPGII S+I Y    ESPRWL+++G TQD +  +K +    +    T 
Sbjct  236  ASSWRNLYLWTSIPGIICSLICYYFILESPRWLFMQGRTQDSMAVLKKLGSSTSLVYSTL  295

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                  N  +G     ++   +++LK+LINK WA++RLL  M +A G+GL+Y+G+ LGVG
Sbjct  296  IINNMANLQEG----TKESSSFASLKILINKRWAVKRLLATMLLAFGLGLMYFGMFLGVG  351

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLL-IDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
             + FN+YL+   +A+  L + L+T +  + +  RR +++G  V+SG  ++   V      
Sbjct  352  NLGFNIYLTAAFSALLSLLSYLITFIYWVPRCNRRISLLGFCVISGTTSIIFSVLGNHSN  411

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
            + + I LE+V+ F AC A+N++L+YT+ELFPTCVRNSA  + RQ+M+ G    P+L+ LG
Sbjct  412  QGLIISLEVVSLFCACMAYNLVLMYTVELFPTCVRNSASLIVRQSMIFGSVFDPVLILLG  471

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            R N+ YSYGVFG+  ++C   ++SLPET G  LCDT++E+E ++
Sbjct  472  RQNKMYSYGVFGITVLVCGFLVLSLPETRGKVLCDTMEEQELRD  515



>ref|XP_006658692.1| PREDICTED: organic cation/carnitine transporter 3-like [Oryza 
brachyantha]
Length=485

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 184/279 (66%), Gaps = 10/279 (4%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +YL+T +P + YS+++Y + +ESPRWL +RG   D +ET++ +A           
Sbjct  191  ASWRNMYLWTSLPSLCYSILLYFLVQESPRWLLVRGRKHDAIETVREIAALNGGGITCSF  250

Query  185  tiF----SDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPL  352
            ++     ++ +D G         +++ L+ +  + WALRRL  +M  + G+G+VYYG+PL
Sbjct  251  SMLHACATEREDAG----AGGDGVFATLQSMWERRWALRRLAAIMTASFGVGMVYYGMPL  306

Query  353  GVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGE  532
             VG +  NLYLS T NA++E P+S+++ LL+ K+ RRS+V+ L  ++G+C+L CV  V  
Sbjct  307  NVGNLGSNLYLSVTYNALAEFPSSILSWLLMGKINRRSSVIALTSVAGLCSLACV--VIP  364

Query  533  ELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
            E    ++  E+++FF  CTAFNI+L+Y++ELFPT VRNSAV + RQA+V+GG  +P+LVA
Sbjct  365  EGSGERMAAEVLSFFATCTAFNIILMYSIELFPTSVRNSAVGLVRQALVLGGVAAPVLVA  424

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
            LGR   F+S+GVFGLA     LF   LPET G  + DT+
Sbjct  425  LGRDRSFWSFGVFGLAVGCLGLFAACLPETRGRSMSDTM  463



>ref|XP_008225995.1| PREDICTED: organic cation/carnitine transporter 2-like [Prunus 
mume]
Length=512

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 183/284 (64%), Gaps = 2/284 (1%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T IP I+Y +++     ESPRWLY+ G  ++ +  ++  + P   S +   
Sbjct  226  NSWRALYLCTSIPAILYCILLQFFVTESPRWLYMHGFVEEAIAILEKSSAPNYPSELKLL  285

Query  185  tiFSDNQDQGLIDLDEQMDL-YSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             + +    +G+ +  +  +  Y ++K L  K WA++R LTVM +  GIG+VYYG+PLGVG
Sbjct  286  LVSTGMPSEGVEETSKTNNHPYKSMKDLFAKRWAMKRTLTVMVLGFGIGMVYYGMPLGVG  345

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+YL    NA+ E+P+  +T +++++  R+ +V+   ++SG+C + C   VG   K
Sbjct  346  NLGFNIYLIVMFNALLEIPSYPITCIILERWSRKYSVLAFCLVSGICGILCA-IVGNGQK  404

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             ++IGLE+ +FF + TA+N++ ++T+ELFPTCVRNSA ++ RQ+ V+    S +LV++G 
Sbjct  405  GIRIGLELASFFCSRTAWNLISMFTVELFPTCVRNSATSLLRQSYVLSAVFSSILVSVGS  464

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             N F SYGVFGLA      F+  LP+T GG LCDT++E+E KE 
Sbjct  465  NNGFLSYGVFGLAIFFSGFFVACLPDTRGGTLCDTMEEQEGKEK  508



>gb|KEH29243.1| organic cation/carnitine transporter [Medicago truncatula]
Length=508

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/289 (38%), Positives = 181/289 (63%), Gaps = 18/289 (6%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SW+ +Y++T +P IIYSVI Y+   ESPRWL ++G  Q+ +  +K ++  E        
Sbjct  229  NSWKSVYIWTSVPAIIYSVIAYIFVTESPRWLLMQGRHQEAMAMLKGVSSVEN-------  281

Query  185  tiFSDNQDQGLID--LDEQ----MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
               SD+    LI+  +++Q      LYS++  L  + WAL+R++ VM + +GIG+VY+G+
Sbjct  282  ---SDDMIVSLIEAPVNKQKASIFQLYSSIAELFARSWALKRMMAVMVLGIGIGMVYFGM  338

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
            PL VG + F++YL+   N + E+P+ + T  L +  R+R   + +  ++        V V
Sbjct  339  PLAVGNLGFDIYLAVVFNGLMEIPSCVATYFLEN--RQRKPSILVFSVASGICCIMCVIV  396

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
            G   + +++GL + +FF+ACTA+N+ LIY +E+FPT VRN+  ++ RQA+V G   SP L
Sbjct  397  GSGQQGIKVGLAMTSFFSACTAYNVFLIYIIEVFPTSVRNTTTSLVRQAIVFGNIFSPFL  456

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            ++ GR N  +SYGVFG+  +L C+ L+ LPE+ G  L DT+D++E K++
Sbjct  457  ISAGRKNDIFSYGVFGVVIMLSCVTLLGLPESRGLALSDTMDQQEKKDD  505



>ref|NP_001240214.1| uncharacterized protein LOC100819053 [Glycine max]
 gb|ACU20215.1| unknown [Glycine max]
 gb|KHN40908.1| Organic cation/carnitine transporter 3 [Glycine soja]
Length=507

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 173/284 (61%), Gaps = 6/284 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSW+ LY++T IP I YS+I YL   ESPRWL ++G  Q+ +  +  ++  E  +++T 
Sbjct  227  NSSWKTLYVWTSIPAIFYSIIAYLFVTESPRWLLMQGREQEAMAMLNGVSSVENGANLTA  286

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            + +      Q          LYS++  L  + WAL+R++ +M + LGIG+VY+G+PL VG
Sbjct  287  SLLKVPAAKQK----SSIFQLYSSIAELFERSWALKRMVAIMVLGLGIGMVYFGMPLAVG  342

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + F++YL+  LNA+ E+P+ +VT  L +   RR   +    ++        V VG   +
Sbjct  343  NLGFDIYLAVVLNALMEIPSCVVTYFLEN--YRRKPSILAFSVASGICCVLCVVVGSGQQ  400

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
              ++G+ +VAFF+A TA+N+ LIY +ELFPT VRN+  ++ RQA V G    P L++ GR
Sbjct  401  VAKVGISLVAFFSAVTAYNVFLIYIIELFPTSVRNTTTSLVRQATVFGNIFIPFLISAGR  460

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             N  +SYGVFG+  +  CL LV LPET G  LCDT+D++E K +
Sbjct  461  KNDIFSYGVFGVVIISSCLTLVCLPETTGIALCDTMDQQEKKHS  504



>gb|AES87562.2| organic cation/carnitine transporter [Medicago truncatula]
Length=509

 Score =   216 bits (549),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/289 (38%), Positives = 181/289 (63%), Gaps = 18/289 (6%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SW+ +Y++T +P IIYSVI Y+   ESPRWL ++G  Q+ +  +K ++  E        
Sbjct  230  NSWKSVYIWTSVPAIIYSVIAYIFVTESPRWLLMQGRHQEAMAMLKGVSSVEN-------  282

Query  185  tiFSDNQDQGLID--LDEQ----MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
               SD+    LI+  +++Q      LYS++  L  + WAL+R++ VM + +GIG+VY+G+
Sbjct  283  ---SDDMIVSLIEAPVNKQKASIFQLYSSIAELFARSWALKRMMAVMVLGIGIGMVYFGM  339

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
            PL VG + F++YL+   N + E+P+ + T  L +  R+R   + +  ++        V V
Sbjct  340  PLAVGNLGFDIYLAVVFNGLMEIPSCVATYFLEN--RQRKPSILVFSVASGICCIMCVIV  397

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
            G   + +++GL + +FF+ACTA+N+ LIY +E+FPT VRN+  ++ RQA+V G   SP L
Sbjct  398  GSGQQGIKVGLAMTSFFSACTAYNVFLIYIIEVFPTSVRNTTTSLVRQAIVFGNIFSPFL  457

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            ++ GR N  +SYGVFG+  +L C+ L+ LPE+ G  L DT+D++E K++
Sbjct  458  ISAGRKNDIFSYGVFGVVIMLSCVTLLGLPESRGLALSDTMDQQEKKDD  506



>ref|XP_003605365.1| Solute carrier family 22 member [Medicago truncatula]
Length=529

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 109/289 (38%), Positives = 181/289 (63%), Gaps = 18/289 (6%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SW+ +Y++T +P IIYSVI Y+   ESPRWL ++G  Q+ +  +K ++  E        
Sbjct  250  NSWKSVYIWTSVPAIIYSVIAYIFVTESPRWLLMQGRHQEAMAMLKGVSSVEN-------  302

Query  185  tiFSDNQDQGLID--LDEQ----MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
               SD+    LI+  +++Q      LYS++  L  + WAL+R++ VM + +GIG+VY+G+
Sbjct  303  ---SDDMIVSLIEAPVNKQKASIFQLYSSIAELFARSWALKRMMAVMVLGIGIGMVYFGM  359

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
            PL VG + F++YL+   N + E+P+ + T  L +  R+R   + +  ++        V V
Sbjct  360  PLAVGNLGFDIYLAVVFNGLMEIPSCVATYFLEN--RQRKPSILVFSVASGICCIMCVIV  417

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
            G   + +++GL + +FF+ACTA+N+ LIY +E+FPT VRN+  ++ RQA+V G   SP L
Sbjct  418  GSGQQGIKVGLAMTSFFSACTAYNVFLIYIIEVFPTSVRNTTTSLVRQAIVFGNIFSPFL  477

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            ++ GR N  +SYGVFG+  +L C+ L+ LPE+ G  L DT+D++E K++
Sbjct  478  ISAGRKNDIFSYGVFGVVIMLSCVTLLGLPESRGLALSDTMDQQEKKDD  526



>gb|EAZ40293.1| hypothetical protein OsJ_24738 [Oryza sativa Japonica Group]
Length=532

 Score =   215 bits (548),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 179/281 (64%), Gaps = 8/281 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPE------tr  166
            +SWR +YL+T +P + Y++++Y + +ESPRWL +RG   D +ET++ +A           
Sbjct  232  ASWRSMYLWTSLPSLGYAILLYFLVQESPRWLLVRGRKHDAIETVRQIAALNGGGGITCS  291

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
             S+          D           +++ L+ +  + WALRRL  +M  + G+G+VYYG+
Sbjct  292  FSMLHACATEREDDSAGGAGGGGGGVFATLRSMWERRWALRRLAAIMTASFGVGMVYYGM  351

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
            PL VG +  NLYLS T NA++E P+S+++ LL+ ++ RRS+VV L   +GVC+L CV   
Sbjct  352  PLNVGNLGSNLYLSVTYNALAEFPSSVLSWLLMGRINRRSSVVALTAAAGVCSLACVAI-  410

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
              E    ++  E+++FF  CTAFNI+L+Y++ELFPT VRNSAV M RQA+V+GG  +P+L
Sbjct  411  -PEGTGGRMAAEVLSFFATCTAFNIILMYSIELFPTSVRNSAVGMVRQALVLGGVAAPML  469

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
            VALGR   F+S+GVFGLA     LF V LPET G  + DT+
Sbjct  470  VALGRERSFWSFGVFGLAVGCLGLFAVCLPETRGRSMSDTM  510



>ref|XP_007214516.1| hypothetical protein PRUPE_ppa015704mg, partial [Prunus persica]
 gb|EMJ15715.1| hypothetical protein PRUPE_ppa015704mg, partial [Prunus persica]
Length=509

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 193/299 (65%), Gaps = 25/299 (8%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssit-  178
              SWR LY  T IP  +Y ++V+ + RESPRWL+++G  ++ + T+K +AP    ++ T 
Sbjct  228  AHSWRTLYFCTSIPTFLYCIMVHFLVRESPRWLFVQGRKEEAIATLKHIAPINGTTTKTP  287

Query  179  -rttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLG  355
              ++ FS+      +  +++           N  WA RRL TV+ +  G+G+VYYG+ L 
Sbjct  288  LTSSFFSN------LSFEQETR---------NSTWAFRRLSTVVAIGFGVGMVYYGMQLA  332

Query  356  VGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEE  535
            +G + FNLYLS T N +SELPASL+TL+ I K+ R+++++    LSGV ++  V+     
Sbjct  333  LGSLDFNLYLSVTFNGLSELPASLITLVFIAKMNRKTSLLVFTSLSGVFSIMSVLKGTHP  392

Query  536  L-KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
            + K +QI  E+V+FF+AC+A N+LLI+T+ELFPTCVRNSAV+M RQA+V+GG  SP+L A
Sbjct  393  IWKTLQIVFELVSFFSACSALNVLLIFTIELFPTCVRNSAVSMVRQAVVLGGVFSPMLAA  452

Query  713  LGRGN-RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV*TLNCLY  886
             GR N  F SYGVFG+   +  LF+V L ET G  +CDT+DEEE KE        +CLY
Sbjct  453  AGRINGGFLSYGVFGVVVGVFGLFVVCLQETRGRGICDTMDEEEYKERD------SCLY  505



>gb|EAZ04337.1| hypothetical protein OsI_26477 [Oryza sativa Indica Group]
Length=532

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 179/281 (64%), Gaps = 8/281 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPE------tr  166
            +SWR +YL+T +P + Y++++Y + +ESPRWL +RG   D +ET++ +A           
Sbjct  232  ASWRSMYLWTSLPSLGYAILLYFLVQESPRWLLVRGRKHDAIETVRQIAALNGGGGITCS  291

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
             S+          D           +++ L+ +  + WALRRL  +M  + G+G+VYYG+
Sbjct  292  FSMLHACATEREDDAAGGAGGGGGGVFATLRSMWERRWALRRLAAIMTASFGVGMVYYGM  351

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
            PL VG +  NLYLS T NA++E P+S+++ LL+ ++ RRS+VV L   +GVC+L CV   
Sbjct  352  PLNVGNLGSNLYLSVTYNALAEFPSSVLSWLLMGRINRRSSVVALTAAAGVCSLACVAI-  410

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
              E    ++  E+++FF  CTAFNI+L+Y++ELFPT VRNSAV M RQA+V+GG  +P+L
Sbjct  411  -PEGTGGRMAAEVLSFFATCTAFNIILMYSIELFPTSVRNSAVGMVRQALVLGGVAAPML  469

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
            VALGR   F+S+GVFGLA     LF V LPET G  + DT+
Sbjct  470  VALGRERSFWSFGVFGLAVGCLGLFAVCLPETRGRSMSDTM  510



>dbj|BAC83382.1| putative organic cation transporter [Oryza sativa Japonica Group]
 dbj|BAD31165.1| putative organic cation transporter [Oryza sativa Japonica Group]
Length=532

 Score =   215 bits (547),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 179/281 (64%), Gaps = 8/281 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPE------tr  166
            +SWR +YL+T +P + Y++++Y + +ESPRWL +RG   D +ET++ +A           
Sbjct  232  ASWRSMYLWTSLPSLGYAILLYFLVQESPRWLLVRGRKHDAIETVRQIAALNGGGGITCS  291

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
             S+          D           +++ L+ +  + WALRRL  +M  + G+G+VYYG+
Sbjct  292  FSMLHACATEREDDAAGGAGGGGGGVFATLRSMWERRWALRRLAAIMTASFGVGMVYYGM  351

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
            PL VG +  NLYLS T NA++E P+S+++ LL+ ++ RRS+VV L   +GVC+L CV   
Sbjct  352  PLNVGNLGSNLYLSVTYNALAEFPSSVLSWLLMGRINRRSSVVALTAAAGVCSLACVAI-  410

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
              E    ++  E+++FF  CTAFNI+L+Y++ELFPT VRNSAV M RQA+V+GG  +P+L
Sbjct  411  -PEGTGGRMAAEVLSFFATCTAFNIILMYSIELFPTSVRNSAVGMVRQALVLGGVAAPML  469

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
            VALGR   F+S+GVFGLA     LF V LPET G  + DT+
Sbjct  470  VALGRERSFWSFGVFGLAVGCLGLFAVCLPETRGRSMSDTM  510



>ref|XP_006657833.1| PREDICTED: organic cation/carnitine transporter 2-like [Oryza 
brachyantha]
Length=532

 Score =   213 bits (541),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 117/278 (42%), Positives = 183/278 (66%), Gaps = 7/278 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y++T +P + YSV+VY++ +ESPRWL +RG  Q+ +E ++ +A           
Sbjct  234  ASWRNMYVWTSLPSLCYSVLVYVLVQESPRWLLVRGRKQEAIEAVRQIASLNGGGGGGMM  293

Query  185  tiFSDNQDQGLIDLDEQMD-----LYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIP  349
            +      D   ++L E        L++ L+ +  + WALRRL  +M  + G+G+VYYG+P
Sbjct  294  SS-FSMLDACAVELGEDRGAGGEGLFATLQSMWERRWALRRLAAIMTASFGVGMVYYGMP  352

Query  350  LGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG  529
            L VG +  NLYLS   NAV+ELP+S+++ L + +  RR++V+ L   SG+C+L CVV  G
Sbjct  353  LNVGSLSSNLYLSVAYNAVAELPSSILSWLFMGRFNRRTSVLVLTTASGLCSLACVVIPG  412

Query  530  EELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLV  709
            E    V++  E+ +FF +CTA++++L+Y++ELFPT VRNSAV + RQA+V+GG ++P+LV
Sbjct  413  ER-TGVRMAAEVCSFFASCTAYDVMLMYSIELFPTSVRNSAVGLVRQAVVLGGVVAPVLV  471

Query  710  ALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCD  823
            A+GR   ++S+GVFGLA     LF+  LPET G  + D
Sbjct  472  AVGRERSYWSFGVFGLAVGCLGLFVACLPETRGRRMSD  509



>ref|XP_003627852.1| Solute carrier family 22 member [Medicago truncatula]
 gb|AET02328.1| organic cation/carnitine transporter [Medicago truncatula]
Length=526

 Score =   212 bits (539),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 118/288 (41%), Positives = 180/288 (63%), Gaps = 13/288 (5%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSW+ LY+++ +P I YSVI YL   ESPRWL ++G  ++ ++ +K ++  E+      
Sbjct  229  NSSWKSLYIWSSVPAICYSVIAYLFVTESPRWLVMQGREKEILKMLKRVSSEESADDD--  286

Query  182  ttiFSDNQDQGLIDLDEQ-----MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
                S N    L  L  +       LYS++  L +K WA+ R++ VM + +G+G+VY+G+
Sbjct  287  ----SVNLASNLPKLPPKEKVSFFQLYSSIGELFHKRWAVIRMIAVMILGIGLGMVYFGM  342

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
            PL VG + FN+YL+   +A  ELP+ + T  L + LRR+ +++   +L G+C + C V +
Sbjct  343  PLAVGNLGFNIYLAVVFSASMELPSCVATYFL-ENLRRKPSILVFSILGGICCVMCAV-L  400

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
               + A ++ L +VAFF ACTA+N+ LIY +ELFPTCVRN+  ++ RQA+V G    P L
Sbjct  401  ENRVPAAKVVLAMVAFFGACTAYNVFLIYIIELFPTCVRNTTTSLVRQAIVFGCIFCPFL  460

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            ++ GR N  YSYGVFG+  +L    L  LPET+G  LCDT+D++E KE
Sbjct  461  ISAGRKNNIYSYGVFGVVIMLSNFTLFFLPETMGIVLCDTMDQQEKKE  508



>ref|XP_003627841.1| Solute carrier family 22 member [Medicago truncatula]
Length=526

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/288 (41%), Positives = 180/288 (63%), Gaps = 13/288 (5%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSW+ LY+++ +P I YSVI YL   ESPRWL ++G  ++ ++ +K ++  E+      
Sbjct  229  NSSWKSLYIWSSVPAICYSVIAYLFVTESPRWLVMQGREKEILKMLKRVSSEESADDD--  286

Query  182  ttiFSDNQDQGLIDLDEQ-----MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
                S N    L  L  +       LYS++  L +K WA+ R++ VM + +G+G+VY+G+
Sbjct  287  ----SVNLASNLPILPPKEKVSFFQLYSSIGELFHKRWAVIRMIAVMILGIGLGMVYFGM  342

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
            PL VG + FN+YL+   +A  ELP+ + T  L + LRR+ +++   +L G+C + C V +
Sbjct  343  PLAVGNLGFNIYLAVVFSASMELPSCVATYFL-ENLRRKPSILVFSILGGICCVTCAV-L  400

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
               + A ++ L +VAFF ACTA+N+ LIY +ELFPTCVRN+  ++ RQA+V G    P L
Sbjct  401  ENRVPAAKVVLAMVAFFGACTAYNVFLIYIIELFPTCVRNTTTSLVRQAIVFGCIFCPFL  460

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            ++ GR N  YSYGVFG+  +L    L  LPET+G  LCDT+D++E KE
Sbjct  461  ISAGRKNNIYSYGVFGVVIMLSNFTLFFLPETIGIVLCDTMDQQEKKE  508



>ref|XP_009363372.1| PREDICTED: organic cation/carnitine transporter 3-like [Pyrus 
x bretschneideri]
Length=515

 Score =   209 bits (533),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/284 (42%), Positives = 183/284 (64%), Gaps = 5/284 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             +SWR LYL T IP ++Y +++     ESPRWL++ G  ++ V  +   A     S +  
Sbjct  233  ANSWRALYLCTSIPAVLYCLLLQFFVSESPRWLFMNGKKEEAVAILLKSAGQNYPSELKL  292

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
              + S   +    ++      Y ++K L  K WA++R LTVM +  GIG+VYYG+PLGVG
Sbjct  293  LLVSSHEVEVDSSNISNHP--YKSMKDLFAKRWAMKRTLTVMVLGFGIGMVYYGMPLGVG  350

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+YLS   NA+ E+P+  +T +++++  R+ +V+G  ++SG+C + C V VG+  K
Sbjct  351  SLGFNIYLSVMFNALLEIPSYPITCIILERWSRKFSVLGFCLVSGICGIVCAV-VGQ--K  407

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             V+IGLE+ +FF + TA+N++ ++T+ELFPTCVRNSA ++ RQ+ V+    S +LV++G 
Sbjct  408  GVRIGLELASFFCSRTAWNLISMFTVELFPTCVRNSATSLLRQSYVLSAVFSSMLVSVGS  467

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             N F SYGVFGLA      F+  LP+T GG LCDT+DE+E KEN
Sbjct  468  SNEFLSYGVFGLAIFFSGFFVGFLPDTRGGMLCDTMDEQERKEN  511



>ref|XP_010045679.1| PREDICTED: organic cation/carnitine transporter 3-like [Eucalyptus 
grandis]
 gb|KCW83961.1| hypothetical protein EUGRSUZ_B00846 [Eucalyptus grandis]
Length=493

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 180/284 (63%), Gaps = 8/284 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWRYLY+ T  P I+Y ++++   RESP+WL+++G   + +  +  +APP     +   
Sbjct  214  ASWRYLYVSTSAPAILYCLLIFFFIRESPKWLFMQGRDDEAMAILTKIAPPTKHGRLKSY  273

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                 ++ +       + DLYS++K L  + WAL RL  VM +  GIG++YYG+ LGVG 
Sbjct  274  LSSLPHRQE-----TTKFDLYSSIKDLFRRRWALTRLAKVMALGFGIGMMYYGMLLGVGN  328

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + F++YLS T NA+  +P+  V+  L+++  R+ST++G  ++SGV ++ C  FVG    +
Sbjct  329  LGFDIYLSVTFNALLIIPSYFVSYFLLNQWNRKSTLLGFIMVSGVLSVACA-FVGS--GS  385

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            V+IGLE+ +FF  C A+N+L+I+T+ELFPT VRNSA +M RQA+ +G    P L++ GR 
Sbjct  386  VEIGLELASFFCTCMAYNVLVIFTIELFPTSVRNSATSMMRQAITLGVLFDPTLISAGRE  445

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                +Y VFG+  + C   ++ LPET G  L DT+DE+E ++ G
Sbjct  446  VPHLTYTVFGIVIIFCGFMVLFLPETRGMTLSDTMDEQEQRDFG  489



>ref|XP_010688820.1| PREDICTED: organic cation/carnitine transporter 2-like [Beta 
vulgaris subsp. vulgaris]
Length=518

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 181/284 (64%), Gaps = 6/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LYL+T IPGII +++ Y    ESPRWL+++G T+D +  ++ ++      S +  
Sbjct  234  SSWRTLYLYTTIPGIICTLLCYFFLLESPRWLFMQGRTKDSMAVLRKLSSNTLSYSTSIM  293

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                 N    L        L+++L +L+ K WA++RL   + +A GIGL+Y+G+ LGV  
Sbjct  294  -----NNIGALQKTPNNTSLFASLNILLKKRWAVKRLSASVVLAFGIGLLYFGMFLGVEH  348

Query  365  MPFNLYLSTTLNAVSELPASLVTLLL-IDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
            + FN+YL++T  A+  L + L+T L  I +  RRS+++G  V+SG  ++   V       
Sbjct  349  LGFNIYLTSTFTALLSLASYLLTFLFWIQRCNRRSSLLGFCVISGATSIIFAVIGKNVHV  408

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            ++ IGLE+V+ F AC A+N++L+YT+ELFPTCVR SA ++ RQAM+ G    P+L+ LGR
Sbjct  409  SLTIGLELVSLFCACMAYNLVLMYTVELFPTCVRISASSLVRQAMIFGSVFDPVLILLGR  468

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             N  YSYGVFG+  ++C   ++ LPET G  LCDT++E+E ++N
Sbjct  469  QNMIYSYGVFGITVLVCGFLVLCLPETRGKVLCDTMEEQELRDN  512



>ref|XP_007133866.1| hypothetical protein PHAVU_011G215600g [Phaseolus vulgaris]
 gb|ESW05860.1| hypothetical protein PHAVU_011G215600g [Phaseolus vulgaris]
Length=508

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 178/289 (62%), Gaps = 15/289 (5%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSW+ LY+ T +P I YSVI YL   ESPRWL ++G  Q+ +  +  M+     +    
Sbjct  227  NSSWKSLYVCTSVPAICYSVIAYLFVTESPRWLLMQGREQEAMAMLTGMSNSSVGN----  282

Query  182  ttiFSDNQDQGLIDL-----DEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
                  +   GL+ +         +LYS++  L  + WA +R++ +M + LGIG+VY+GI
Sbjct  283  ----GPDLTAGLLKVPVVKQKSIFELYSSIAELFERSWARKRVVAIMVLGLGIGMVYFGI  338

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
            PL VG + F++YL+   NA  E+P+ + T  L +  RR+ +++   V SG+C + C V V
Sbjct  339  PLAVGNLGFDIYLAVVFNAFMEIPSCVATYFL-ENCRRKPSILAFSVASGICCIFCAV-V  396

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
               LK  ++G+ +VAFF+A TA+N+ LIY +ELFPT VRN+  ++ RQA+V G    P L
Sbjct  397  STGLKVAKVGVSLVAFFSAVTAYNVFLIYVIELFPTRVRNTTTSLVRQAVVFGNIFIPFL  456

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            ++ GR N+ +SYGVFG+  +  CL LV LPET+G  L DT++++E KE+
Sbjct  457  ISEGRKNKIFSYGVFGVVIMSSCLSLVCLPETIGVALSDTMEQQEKKED  505



>ref|XP_003616420.1| Solute carrier family 22 member [Medicago truncatula]
 gb|AES99378.1| organic cation/carnitine transporter [Medicago truncatula]
Length=523

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 115/290 (40%), Positives = 170/290 (59%), Gaps = 16/290 (6%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSW+ LYL++ IP I YSVI Y    ESPRWL ++G  ++ ++ +K +   E+      
Sbjct  231  NSSWKSLYLWSSIPAICYSVIAYFFVTESPRWLIMQGREKEIIKRLKRVLSKESVDD---  287

Query  182  ttiFSDNQDQGLI----DLDEQMDL---YSALKLLINKGWALRRLLTVMWVALGIGLVYY  340
                 DN + G         E++ +   YS++  LI+K WAL R++ VM + +GIG+VY 
Sbjct  288  ----DDNTNLGSSLPKPPTKEKVTIFQHYSSIGELIHKRWALIRIIAVMILGIGIGMVYL  343

Query  341  GIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvv  520
            G+PL VG + FN+YL+   +A  E+P+ + T  L +   RR   + +  + G        
Sbjct  344  GMPLAVGNLGFNIYLAVVFSASMEIPSCVATYFLEN--YRRKPSILVFSILGGICCVMCA  401

Query  521  FVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISP  700
             V   +  V++ L +VAFF ACTA+N+ LIY +ELFPTCVRN+  ++ RQA+V G    P
Sbjct  402  VVENRVPTVKVVLAMVAFFGACTAYNVFLIYIIELFPTCVRNTTTSLVRQAIVFGCIFCP  461

Query  701  LLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             L++ GR N  +SYGVFG+  +L    L+ LPET G  LCDT+D +E KE
Sbjct  462  FLISAGRKNNIFSYGVFGVVIMLSNFTLLCLPETEGIVLCDTMDRQEKKE  511



>ref|XP_008372143.1| PREDICTED: organic cation/carnitine transporter 2-like [Malus 
domestica]
Length=515

 Score =   206 bits (525),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 119/284 (42%), Positives = 182/284 (64%), Gaps = 5/284 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             +SWR LYL T IP ++Y +++     ESPRWL+  G  ++ V  +   A     S +  
Sbjct  233  ANSWRALYLCTSIPAVLYCLLLQFFVSESPRWLFKNGKREEAVAILLKSAGQNYPSELKL  292

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
              + S   +    ++ +    Y ++K L  K WA++R LTVM +  GIG+VYYG+PLGVG
Sbjct  293  LLVSSHEVEVDSSNVSDHP--YKSMKDLFAKRWAMKRTLTVMVLGFGIGMVYYGMPLGVG  350

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+YLS   NA+ E+P+  +T +++++  R+ +V+G  ++SG+C + C V  G+  K
Sbjct  351  NLGFNIYLSVMFNALLEIPSYPITCIILERWSRKFSVLGFCLVSGICGIVCAV-XGQ--K  407

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             V+IGLE+ +FF + TA+N++ ++T+ELFPTCVRNSA ++ RQ+ V+    S +LV++G 
Sbjct  408  GVRIGLELASFFCSRTAWNLISMFTVELFPTCVRNSATSLLRQSXVLSAVFSSMLVSVGS  467

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             N F SYGVFGLA      F+  LP+T GG LCDT+DE+E KEN
Sbjct  468  SNEFLSYGVFGLAIFFSGFFVGFLPDTRGGMLCDTMDEQERKEN  511



>gb|KFK42346.1| hypothetical protein AALP_AA2G244300 [Arabis alpina]
Length=514

 Score =   206 bits (524),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/282 (40%), Positives = 171/282 (61%), Gaps = 7/282 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR+LYL T +P  +YS+ +YL A ESPRWL+++G  ++ +E +K +AP +     + +
Sbjct  231  ASWRFLYLSTSVPAAVYSIFLYLFALESPRWLHVQGKNEEAIEVLKRLAPTKEGYLESVS  290

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     +        EQ   YS   L I K WA RR++ VM +  G G+ YYG+PL V +
Sbjct  291  SRLPPKETL------EQAPSYSIKDLFIRK-WAFRRIIVVMIIMFGSGMSYYGVPLAVRD  343

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            M  N+YLS  LNA+ ELP  ++T +L+++  RRS++V   ++ G   + C V        
Sbjct  344  MKLNMYLSEALNAMVELPTFIITPILLERFNRRSSLVINCLIGGASGVFCFVISLFGRTN  403

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+ +FF A   FN++ IY +E+FPTCVRNSA  M RQA+++GGA SP++ ++G  
Sbjct  404  IAFALELASFFCARIVFNLMAIYMVEMFPTCVRNSATTMLRQALILGGACSPIIASIGTN  463

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             +  S+ VFGLA     LF + LPET G  LCDT++ +E  +
Sbjct  464  VQSLSFAVFGLAMSGLGLFALLLPETKGATLCDTMEAQEKSD  505



>emb|CBI24142.3| unnamed protein product [Vitis vinifera]
Length=922

 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 165/264 (63%), Gaps = 50/264 (19%)
 Frame = +2

Query  59   VIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLIDLDEQM  238
            V V+   RESPRWL +RG  ++ V T+K++                              
Sbjct  270  VCVHFFVRESPRWLLVRGRKEEAVATLKSIGA----------------------------  301

Query  239  DLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELP  418
                     +N             +  G+G+VYYG+PL +G +PFNLY + T NA+SELP
Sbjct  302  ---------VNN------------IGFGVGMVYYGMPLALGNLPFNLYWNVTFNALSELP  340

Query  419  ASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIGLEIVAFFTACTAFN  598
            ASL+    I++L R+S+V+   + SGVC++ CVV +GEE  +++IGLE+V+FF+ CTAF+
Sbjct  341  ASLIAFFFIERLNRKSSVLVFTMTSGVCSIMCVV-MGEEWASLKIGLELVSFFSTCTAFD  399

Query  599  ILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCL  778
            ILLIYT+ELFPTCVRNSA+AM RQA+V GG   P++V +G GN + SYGVFG+  + C L
Sbjct  400  ILLIYTIELFPTCVRNSAMAMVRQALVFGGVFCPVIVEIGMGNGYLSYGVFGVVIISCGL  459

Query  779  FLVSLPETLGGDLCDTIDEEESKE  850
            F+  LPET GG LCDT++EEE+KE
Sbjct  460  FVGCLPETKGGTLCDTMEEEENKE  483


 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/253 (42%), Positives = 151/253 (60%), Gaps = 52/253 (21%)
 Frame = +2

Query  62   IVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLIDLDEQMD  241
            + +   RESPRWL +RG  ++ V T+K++                               
Sbjct  677  VFHFFVRESPRWLLVRGRKEEAVATLKSIGA-----------------------------  707

Query  242  LYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPA  421
                    +N             +  G+G+VYYG+PL +G +PFNLY + T NA+SELPA
Sbjct  708  --------VNN------------IGFGVGMVYYGMPLALGNLPFNLYWNVTFNALSELPA  747

Query  422  SLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIGLEIVAFFTACTAFNI  601
            SL+    I++L R+S+V+   + SGVC++ CVV +GEE  +++IGLE+V+FF+ CTAF+I
Sbjct  748  SLIAFFFIERLNRKSSVLVFTMTSGVCSIMCVV-MGEEWASLKIGLELVSFFSTCTAFDI  806

Query  602  LLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLF  781
            LLIYT+ELFPTCVRNSA+AM RQA+V GG   P++V +GRGN + SYGVFG+  + C LF
Sbjct  807  LLIYTIELFPTCVRNSAMAMVRQALVFGGVFCPVIVEIGRGNGYLSYGVFGVVIISCGLF  866

Query  782  LVSLP--ETLGGD  814
                P   TLG +
Sbjct  867  EKYSPNSNTLGSN  879



>ref|XP_009149071.1| PREDICTED: organic cation/carnitine transporter 6-like [Brassica 
rapa]
Length=521

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 174/284 (61%), Gaps = 6/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR+LYL+T +P ++Y + +YL A ESPRWL+L+G  ++ ++ +K+M+           
Sbjct  238  SSWRFLYLYTAVPALLYCIFLYLFALESPRWLHLQGNDEEAIKVLKSMSSKNKPYLELLV  297

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            ++    Q+       +Q+  YS +K    + WA RR++ VM +  G+G+ YYG+PL   +
Sbjct  298  SVLPLEQET-----SKQLTRYS-IKDFFFRKWAFRRIVVVMIIMFGLGISYYGVPLAARD  351

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS TLNAV ELP+ ++T +L+++  RRS+V+   +L G   + C V        
Sbjct  352  IDVNIYLSETLNAVVELPSFVITPILLERFNRRSSVLVNTLLGGASGVLCFVLSVLGKTG  411

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+  FF A   FN++ +Y +E+FPTCVR+SA  M RQA+VVGGA  PL+ ++GR 
Sbjct  412  IAFAFELSTFFCARIGFNLMAVYMVEMFPTCVRSSATMMFRQALVVGGACCPLIASIGRD  471

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                S+ +FG+A     LF++ LPET G  LCDT++E+E ++  
Sbjct  472  LPSVSFAIFGVAMSGLGLFVLILPETKGSSLCDTMEEQEKRDQA  515



>ref|XP_002467752.1| hypothetical protein SORBIDRAFT_01g033410 [Sorghum bicolor]
 gb|EER94750.1| hypothetical protein SORBIDRAFT_01g033410 [Sorghum bicolor]
Length=555

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 118/300 (39%), Positives = 185/300 (62%), Gaps = 18/300 (6%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP----PEtrssi  175
            SWR +Y +  +P + Y+ +++ +A+ESPRWL +RG  +D VET++ +A       T    
Sbjct  237  SWRSIYFWMSVPCLFYAALLHFLAQESPRWLLVRGRKRDAVETLRQLAALNGGSSTTDLS  296

Query  176  trttiFSDNQDQGLIDLDEQMD----------LYSALKLLINKGWALRRLLTVMWVALGI  325
                      +   + + E+ D          +++AL+ +  + WA+RRL  +M    G+
Sbjct  297  VLELELELELEACCVTMHEEDDGGSSGGGGGGVFAALQAMWERPWAIRRLAAIMVAGFGV  356

Query  326  GLVYYGIPLGVGEM---PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsg  496
            G+VY+G+PL VG +     NLYLST  NA++E+P+S+++ LL+ +  RRS+VV L   +G
Sbjct  357  GMVYFGMPLTVGSLGSRSSNLYLSTVYNALAEVPSSILSGLLMARANRRSSVVALAASAG  416

Query  497  vcnlgcvvFVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAM  676
             C+L CV  V +   A ++  E+++FF  CTA++++LIY++ELFPT VRNSAV + RQAM
Sbjct  417  ACSLACVA-VPQRAGAARMAAELLSFFATCTAYDLILIYSIELFPTSVRNSAVGLVRQAM  475

Query  677  VVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            V+GG  +P+LVALGR    +S+GVFGL      LF  SLPET G  + DT+++EE +   
Sbjct  476  VLGGMAAPVLVALGRERSIWSFGVFGLVIGCSGLFAASLPETRGRSMLDTMEDEEMRSQA  535



>gb|ACB59210.1| transporter-related protein [Brassica oleracea]
Length=481

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 171/283 (60%), Gaps = 6/283 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR+LYL+T +P I Y + +Y+ A ESPRWL+++G  ++ +  +K+M+        +  
Sbjct  198  SSWRFLYLYTAVPAIFYCIFLYIFALESPRWLHMQGNDEEAINVLKSMSSKNKPYLESLV  257

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+       E++  YS +K    + WA RR++ VM +  G+G+ YYG+PL   +
Sbjct  258  SQLPPEQETS-----EELPRYS-IKDFFFRKWAFRRIVVVMIILFGLGISYYGVPLAARD  311

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS TLNAV ELP  ++T +++++  RRS+V+   +L G   + C V        
Sbjct  312  IDVNIYLSETLNAVVELPTFIITPIILERFNRRSSVLVNTLLGGASGVLCFVLSLLGKTG  371

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+  FF A   FN++ +Y +E+FPTCVR+SA  M RQA+VVGGA  PL+ ++GR 
Sbjct  372  IAFAFELATFFCARIGFNLMAVYMVEMFPTCVRSSATMMFRQALVVGGACCPLIASIGRD  431

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
                S+ +FG+A     LF++ LPET G  LCDT++E+E ++ 
Sbjct  432  LPSVSFAIFGVAMSGFGLFVLVLPETKGSSLCDTMEEQEKRDQ  474



>ref|XP_004986929.1| PREDICTED: organic cation/carnitine transporter 2-like [Setaria 
italica]
Length=537

 Score =   204 bits (519),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 116/293 (40%), Positives = 178/293 (61%), Gaps = 19/293 (6%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +YL+T +P + YS++VY + +ESPRWL +RG  Q+ VE ++ +            
Sbjct  235  ASWRNMYLWTSVPCLCYSILVYFLVQESPRWLLVRGRKQEAVEALRQI---------ISL  285

Query  185  tiFSDNQDQGLIDLDEQM--------DLYSALKLLINKGWALRRLLTVMWVALGIGLVYY  340
               SD        LD            +++ L+ +  + WALRRL  +M  + G+G+VY+
Sbjct  286  NGRSDTTAASFCMLDACAADADSAGGGVFATLRAVWERRWALRRLAAMMAASFGVGMVYF  345

Query  341  GIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvv  520
            G+PL VG +  NLYLS   NA++ELP++ +  +LI +  RR +V+ L   SG C+L C  
Sbjct  346  GMPLNVGSLGSNLYLSVAYNALAELPSAALACVLISRTGRRGSVIALAAASGACSLACAA  405

Query  521  FVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISP  700
                   A ++  E+++FF ACTA +++L+Y+ ELFPT VRNSAV + RQAMV+GG  +P
Sbjct  406  IP-RGAAAARMSAEVLSFFAACTAIDVMLVYSTELFPTSVRNSAVGLVRQAMVLGGVAAP  464

Query  701  LLVALGRGNR-FYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            +L+ALGR    F+S+GVFG+A     LF+  LPET+G  + DT++E+E +   
Sbjct  465  VLIALGRERSLFWSFGVFGIAIGCSALFVACLPETMGKSMSDTMEEDEERNEA  517



>gb|AAM78113.1| At1g79410/T8K14_17 [Arabidopsis thaliana]
Length=378

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 167/284 (59%), Gaps = 7/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SW+ LYL T IP  I+S+ +Y  A ESPRWL+L G  ++ +E +K ++P       + +
Sbjct  95   ASWKVLYLCTSIPAGIHSIFIYFFALESPRWLHLEGKNKEAIEVLKRISPANRGYLESVS  154

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     +        EQ   YS   L I K WA RR+  VM +  G+G+ YYG+PL V +
Sbjct  155  SRLRPKETL------EQTSSYSIKDLFIIK-WAFRRVTLVMIIMFGLGMSYYGVPLAVRD  207

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+Y+S  LNA+ ELP  +VT +L+++  RRS+V+   ++ G   + C V        
Sbjct  208  IKVNIYMSEALNAMVELPTFVVTPILLEQFSRRSSVLVNCLIGGASGVLCFVMSLYGRTK  267

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+ +FF A   FN++ IY +ELFPTCVRNSA  M RQA+VVGGA  PL+ +LGR 
Sbjct  268  IAFALELGSFFCARIGFNLMAIYLVELFPTCVRNSATMMLRQALVVGGACCPLIASLGRN  327

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                S+ VFG A     LF + LPET G  LCDT++E+E ++  
Sbjct  328  VPSLSFAVFGFAMSGLGLFALLLPETKGLSLCDTMEEQEQRDQA  371



>ref|XP_008661101.1| PREDICTED: LOW QUALITY PROTEIN: organic cation/carnitine transporter 
3-like [Zea mays]
Length=537

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 180/291 (62%), Gaps = 9/291 (3%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP-PEtrssitrt  184
            SWR +Y +  +P + Y+ +++L+A+ESPRWL +RG  +D +E+++ +A   ++    T  
Sbjct  238  SWRSMYFWMVVPCLFYAALIHLLAQESPRWLLVRGHKRDAIESLRQIATLDDSGGHTTTN  297

Query  185  tiFSDNQDQGLIDLDEQ-------MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYG  343
                + + +  + +  +         +++ L+++  + WA+RRL  +M    G+G+VY+G
Sbjct  298  LSMLELELEACVSMHNEDGASSSGSGVFATLQVMWERPWAIRRLAAIMVAGFGVGMVYFG  357

Query  344  IPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvF  523
            +PL VG +  NLYLST  NA++E+P+S+++ LLI +  RR T V +   S          
Sbjct  358  MPLTVGSLGSNLYLSTAYNALAEVPSSILSWLLIARANRR-TSVVVLAASAGVLSLACAA  416

Query  524  VGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
            + +  +A ++  E+++FF  CTA++++L+Y++ELFPT VRNSAV + RQAMV+GG  +P+
Sbjct  417  MPQRAEAARMAGELLSFFATCTAYDVILVYSIELFPTSVRNSAVGLVRQAMVLGGMAAPV  476

Query  704  LVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            LVALGR    +S+GVFGL      LF  SLPET    + DT+++E+ +   
Sbjct  477  LVALGRERSIWSFGVFGLVIGCSGLFAASLPETRWRSMSDTMEDEDMRSEA  527



>emb|CDY35085.1| BnaA06g10950D [Brassica napus]
Length=518

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 171/283 (60%), Gaps = 6/283 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR+LYL+T +P I Y + +Y+ A ESPRWL+++G  ++ +  +K+M+        +  
Sbjct  235  SSWRFLYLYTAVPAIFYCIFLYIFALESPRWLHMQGNDEEAINVLKSMSSKNKPYLESLV  294

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+       E++  YS +K    + WA RR++ VM +  G+G+ YYG+PL   +
Sbjct  295  SQLPPEQETS-----EELPRYS-IKDFFFRKWAFRRIVVVMIILFGLGISYYGVPLAARD  348

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS TLNAV ELP  ++T +L+++  RRS+V+   +L G   + C V        
Sbjct  349  IDVNIYLSETLNAVVELPTFVITPILLERFNRRSSVLVNTLLGGASGVLCFVLSLLGKTG  408

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+  FF A   FN++ +Y +E+FPTCVR+SA  M RQA+VVGGA  PL+ ++GR 
Sbjct  409  MAFAFELATFFCARIGFNLMAVYMVEMFPTCVRSSATMMFRQALVVGGACCPLIASIGRD  468

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
                S+ +FG+A     LF++ LPET G  LCDT++E+E ++ 
Sbjct  469  LPSVSFAIFGVAMSGFGLFVLILPETKGSSLCDTMEEQEKRDQ  511



>emb|CDY33333.1| BnaC05g12500D [Brassica napus]
Length=522

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 175/292 (60%), Gaps = 8/292 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWRYLYL+T +P   Y + +YL A ESPRWL+L+G  ++ +  +K+++        +  
Sbjct  238  SSWRYLYLYTAVPATFYCIFLYLFALESPRWLHLQGNNEEAIVVLKSLSSKNKAYLESLI  297

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+       E +  YS +K    + WA RR+L VM +  G+G+ YYG+PL V +
Sbjct  298  SKLPLEQETV-----EALPRYS-IKDFFFRKWAFRRILVVMVILFGMGMSYYGVPLAVRD  351

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS TLNAV ELP  ++T  +++++ RRS+V+   +L G   + C V        
Sbjct  352  IDVNIYLSETLNAVVELPTFIITPFILERVNRRSSVLVNTLLGGASGVLCFVLSVFGKTG  411

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+  FF A T FN++ +Y +E+FPTCVR+SA  M RQA+VVGGA  PL+ ++GR 
Sbjct  412  IAFAFELGTFFCARTGFNLMAVYMVEMFPTCVRSSATMMFRQALVVGGACCPLIASIGRD  471

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV*TLNC  880
                S+ +FG+A     LF++ LPET G  LCDT++E+E ++    + T NC
Sbjct  472  LPSVSFAIFGVAMSGLGLFVLILPETKGSSLCDTMEEQEKRD--QTINTSNC  521



>gb|EYU33503.1| hypothetical protein MIMGU_mgv1a027031mg [Erythranthe guttata]
Length=282

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/268 (44%), Positives = 179/268 (67%), Gaps = 13/268 (5%)
 Frame = +2

Query  56   SVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLIDLDEQ  235
            S ++Y  A ESPRWL++ G  ++F ET+++M+  +  +   R   F +N  +  ID D +
Sbjct  17   SFVLYFSADESPRWLFINGRRKEFAETLRSMSSQKNINLTER---FFENCVRKNIDDDRR  73

Query  236  MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPF-NLYLSTTLNAVSE  412
              +YS   +L+ K WALRRL  ++ V  G+G+ +YG+PLG+G + F NLYLS  LNA SE
Sbjct  74   --IYS---ILLEKKWALRRLAALVVVGFGVGMAFYGMPLGLGSLSFGNLYLSVALNAASE  128

Query  413  LPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIGLEIVAFFTACTA  592
            L A ++  ++I KL+RR +++GL +LSGVC    V  VG  LK V++GLE+V+FF+ C A
Sbjct  129  LSAEVLLFIVIGKLKRRGSLLGLCLLSGVCGSASVFAVG--LKGVEMGLEMVSFFSVCIA  186

Query  593  FNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVAL--GRGNRFYSYGVFGLASV  766
            FN+LLIY +ELFPT VRN+A+++ R + +VGG + P++V +  G+     +Y VFG A  
Sbjct  187  FNVLLIYVVELFPTRVRNTAMSVVRGSTLVGGLVGPIVVGVAGGKNGGSLAYSVFGAAIA  246

Query  767  LCCLFLVSLPETLGGDLCDTIDEEESKE  850
            +C   +V LPET G  LCD ++EEE+++
Sbjct  247  VCGFTVVLLPETKGKTLCDYMEEEEARD  274



>ref|XP_009149070.1| PREDICTED: organic cation/carnitine transporter 6-like [Brassica 
rapa]
Length=518

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 171/283 (60%), Gaps = 6/283 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR+LYL+T +P I Y + +Y+ A ESPRWL+++G  ++ +  +K+M+        +  
Sbjct  235  SSWRFLYLYTAVPAIFYCIFLYIFALESPRWLHMQGNDEEAINVLKSMSSKNKPYLESLV  294

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+       E++  YS +K    + WA RR++ VM +  G+G+ YYG+PL   +
Sbjct  295  SQLPPEQETS-----EELPRYS-IKDFFFRKWAFRRIVVVMIILFGLGISYYGVPLAARD  348

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS TLNAV ELP  ++T +L+++  RRS+V+   +L G   + C V        
Sbjct  349  IDVNIYLSETLNAVVELPTFVITPILLERFNRRSSVLVNTLLGGASGVLCFVLSLLGKTG  408

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+  FF A   FN++ +Y +E+FPTCVR+SA  M RQA+VVGGA  PL+ ++GR 
Sbjct  409  MAFAFELATFFCARIGFNLMAVYMVEMFPTCVRSSATMMFRQALVVGGACCPLIASIGRD  468

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
                S+ +FG+A     LF++ LPET G  LCDT++E+E ++ 
Sbjct  469  LPSVSFAIFGVAMSGFGLFVLILPETKGSSLCDTMEEQEKRDQ  511



>gb|EAZ40296.1| hypothetical protein OsJ_24741 [Oryza sativa Japonica Group]
Length=515

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/285 (41%), Positives = 183/285 (64%), Gaps = 6/285 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y++T +P + Y+V++Y + +ESPRWL +RG  Q+ +  ++ +A       IT +
Sbjct  222  ASWRNMYVWTSLPSLCYAVLLYFLVQESPRWLLVRGRKQEAIAALRQIASLNGGEGITTS  281

Query  185  tiFSDNQDQGLID--LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGV  358
            +        G +   +     ++S L+ +  + WALRRL  +     G+G+VYYG+PL V
Sbjct  282  SFTKLETCAGEVGDGVAGGEGMFSTLRSICERRWALRRLAAITTATFGVGVVYYGMPLSV  341

Query  359  GEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
            G +  +LYLS   NA +ELP+S+++ LL+ +  RRS++V L   SG+C+L CVV    E 
Sbjct  342  GSLSSDLYLSVAYNAAAELPSSVLSWLLMGRFNRRSSLVALTAASGLCSLACVVIPDPEA  401

Query  539  KA----VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
             A    +++  E+ +FF +C A+++LL+Y++ELFPT VRNSAV + RQA V+GG ++P+L
Sbjct  402  GAGGSHLRLAAELASFFASCAAYDVLLMYSIELFPTSVRNSAVGLVRQAGVLGGVVAPML  461

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEE  841
            VALGR   ++S+GVFGL      LF+  LPET G  L DT+++EE
Sbjct  462  VALGRERSYWSFGVFGLTVGCLGLFVTFLPETKGRRLSDTMEDEE  506



>ref|NP_173087.1| organic cation/carnitine transporter 6 [Arabidopsis thaliana]
 sp|Q9SA36.1|OCT6_ARATH RecName: Full=Organic cation/carnitine transporter 6; Short=AtOCT6 
[Arabidopsis thaliana]
 gb|AAD34689.1|AC006341_17 Is a member of the PF|00083 sugar transporter family [Arabidopsis 
thaliana]
 dbj|BAF01217.1| putative transport protein [Arabidopsis thaliana]
 gb|AEE29443.1| organic cation/carnitine transporter 6 [Arabidopsis thaliana]
Length=521

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 171/284 (60%), Gaps = 6/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWRYLYL+T +P + Y + +YL A ESPRWL+++G  ++ ++ +  M+P E     +  
Sbjct  237  SSWRYLYLYTSVPAVFYCIFLYLFALESPRWLHMQGKDKEAIDVLTKMSPKEKAYLESVV  296

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+       EQ   YS +K    + WA RR+L VM +  G+G+ YYG+PL   +
Sbjct  297  SKLPLKQENF-----EQAPTYS-IKDFFFRKWAFRRILVVMIIMFGLGISYYGVPLAARD  350

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS TLNA+ ELP  ++T +L+++  RRS+V+   +L G   + C V        
Sbjct  351  IDVNIYLSETLNALVELPTFVITPILLERFNRRSSVLVNTLLGGASGVLCFVLSILGKTE  410

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+  FF A   FN++ ++ +E+FPTCVR+SA  M RQA+VVGGA  PL+ ++GR 
Sbjct  411  IAFAFELGTFFCARIGFNLMAVFMVEMFPTCVRSSATMMFRQALVVGGACCPLIASIGRY  470

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                S+ +FG+A     +F++ LPET G  LCD+++E+E ++  
Sbjct  471  IPSVSFAIFGIAMSGLGMFVLILPETKGLSLCDSMEEQEKRDQA  514



>ref|NP_001059990.1| Os07g0562400 [Oryza sativa Japonica Group]
 dbj|BAC83389.1| putative organic cation transporter [Oryza sativa Japonica Group]
 dbj|BAF21904.1| Os07g0562400 [Oryza sativa Japonica Group]
Length=534

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/285 (41%), Positives = 183/285 (64%), Gaps = 6/285 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y++T +P + Y+V++Y + +ESPRWL +RG  Q+ +  ++ +A       IT +
Sbjct  241  ASWRNMYVWTSLPSLCYAVLLYFLVQESPRWLLVRGRKQEAIAALRQIASLNGGEGITTS  300

Query  185  tiFSDNQDQGLID--LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGV  358
            +        G +   +     ++S L+ +  + WALRRL  +     G+G+VYYG+PL V
Sbjct  301  SFTKLETCAGEVGDGVAGGEGMFSTLRSICERRWALRRLAAITTATFGVGVVYYGMPLSV  360

Query  359  GEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
            G +  +LYLS   NA +ELP+S+++ LL+ +  RRS++V L   SG+C+L CVV    E 
Sbjct  361  GSLSSDLYLSVAYNAAAELPSSVLSWLLMGRFNRRSSLVALTAASGLCSLACVVIPDPEA  420

Query  539  KA----VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
             A    +++  E+ +FF +C A+++LL+Y++ELFPT VRNSAV + RQA V+GG ++P+L
Sbjct  421  GAGGSHLRLAAELASFFASCAAYDVLLMYSIELFPTSVRNSAVGLVRQAGVLGGVVAPML  480

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEE  841
            VALGR   ++S+GVFGL      LF+  LPET G  L DT+++EE
Sbjct  481  VALGRERSYWSFGVFGLTVGCLGLFVTFLPETKGRRLSDTMEDEE  525



>gb|EAZ04340.1| hypothetical protein OsI_26480 [Oryza sativa Indica Group]
Length=534

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/285 (41%), Positives = 183/285 (64%), Gaps = 6/285 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y++T +P + Y+V++Y + +ESPRWL +RG  Q+ +  ++ +A       IT +
Sbjct  241  ASWRNMYVWTSLPSLCYAVLLYFLVQESPRWLLVRGRKQEAIAALRQIASLNGGEGITTS  300

Query  185  tiFSDNQDQGLID--LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGV  358
            +        G +   +     ++S L+ +  + WALRRL  +     G+G+VYYG+PL V
Sbjct  301  SFTKLETCAGEVGDGVAGGEGMFSTLRSICERRWALRRLAAITTATFGVGVVYYGMPLSV  360

Query  359  GEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
            G +  +LYLS   NA +ELP+S+++ LL+ +  RRS++V L   SG+C+L CVV    E 
Sbjct  361  GSLSSDLYLSVAYNAAAELPSSVLSWLLMGRFNRRSSLVALTAASGLCSLACVVIPDPEA  420

Query  539  KA----VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
             A    +++  E+ +FF +C A+++LL+Y++ELFPT VRNSAV + RQA V+GG ++P+L
Sbjct  421  GAGGSHLRLAAELASFFASCAAYDVLLMYSIELFPTSVRNSAVGLVRQAGVLGGVVAPML  480

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEE  841
            VALGR   ++S+GVFGL      LF+  LPET G  L DT+++EE
Sbjct  481  VALGRERSYWSFGVFGLTVGCLGLFVTFLPETKGRRLSDTMEDEE  525



>ref|XP_003616647.1| Solute carrier family 22 member [Medicago truncatula]
 gb|AES99605.1| organic cation/carnitine transporter [Medicago truncatula]
Length=532

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 179/292 (61%), Gaps = 21/292 (7%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSW+ LYL++ IP I YS I Y    ESPRWL ++G  ++ ++ +  ++  E+      
Sbjct  242  NSSWKSLYLWSSIPAIFYSFIAYFFVTESPRWLVMQGREKEILKMLNKVSSEESV-----  296

Query  182  ttiFSDNQDQGLID------LDEQMDL---YSALKLLINKGWALRRLLTVMWVALGIGLV  334
                 D+ +  L          E++ +   YS++  L +K WAL R++ VM +++GIG+V
Sbjct  297  -----DDDNINLASSLPKPPAKEKISIFKHYSSIGKLFHKKWALIRMIAVMILSIGIGMV  351

Query  335  YYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgc  514
            YYG+PL VG + FN+YL+   +A  E+P S V +  ++  RR+ +++   +LSG+C + C
Sbjct  352  YYGMPLAVGNLGFNIYLAVVFSASMEIP-SCVAIYFLENYRRKLSILVFSILSGICCVMC  410

Query  515  vvFVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAI  694
            VV V   + A+++ L ++AFF A TA+N+ LIY +ELFPTCVRN+  ++ RQA V G   
Sbjct  411  VV-VENNVPAIKVVLAMIAFFGASTAYNVFLIYIIELFPTCVRNTTTSLVRQATVFGCIF  469

Query  695  SPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             P L++ GR N  +SYG+FG+  +L  L    LPET G  LCDT+D++E KE
Sbjct  470  CPFLISAGRKNNIFSYGMFGVVIMLSNLIFFYLPETKGIVLCDTMDQQEKKE  521



>ref|NP_001059989.1| Os07g0562300 [Oryza sativa Japonica Group]
 dbj|BAC83386.1| putative organic cation transporter [Oryza sativa Japonica Group]
 dbj|BAF21903.1| Os07g0562300 [Oryza sativa Japonica Group]
 gb|EAZ40295.1| hypothetical protein OsJ_24740 [Oryza sativa Japonica Group]
Length=537

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 183/293 (62%), Gaps = 32/293 (11%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y++T +P + Y+V++Y + +ESPRWL +RG  Q+ +E ++ +A           
Sbjct  233  ASWRTMYVWTSLPSLCYAVLLYFLVQESPRWLLVRGRNQEAIEALRQIA-----------  281

Query  185  tiFSDNQDQGLIDLDEQM----------------DLYSALKLLINKGWALRRLLTVMWVA  316
               S N  +G+      M                 ++++L+L+  + WA +RL  +M  +
Sbjct  282  ---SLNGGEGVTTSSFSMLDACAVEVGDGVAGGDGMFASLRLIWERRWAFQRLAAMMTAS  338

Query  317  LGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsg  496
             G+G+VYYG+PL VG +  +LYLS   NA +ELP+S+++ LL+ +  RRS++V L   SG
Sbjct  339  FGVGVVYYGLPLSVGSLSSDLYLSVAYNAAAELPSSVLSWLLMGRFNRRSSLVALTAASG  398

Query  497  vcnlgcvvFVGEE--LKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQ  670
            +C+L CVV   EE     +++  E+ +FF +C AF+++L+Y++ELFPT VRNSAV + R+
Sbjct  399  LCSLACVVIPDEEAGTGGLRLAAELASFFASCAAFDVMLMYSIELFPTSVRNSAVGLVRK  458

Query  671  AMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
            A V+GG ++P+LVALGR   ++S+GVFGLA     LF+  LPET G  L DT+
Sbjct  459  AAVLGGVVAPMLVALGRERSYWSFGVFGLAVGCLGLFVTWLPETKGRRLSDTM  511



>gb|EMT22077.1| Solute carrier family 22 member 12 [Aegilops tauschii]
Length=455

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 163/257 (63%), Gaps = 3/257 (1%)
 Frame = +2

Query  83   ESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLIDLDEQMDLYSALKL  262
            ESPRWL +RG  QD ++T++ M      SS           D           +++ L  
Sbjct  182  ESPRWLLVRGRRQDAIDTLQQMQIGGITSSNFSMIHACAMNDDDDDAEAGASSVFATLHS  241

Query  263  LINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLL  442
            +  + WALRRL  +M  + G+G+VYYG+PL VG +  NLYLS T NA++ELP+S+++ LL
Sbjct  242  MWERPWALRRLAAIMTASFGVGMVYYGMPLNVGNLGSNLYLSVTYNALAELPSSILSWLL  301

Query  443  IDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIGLEIVAFFTACTAFNILLIYTLE  622
            + ++ RRS+VV L   +G+ +L CV+         ++  E+V+FF  CTAFN++L+Y++E
Sbjct  302  MGRINRRSSVVALTAAAGLWSLACVII---PQGTARMAAELVSFFATCTAFNVILMYSIE  358

Query  623  LFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPET  802
            LFPT VRNSAV + RQA+V+GG  +PLLVALGR N F+S+GV GL      +F   LPET
Sbjct  359  LFPTSVRNSAVGLVRQALVLGGVAAPLLVALGRRNSFFSFGVLGLVIGCSGMFAACLPET  418

Query  803  LGGDLCDTIDEEESKEN  853
             G  + DT+DEE+ KE+
Sbjct  419  KGKAMSDTMDEEDHKEH  435



>ref|XP_009106661.1| PREDICTED: organic cation/carnitine transporter 5-like [Brassica 
rapa]
Length=514

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 106/287 (37%), Positives = 172/287 (60%), Gaps = 6/287 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T +P +++S+ +   A ESPRWL+L+G   + +E +K ++P       + +
Sbjct  230  ASWRVLYLCTSVPAVVHSIFLLFFALESPRWLHLQGRNHEAIEVLKIISPETRAYLESVS  289

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+       EQ   Y+   L I + WA RR++ VM +  G+G+ YYG+PL V +
Sbjct  290  SRLLQQQET-----PEQAPRYTIKDLFI-RNWAFRRIMVVMIIMFGLGMSYYGVPLAVRD  343

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS +LNA+ ELP+ ++T +L+++  RR +V+   ++ G   + C          
Sbjct  344  IKLNIYLSESLNAMVELPSFVITPILLERFNRRRSVLVNALVGGASGVLCFFLSLFGRTK  403

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +  GLE+V+F  A   FN++ +Y +ELFPTCVRN A+ M RQA+VVGGA  P++ ++GR 
Sbjct  404  IAFGLELVSFLCARIGFNLMAVYIVELFPTCVRNCAMTMLRQALVVGGACCPIIASVGRH  463

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV  865
                S+ VFG A     LF++ LPET G  LCDT++ +E ++   ++
Sbjct  464  VPSLSFAVFGFAMSGFGLFVLLLPETKGSSLCDTMEAQELRDQALKI  510



>ref|XP_002889243.1| hypothetical protein ARALYDRAFT_477106 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65502.1| hypothetical protein ARALYDRAFT_477106 [Arabidopsis lyrata subsp. 
lyrata]
Length=514

 Score =   201 bits (511),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 166/284 (58%), Gaps = 7/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SW+ LYL T +P  I+S+ +Y  A ESPRWL+L G  ++ +E +K ++P       + +
Sbjct  232  ASWKILYLCTSVPAGIHSIFIYFFALESPRWLHLEGKNEEAIEVLKRISPANKGYLESVS  291

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     +        +Q   YS   L I K WA +R+  VM +  G+G+ YYG+PL V +
Sbjct  292  SRLPPKETL------DQTSSYSIKDLFIRK-WAFQRVTLVMIIMFGLGMSYYGVPLAVRD  344

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA+ ELP  +VT +L++K  RRS+V+   ++ G   + C          
Sbjct  345  IKVNIYLSEALNAMVELPTFVVTPILLEKFSRRSSVLVNCLIGGASGVLCFAMSLYGRTK  404

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+ +FF A   FN++ +Y +ELFPTCVRNSA  M RQA+VVGGA  PL+ +LGR 
Sbjct  405  IAFALELGSFFCARIGFNLMAVYMVELFPTCVRNSATMMLRQALVVGGACCPLIASLGRN  464

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                S+ VFG A     LF + LPET G  LCDT++E+E ++  
Sbjct  465  IPSLSFAVFGFAMSGLGLFALLLPETKGSSLCDTMEEQEQRDQA  508



>emb|CDX87384.1| BnaA07g34890D [Brassica napus]
Length=514

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/287 (37%), Positives = 173/287 (60%), Gaps = 6/287 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T +P  ++S+ +   A ESPRWL+L+G+ Q+ +E +K ++P       + +
Sbjct  230  ASWRVLYLCTSVPAAVHSIFLLFFALESPRWLHLQGMNQEAIEVLKRISPETRAYLESVS  289

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+       EQ   Y+   L I + WA RR++ VM +  G+G+ YYG+PL V +
Sbjct  290  SRLLQQQET-----PEQAPRYTIKDLFI-RNWAFRRIMVVMIIMFGLGMSYYGVPLAVRD  343

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  ++YLS +LNA+ ELP+ ++T +L+++  RRS+V+   ++ G   + C          
Sbjct  344  IKLSIYLSESLNAMVELPSFVITPILLERFNRRSSVLVNALVGGASGVLCFFLSLFGRTK  403

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+V+F  A   FN++ +Y +ELFPTCVRN A+ M RQA+VVGGA  P++ ++GR 
Sbjct  404  IAFALELVSFLCARIGFNLMAVYIVELFPTCVRNCAMTMLRQALVVGGACCPIIASVGRH  463

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV  865
                S+ VFG A     LF++ LPET G  LCDT++ +E ++   ++
Sbjct  464  VPSLSFAVFGFAMSGFGLFVLLLPETKGSSLCDTMEAQELRDQALKI  510



>ref|NP_178059.1| organic cation/carnitine transporter5 [Arabidopsis thaliana]
 sp|Q9SAK7.1|OCT5_ARATH RecName: Full=Organic cation/carnitine transporter 5; Short=AtOCT5 
[Arabidopsis thaliana]
 gb|AAD30235.1|AC007202_17 Is a member of the PF|00083 sugar transporter family [Arabidopsis 
thaliana]
 gb|AEE36239.1| organic cation/carnitine transporter5 [Arabidopsis thaliana]
Length=515

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 167/284 (59%), Gaps = 7/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SW+ LYL T IP  I+S+ +Y  A ESPRWL+L G  ++ +E +K ++P       + +
Sbjct  232  ASWKVLYLCTSIPAGIHSIFIYFFALESPRWLHLEGKNKEAIEVLKRISPANRGYLESVS  291

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     +        EQ   YS   L I K WA RR+  VM +  G+G+ YYG+PL V +
Sbjct  292  SRLRPKETL------EQTSSYSIKDLFIIK-WAFRRVTLVMIIMFGLGMSYYGVPLAVRD  344

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+Y+S  LNA+ ELP  +VT +L+++  RRS+V+   ++ G   + C V        
Sbjct  345  IKVNIYMSEALNAMVELPTFVVTPILLEQFSRRSSVLVNCLIGGASGVLCFVMSLYGRTK  404

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+ +FF A   FN++ IY +ELFPTCVRNSA  M RQA+VVGGA  PL+ +LGR 
Sbjct  405  IAFALELGSFFCARIGFNLMAIYLVELFPTCVRNSATMMLRQALVVGGACCPLIASLGRN  464

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                S+ VFG A     LF + LPET G  LCDT++E+E ++  
Sbjct  465  VPSLSFAVFGFAMSGLGLFALLLPETKGLSLCDTMEEQEQRDQA  508



>gb|EEC70554.1| hypothetical protein OsI_01709 [Oryza sativa Indica Group]
Length=669

 Score =   201 bits (512),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 183/287 (64%), Gaps = 7/287 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y++T +P + Y+V++YL+ +ESPRWL +RG  Q+ +E ++ +A          T
Sbjct  367  ASWRNMYVWTSLPSLCYAVLLYLLVQESPRWLLVRGRKQEAIEAVRQIASLNGGGGGITT  426

Query  185  tiFSDNQDQGLIDL-DEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            + FS   D   ++L D    +++ L  +  + WALRRL  +   + G+G+VYYG+PL VG
Sbjct  427  SSFS-MLDACAVELGDGGEGMFATLHSIWERRWALRRLAAITAASFGVGMVYYGMPLNVG  485

Query  362  EM-PFNLYLSTTLNAVSELPASLVTLLLIDK-LRRRSTvvglgvlsgvcnlgcvvFVGEE  535
             + P NLYLS   NAV+ELP+S++  LL+ +   RR +VV L   SG+C+L   V     
Sbjct  486  SLSPSNLYLSVAYNAVAELPSSILAWLLMGRWFNRRGSVVALTTASGLCSLAACVPAVVL  545

Query  536  LKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVAL  715
                ++  E+ +FF +CTA++++L+YT+ELFPT VRNSAV + RQA+ +GG ++P+LVA+
Sbjct  546  PDGARLAAEVASFFASCTAYDMMLMYTIELFPTSVRNSAVGLVRQAVALGGVVAPVLVAV  605

Query  716  GRGNRFY---SYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            GR    Y   S+G+FGLA     L +  LPET G  L DT++EEE+ 
Sbjct  606  GRETTSYWSSSFGLFGLAVGCLGLLVTCLPETRGRRLSDTMEEEEAA  652



>ref|XP_004295551.1| PREDICTED: organic cation/carnitine transporter 3-like [Fragaria 
vesca subsp. vesca]
Length=392

 Score =   195 bits (496),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/274 (39%), Positives = 177/274 (65%), Gaps = 5/274 (2%)
 Frame = +2

Query  32   TGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQ  211
            TG+P   +    ++   ESPRWL++ G  ++ +  +K  A  +   S   + + ++    
Sbjct  120  TGLPASSF----FMGGVESPRWLFMNGRGEEAITVLKKSAASKPIISELNSLLCAEGLRS  175

Query  212  GLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLST  391
               +  +  D Y ++K L  K WA++R L VM +  GIG+VYYG+PLGVG + FN+YLS 
Sbjct  176  KAAESTKSSDPYKSMKELFAKKWAMKRTLVVMVLGFGIGMVYYGMPLGVGNLGFNIYLSV  235

Query  392  TLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIGLEIVA  571
              NA+ E+P+  +TL++++K  R+ +V+   ++SG+C + C V VG++ K ++I LE+ +
Sbjct  236  MFNALLEIPSYPLTLIILEKWSRKFSVLWFCLVSGICGVVCAV-VGDKQKVIRIVLELAS  294

Query  572  FFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVF  751
            FF + TA+N++ ++T+ELFPTCVRNSA ++ RQ+ ++    S +LV++G  + F SYGVF
Sbjct  295  FFCSRTAWNLISMFTVELFPTCVRNSATSLLRQSYILSAVFSSMLVSVGSSSGFLSYGVF  354

Query  752  GLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            G+A  +   F+  LP+T GG LCDT+DE+E KEN
Sbjct  355  GVAIFVSGFFVAFLPDTRGGTLCDTMDEQERKEN  388



>emb|CDX88537.1| BnaC06g39810D [Brassica napus]
Length=475

 Score =   197 bits (501),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/287 (37%), Positives = 169/287 (59%), Gaps = 7/287 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T +P  ++S+ +   A ESPRWLYL+G  Q+ +E +K ++P       + +
Sbjct  192  ASWRVLYLCTSVPAAVHSICLLFFALESPRWLYLQGRNQEAIEVLKIISPETRAYLESVS  251

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q        EQ   Y+   L I + WA +R++ VM +  G+G+ YYG+PL V +
Sbjct  252  SRLPRQQHL------EQAPRYTIKDLFI-RTWAFKRIIVVMIIMFGLGMSYYGVPLAVRD  304

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA+ ELP+ ++T +L++   RRS+V+   ++ G   + C          
Sbjct  305  IKLNIYLSEALNAMVELPSFVITPILLESFTRRSSVLVNALVGGASGVLCCFLSLFGRTK  364

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+V+F  A   FN++ +Y +ELFPTCVRN A+ M RQA+VVGGA  P++ ++GR 
Sbjct  365  IAFALELVSFLCARIGFNLMAVYIVELFPTCVRNCAMTMLRQALVVGGACCPIIASIGRH  424

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV  865
                S+ VFG A     LF++ LPET G  LCDT++ +E ++   ++
Sbjct  425  VPSLSFAVFGFAMSGFGLFVLLLPETKGSSLCDTMEAQELRDKALKI  471



>ref|XP_006389892.1| hypothetical protein EUTSA_v10018417mg [Eutrema salsugineum]
 gb|ESQ27178.1| hypothetical protein EUTSA_v10018417mg [Eutrema salsugineum]
Length=511

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 170/284 (60%), Gaps = 7/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T +P  I+S+ +Y  A ESPRWL+++G  ++ +E +K ++        + +
Sbjct  230  ASWRVLYLCTSVPAAIHSIFLYFFALESPRWLHVQGKNEEAIEVLKRISTANRGYLESVS  289

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     +      + EQ    S   L I K WA RR++ VM + LG+G++YYG+PL V +
Sbjct  290  SRLPPKE------ILEQAPSSSIKDLFIRK-WAFRRIVVVMTIMLGLGMMYYGVPLAVRD  342

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA+ ELP  ++T +L++K  RRS+V+   ++ G   + C V        
Sbjct  343  IKVNIYLSEALNAMVELPTFVITPILLEKFNRRSSVLVNCLIGGALGVLCFVLTLFGRTN  402

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+ +FF A   FN++ +Y +E+FPTCVRN A  M RQA+VVGGA  P++V++GR 
Sbjct  403  IAFALELGSFFCARIGFNLMAVYMIEMFPTCVRNFATTMLRQALVVGGACCPIIVSIGRN  462

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                S+ VFG A     LF + LPET G  LCDT++E+E  ++ 
Sbjct  463  VPSLSFAVFGFAVSGLGLFALLLPETKGSSLCDTMEEQEQSDHA  506



>ref|XP_010472795.1| PREDICTED: organic cation/carnitine transporter 5 [Camelina sativa]
Length=515

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 169/283 (60%), Gaps = 7/283 (2%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SW+ LYL T +P  I+S+++Y  A ESPRWL+L G   + +E +K ++P +     +   
Sbjct  233  SWKVLYLCTSVPAGIHSIVIYFFALESPRWLHLEGKNDEAIEVLKRISPAKRGYLESA--  290

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
             FS    +  ++L       S++K L  + WA RR++ VM +  G+G+ YYG+PL V ++
Sbjct  291  -FSRLPPKETLELTSS----SSIKDLFIRKWAFRRIVLVMIIMFGLGMSYYGVPLAVRDI  345

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV  547
              N+YLS  LNA+ ELP  ++T +L++K  RRS+++   ++ G   + C V        +
Sbjct  346  KVNIYLSEALNAMVELPTFVITPILLEKFSRRSSMLVNCLIGGASGVLCFVMSLLGRTKI  405

Query  548  QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGN  727
               LE+ +FF A   FN++ +Y +ELFPTCVRNSA  M RQA+VVGGA  P++ ++GR  
Sbjct  406  AFALELGSFFCARIGFNLMAVYMVELFPTCVRNSATTMLRQALVVGGACCPIIASVGRNL  465

Query  728  RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
               S+ VFG       LF++ LPET G  LCDT++ +E ++  
Sbjct  466  PSLSFAVFGFTMSGVGLFVLLLPETKGSSLCDTMEAQEQRDQA  508



>emb|CDY61617.1| BnaC02g46700D [Brassica napus]
Length=511

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 167/284 (59%), Gaps = 10/284 (4%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T +P  I+SV +Y  A ESPRWL+++G  Q+ +E +K ++P       + +
Sbjct  231  ASWRVLYLCTSVPAAIHSVCIYFFALESPRWLHVQGKNQEAIEVLKRLSPVNRDYLESVS  290

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     +              S++K +  + WA RR++ VM +  G+G++YYG+PL V +
Sbjct  291  SRLHSKEQSP----------SSSIKDMFIRKWAFRRIVVVMIIMFGLGMMYYGVPLAVRD  340

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA+ ELP  ++T +L++K  RRS+V+   +L G   + C V    E   
Sbjct  341  IKVNIYLSEALNAMVELPTFVITPILLEKFNRRSSVLVNCLLGGALGVLCFVMTTFERTN  400

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+ +FF A   FN++ +Y +E+FPTCVRN A  M RQ++V+GGA  P++ ++GR 
Sbjct  401  IAFALELGSFFCARIGFNLMAVYMIEMFPTCVRNFATTMLRQSLVLGGASCPIIASVGRN  460

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                S+ VFGL      LF + LPET G  LCDT++ +E  +  
Sbjct  461  VPSISFAVFGLVVSGLGLFALLLPETKGSSLCDTMEAQEQSDQA  504



>ref|XP_006422297.1| hypothetical protein CICLE_v10006697mg [Citrus clementina]
 gb|ESR35537.1| hypothetical protein CICLE_v10006697mg [Citrus clementina]
Length=1023

 Score =   202 bits (515),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/288 (40%), Positives = 172/288 (60%), Gaps = 46/288 (16%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSW+ LY++T IP I+  +I+Y    ESPRWL++ G   + +  +K +A          
Sbjct  233  GSSWKMLYVWTSIPSIVCCIIIYPFISESPRWLFIHGHEAEAMAVLKRLA----------  282

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                                                RLLT+M +A GIG+VY+G+ LGVG
Sbjct  283  -----------------------------------SRLLTIMALAFGIGVVYFGLLLGVG  307

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FN+YLS   N + ++PA L+T +LI++  R+S+++   +LSG C+  CV  +G+E +
Sbjct  308  NLSFNIYLSLAFNGLLDIPAYLLTFILIERWSRKSSILTFCILSGTCSAICVA-IGDEQE  366

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             +QIGLE+ +FF+AC AFN+LL++  ELFPTCVRNS  ++ RQA+ +G A SP+L++ GR
Sbjct  367  VLQIGLELASFFSACVAFNVLLVFGTELFPTCVRNSTTSLVRQAVNLGAAFSPVLISAGR  426

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV  865
             N F S+GVFGL       F+V LPET+G  LCDT+D++E  + G  +
Sbjct  427  QNEFLSFGVFGLVVFCFGFFVVFLPETIGVTLCDTLDQQEYFKTGGEL  474


 Score =   186 bits (471),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/319 (34%), Positives = 175/319 (55%), Gaps = 35/319 (11%)
 Frame = +2

Query  2     GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
              SSW  +YL+T IP ++YS ++Y+   ESPRWL+++G  ++ VE IK+++P +  + ++ 
Sbjct  702   SSSWTIIYLWTSIPTLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSPIKDSNQLSL  761

Query  182   ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             + + + +         ++    S+++ L  + WAL R L +M +  GIG+VYYG+ LG+ 
Sbjct  762   SLVSAVSFGHEPAASSKESSFLSSIRELFVRRWALERTLALMVLGFGIGVVYYGMTLGIE  821

Query  362   EMPFNLYLSTTLNAV---------------------------------SELPASLVTLLL  442
              + F++YL    NA+                                 S +P+  +T  L
Sbjct  822   NLGFDIYLGVVFNALLEIPVWGIYFDKTSHDEQVSDSRIPRTENQNLASTIPSFFLTFFL  881

Query  443   IDKLRRRSTvvglgvls--gvcnlgcvvFVGEELKAVQIGLEIVAFFTACTAFNILLIYT  616
             I K  R+S+++ L ++S            +    K ++IGLE+ + F+A  A+ ++ IY 
Sbjct  882   IQKWNRKSSLLVLFIISGICSIMAVVANDISNAGKRMRIGLELASLFSAYIAYTVIFIYA  941

Query  617   LELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLP  796
             +ELFPTCVRNSA ++ R A++     S +LVA G  N F SYGVFGL  + C  F++ LP
Sbjct  942   IELFPTCVRNSATSIMRLAIIFAAIFSSVLVAAGSNNEFVSYGVFGLVIICCGFFVICLP  1001

Query  797   ETLGGDLCDTIDEEESKEN  853
             ET G  LCDTID+ E K++
Sbjct  1002  ETRGSSLCDTIDQREHKDS  1020



>ref|XP_002890161.1| hypothetical protein ARALYDRAFT_471833 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66420.1| hypothetical protein ARALYDRAFT_471833 [Arabidopsis lyrata subsp. 
lyrata]
Length=506

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 168/285 (59%), Gaps = 19/285 (7%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWRYLYL+T +P I Y + +YL A ESPRWL+++G  ++ ++ +  M+P       +  
Sbjct  233  SSWRYLYLYTSVPAIFYCIFLYLFALESPRWLHMQGNDKEAIDVLTKMSPKNKAYLESVV  292

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+       EQ+  YS +K    + WA +R+L VM +  G+G+ YYG+PL   +
Sbjct  293  SKLPHEQENF-----EQVPTYS-IKDFFFRKWAFQRILVVMIIMFGLGISYYGVPLAARD  346

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS TLNA+ ELP  ++T +L+++  RRS+V+                +G     
Sbjct  347  IDVNIYLSETLNALVELPTFVITPILLERFNRRSSVLVNT------------LLGGASGV  394

Query  545  VQIGLEIVA-FFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            +   L I+  FF A   FN++ ++ +E+FPTCVR+SA  M RQA+VVGGA  PL+ ++GR
Sbjct  395  LCFVLSILGTFFCARIGFNLMAVFMVEMFPTCVRSSATMMFRQALVVGGACCPLISSIGR  454

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                 S+ +FG+A     LF++ LPET G  LCD+++E+E ++  
Sbjct  455  YIPSVSFAIFGIAMSGLGLFVLILPETKGLSLCDSMEEQEKRDQA  499



>ref|XP_009106662.1| PREDICTED: organic cation/carnitine transporter 5-like [Brassica 
rapa]
Length=515

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/283 (37%), Positives = 166/283 (59%), Gaps = 7/283 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T +P  I+SV++YL A ESPRWL+++G  ++ +E +K ++P       + +
Sbjct  230  ASWRVLYLCTSVPAAIHSVLIYLFALESPRWLHVQGRNEEAIEVLKRISPASRAYLESVS  289

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                   D        +    S++K L  + WA RR+L VM +  G+G++YYG+PL V +
Sbjct  290  ARLPSKDDV-------ESTPSSSIKDLFIRKWAFRRILVVMTIMFGLGMMYYGVPLAVRD  342

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA  ELP  ++  +L++K  RRS+V+   ++ G   + C V     L  
Sbjct  343  IDVNIYLSEALNAAVELPTFVIAPILLEKFNRRSSVLANCLVGGALAVFCFVLTLLGLTN  402

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+ +FF A   FN++ +Y +E+FPTCVRN A  M R ++V+GGA+ P++ ++GR 
Sbjct  403  IAFVFELGSFFCARIGFNLMAVYMIEMFPTCVRNFATTMLRLSLVLGGAVCPIIASVGRN  462

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
               +S+ VFG        F + LPET G  LCDT++ +E +E 
Sbjct  463  VPSFSFAVFGFTVSGLGFFALLLPETKGSSLCDTLEAQEQREQ  505



>ref|XP_006301621.1| hypothetical protein CARUB_v10022062mg [Capsella rubella]
 gb|EOA34519.1| hypothetical protein CARUB_v10022062mg [Capsella rubella]
Length=510

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 168/284 (59%), Gaps = 7/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SW+ LYL T +P  I+S+ +Y  A ESPRWLYL G  ++ +E +K ++P       + +
Sbjct  231  ASWKVLYLCTSVPAGIHSMFIYFFALESPRWLYLEGRNEEAIEVLKRISPANRGYLESAS  290

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     +        EQ    S++K L  + WA +R++ VM +  G+G+ YYG+PL V +
Sbjct  291  SRLPPKKTL------EQTS-SSSIKDLFVRKWAFQRVVLVMIIMFGLGMSYYGVPLAVRD  343

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA+ ELP  +VT +L++K  RRS+V+   ++ G   + C V        
Sbjct  344  IKVNIYLSEALNAMVELPTFIVTPILLEKFNRRSSVLVSCLVGGASGVLCFVLSLSGRTK  403

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+ +FF A   FN++ +Y +ELFPT VRNSA  M RQA+V GGA  PL+ ++GR 
Sbjct  404  IAFALELSSFFCARIGFNLMAVYLVELFPTSVRNSATMMLRQALVFGGACCPLIASIGRH  463

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                S+ VFG+A     LF + LPET G  LCDT++E+E ++  
Sbjct  464  VPSLSFAVFGIAMSGLGLFALLLPETKGSSLCDTMEEQEQRDQA  507



>ref|XP_010429822.1| PREDICTED: organic cation/carnitine transporter 5-like [Camelina 
sativa]
Length=516

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/284 (39%), Positives = 166/284 (58%), Gaps = 7/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SW+ LYL T +P  I+ + +YL A ESPRWL+L G  ++ +E +K ++P +     T  
Sbjct  233  ASWKVLYLCTSVPAGIHCIFIYLFALESPRWLHLEGKNEEAIEVLKKISPAKRGYLETAF  292

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     +        EQ    S   L I K WA RR++ VM +  G+G+ YYG+PL V +
Sbjct  293  SRLPPKETL------EQTSSSSIKDLFIRK-WAFRRIVLVMIIMFGLGMSYYGVPLAVRD  345

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA+ ELP  ++T +L++K  RRS+V+   ++ G   + C V        
Sbjct  346  IKVNIYLSEALNAMVELPTFVITPILLEKFSRRSSVLVNCLIGGASGVFCFVMSLLGRTK  405

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+ +FF A   FN++ +Y +ELFPTCVRNSA  M RQA+VVGGA  P++ ++GR 
Sbjct  406  IAFALELGSFFCARIGFNLMAVYMVELFPTCVRNSATTMLRQALVVGGACCPIIASVGRN  465

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                S+ VFG       LF++ LPET G  LCDT++ +E ++  
Sbjct  466  LPSLSFAVFGFTMSGVGLFVLLLPETKGSSLCDTMEAQEQRDQA  509



>emb|CDY56801.1| BnaA02g36150D [Brassica napus]
Length=512

 Score =   195 bits (496),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 107/292 (37%), Positives = 174/292 (60%), Gaps = 10/292 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T +P  I+SV +Y  A ESPRWL+++G  Q+ +E ++ ++P          
Sbjct  231  ASWRVLYLCTSVPAAIHSVCIYFFALESPRWLHVQGKNQEAIEVLQRLSP--------VN  282

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
              + ++    L   ++  +  S++K +  + WA RR++ VM +  G+G++YYG+PL V +
Sbjct  283  RDYLESVSSRLHSKEQSPN--SSIKDMFIRRWAFRRIVVVMIIMFGLGMMYYGVPLAVRD  340

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA+ ELP  ++T +L++K  RRS+V+   +L G   + C V    E   
Sbjct  341  IKVNIYLSEALNAMVELPTFVITPILLEKFNRRSSVLVNCLLGGALGVLCFVMTTFERTN  400

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+ +FF A   FN++ +Y +ELFPTCVRN A  M RQ++V+GGA  P++ ++G+ 
Sbjct  401  IAFALELGSFFCARIGFNLMAVYMIELFPTCVRNFATTMLRQSLVLGGASCPIIASVGKN  460

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV*TLNC  880
                S+ VFGL      LF + LPET G  LCDT++ +E  +   +  + +C
Sbjct  461  VPSISFAVFGLVVSGLGLFALLLPETKGSSLCDTMEAQEQSDQALKNTSPSC  512



>ref|XP_006303214.1| hypothetical protein CARUB_v10011578mg [Capsella rubella]
 gb|EOA36112.1| hypothetical protein CARUB_v10011578mg [Capsella rubella]
Length=521

 Score =   196 bits (497),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 104/283 (37%), Positives = 172/283 (61%), Gaps = 6/283 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR+LY++T IP I Y + +YL+A ESPRWL+++G  ++ ++ +  ++P       +  
Sbjct  237  SSWRFLYIYTSIPAIFYCIFLYLLALESPRWLHMQGKDKEAIDVLTKLSPKRRAYLESVI  296

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+       +Q+  YS +K L  + WA RR++ VM +  G+G+ YYG+PL   +
Sbjct  297  SKLPLEQETY-----DQVPTYS-IKDLFFRKWAFRRIVVVMIIMFGLGISYYGVPLAARD  350

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS TLNA+ ELP  ++T +L+++  RRS+V+   +L G   + C +        
Sbjct  351  IDVNIYLSETLNALVELPTFIITPILLERFNRRSSVLVNTLLGGGSGVLCFLLSITGQTK  410

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+  FF A   FN++ ++ +E+FPT VR+SA  M RQA+V+GGA  PL+ ++GR 
Sbjct  411  IAFAFELGTFFCARIGFNLMAVFMVEMFPTRVRSSATMMFRQALVIGGACCPLIASIGRD  470

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
                S+ +FG+A     LF++ LPET G  LCDT++E+E ++ 
Sbjct  471  IPSVSFAIFGIAMSCLGLFVLILPETKGLSLCDTMEEQEKRDQ  513



>gb|KDO61527.1| hypothetical protein CISIN_1g041759mg, partial [Citrus sinensis]
Length=525

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 107/293 (37%), Positives = 174/293 (59%), Gaps = 9/293 (3%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSW  +YL+T IP ++YS ++Y+   ESPRWL+++G  ++ VE IK+++P +  + ++ 
Sbjct  230  SSSWTIIYLWTSIPTLVYSGLLYIFVSESPRWLFMQGRQEEAVEVIKSLSPIKDSNQLSL  289

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            + + + +         ++    S+++ L  + WAL R L +M    GIG+VYYG+ LG+ 
Sbjct  290  SLVSAVSFGHEPAASSKESSFLSSIRELFVRRWALERTLALMVPGFGIGVVYYGMTLGIE  349

Query  362  EMPFNLYLSTTLNAV-------SELPASLVTLLLIDKLRRRSTvvglgvls--gvcnlgc  514
             + F++YL    NA+       S +P+  +T  LI K  R+S+++ L ++S         
Sbjct  350  NLGFDIYLGVVFNALLEIPNLASTIPSFFLTFFLIQKWNRKSSLLVLFIISGICSIMAVV  409

Query  515  vvFVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAI  694
               +    K ++IGLE+ + F+A  A+ ++ IY +ELFPTCVRNSA ++ R A++     
Sbjct  410  ANDISNAGKRMRIGLELASLFSAYIAYTVIFIYAIELFPTCVRNSATSIMRLAIIFAAIF  469

Query  695  SPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            S +LVA G  N F SYGVFGL  + C  F++ LPET G  LCDTID+ E K++
Sbjct  470  SSVLVAAGSNNEFVSYGVFGLVIICCGFFVICLPETRGSSLCDTIDQREHKDS  522



>emb|CDX87383.1| BnaA07g34900D [Brassica napus]
Length=515

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/283 (37%), Positives = 165/283 (58%), Gaps = 7/283 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T +P  I+SV++YL A ESPRWL+++G  ++  E +K ++P       + +
Sbjct  230  ASWRVLYLCTSVPAAIHSVLIYLFALESPRWLHVQGRNEEATEVLKRISPASRAYLESVS  289

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                   D        +    S++K L  + WA RR+L VM +  G+G++YYG+PL V +
Sbjct  290  ARLPSKDDV-------ESTPSSSIKDLFIRKWAFRRILVVMTIMFGLGMMYYGVPLAVRD  342

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA  ELP  ++  +L++K  RRS+V+   ++ G   + C V     L  
Sbjct  343  IDVNIYLSEALNAAVELPTFVIAPILLEKFNRRSSVLANCLVGGALAVFCFVLTLLGLTN  402

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+ +FF A   FN++ +Y +E+FPTCVRN A  M R ++V+GGA+ P++ ++GR 
Sbjct  403  IAFVFELGSFFCARIGFNLMAVYMIEMFPTCVRNFATTMLRLSLVLGGAVCPIIASVGRN  462

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
               +S+ VFG        F + LPET G  LCDT++ +E +E 
Sbjct  463  VPSFSFAVFGFTVSGLGFFALLLPETKGSSLCDTLEAQEQREQ  505



>ref|XP_009795682.1| PREDICTED: organic cation/carnitine transporter 3-like [Nicotiana 
sylvestris]
Length=510

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/284 (40%), Positives = 172/284 (61%), Gaps = 13/284 (5%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LYL+T +P IIY +++     ESP+WL  +G  ++    + T   P  ++      
Sbjct  231  SWRVLYLWTSLPTIIYCMLLQFCVYESPKWLLSKGKNREAFAVLTTFVAPHFKN------  284

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
              S N  +  ID      L   +K+L+ K W L +LL  +    GIGL+YYG+PLG+G  
Sbjct  285  -LSLNDHKVKIDNGFNQPL---IKILLKKRWILGQLLLALTTGFGIGLMYYGMPLGLGNF  340

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV  547
              NLYLST LNA+ ELPA L+   L++K +RRST   +G+       G +  + ++ K +
Sbjct  341  SLNLYLSTGLNAMLELPAFLIVFFLVEKCKRRST--LVGLSILSGVCGMLCMIVDKWKVL  398

Query  548  QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLV-ALGRG  724
            Q+ LE+++FF+ACTAF++ LIYT ELFPT +RN+ V++  QA+V+GG +SP+LV A G  
Sbjct  399  QLVLELISFFSACTAFDLFLIYTSELFPTSIRNATVSIVWQAVVLGGVVSPVLVDAGGDR  458

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            ++   Y V G+ + +    ++ LPET G DLC  ++E+E + NG
Sbjct  459  SKILPYLVLGIMTSIAGSLVIFLPETKGLDLCKNMEEKEQEGNG  502



>ref|XP_010497803.1| PREDICTED: organic cation/carnitine transporter 6-like [Camelina 
sativa]
Length=523

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/287 (37%), Positives = 168/287 (59%), Gaps = 12/287 (4%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWRYLYL+T +P I Y + +YL A ESPRWL+++G  ++ +  +  M+P       +  
Sbjct  237  SSWRYLYLYTSVPAIFYCIFLYLFALESPRWLHMQGKDKEAINVLTKMSPKNRAYLESVI  296

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+        Q+  YS +K    + WA +R+  VM +  G+G+ YYG+PL   +
Sbjct  297  SKLPLEQEN-----HAQVPTYS-IKDFFFRRWAFQRISVVMIIMFGLGISYYGVPLAARD  350

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvl--sgvcnlgcvvFVGEEL  538
            +  N+YLS TLNA+ ELP  ++T +L+++  RRS+V+   +L  +       +  +G+  
Sbjct  351  IDVNIYLSETLNALVELPTFVITPILLERFNRRSSVLINTLLGGASGVLCFLLSIIGQ--  408

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
              +    E+  FF A   FN+++++ +E+FPTCVR+SA  M RQA+VVGGA  PL+ ++G
Sbjct  409  TEIAFAFELATFFCARIGFNLMVVFMVEMFPTCVRSSATMMFRQALVVGGACCPLIASIG  468

Query  719  RGNRF--YSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            R       S+ VFG       LF++ LPET G  LCDT++E+E ++ 
Sbjct  469  RDIHIPSVSFAVFGTEMSGLGLFVLILPETKGLSLCDTMEEQEKRDQ  515



>ref|XP_006403333.1| hypothetical protein EUTSA_v10003188mg [Eutrema salsugineum]
 gb|ESQ44786.1| hypothetical protein EUTSA_v10003188mg [Eutrema salsugineum]
Length=519

 Score =   194 bits (492),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 171/284 (60%), Gaps = 7/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LYL+T IP I Y + +YL A ESPRWL+++G   + ++ +K ++        +  
Sbjct  237  SSWRLLYLYTSIPAIFYCIFLYLFALESPRWLHMQGNNYEAIDVLKKISSRNIPYLESVM  296

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +          I+  EQ+   S   L I K WA +R+L  M +  G+G+ YYG+PL V +
Sbjct  297  SKLPLE-----IETFEQVPSNSIKDLFIRK-WAFQRILAAMSILFGLGMSYYGVPLAVRD  350

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS TLNA+ ELP  ++T +L+++  RRS+V+   +L G   + C V        
Sbjct  351  IGVNIYLSETLNALVELPTFVITPILLERFNRRSSVLWNALLGGASGVFCFVLSVFGKAE  410

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+  FF +   FN++++Y +E+FPTCVRNSA  M RQA++VGGA SPL+ ++GR 
Sbjct  411  IAFAFELGTFFCSRIGFNLMVVYMVEMFPTCVRNSATMMFRQALIVGGACSPLIASIGRD  470

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                S+ +FG+A  L  LF++ LPET G  LCD+++E+E +E  
Sbjct  471  VPSVSFAIFGMAMSL-GLFVLILPETKGLSLCDSMEEQEMREQA  513



>ref|XP_011012857.1| PREDICTED: organic cation/carnitine transporter 3-like, partial 
[Populus euphratica]
Length=279

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 147/219 (67%), Gaps = 3/219 (1%)
 Frame = +2

Query  197  DNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFN  376
            D Q++       + +LYS +K+L+ + WAL+RLL VM    GIG+VYY +PL VG + FN
Sbjct  61   DEQEEKEQLEAPKTNLYSPIKILLVRKWALQRLLIVMLTGFGIGIVYYSMPLAVGNLGFN  120

Query  377  LYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIG  556
            +YLS   NA++E+P+ ++   ++ K  R+ +++    L G+C++ C++   E    V IG
Sbjct  121  IYLSVAFNALAEIPSYIIFSFIVSKWSRKGSLLAFTTLGGICSIMCIMNWKE---VVLIG  177

Query  557  LEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFY  736
            LE+V++F+ACTAF +L+IYTLELFPTCVRN A +M RQA V G   SP+L++ GR N+  
Sbjct  178  LELVSYFSACTAFIMLMIYTLELFPTCVRNGASSMVRQAPVFGAVFSPILISAGRSNKVL  237

Query  737  SYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            SYGVFGL  +   +F+  LPET G  L DT+DE+E KE 
Sbjct  238  SYGVFGLVILCSSVFVFCLPETRGVALSDTMDEQEEKEQ  276



>ref|XP_010539566.1| PREDICTED: organic cation/carnitine transporter 5-like [Tarenaya 
hassleriana]
 ref|XP_010539567.1| PREDICTED: organic cation/carnitine transporter 5-like [Tarenaya 
hassleriana]
 ref|XP_010539568.1| PREDICTED: organic cation/carnitine transporter 5-like [Tarenaya 
hassleriana]
Length=522

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 172/284 (61%), Gaps = 10/284 (4%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LYL T IP  IYS+++YL A ESPRWL + G  ++    ++ ++     + ++   
Sbjct  238  SWRVLYLCTSIPAAIYSILLYLFAFESPRWLSMVGRNEEAKNVLEKISKTNKATLVSLFA  297

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
            +    Q+       ++   YS   L I K WALRR+ TVM +A GIG+ YYG+PL V  +
Sbjct  298  LLPLTQES-----KDRGRKYSIKDLFIRK-WALRRISTVMVIAFGIGMSYYGVPLAVRGV  351

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV  547
              N+Y+   LNA+ ELP+ ++T  L++K  RRS+++   ++ G+  + C  FV   L   
Sbjct  352  NVNIYVGEALNALVELPSFVLTPFLLEKFNRRSSLLTCNLIGGITGISC--FVLSVLGKG  409

Query  548  QIG--LEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            ++G  LE+  FF +   FN++++Y +E+FPTCVRNSA  MARQA+VVGG  SP++ ++G 
Sbjct  410  KLGFVLELACFFCSRMGFNLMMVYVVEMFPTCVRNSATTMARQALVVGGICSPMISSIGL  469

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
                  + VFG +  +  LF + LPET G  LCDT++E+E K+ 
Sbjct  470  NVPLLPFAVFGASLFVFGLFGLLLPETKGSSLCDTMEEQEEKDR  513



>ref|XP_009766980.1| PREDICTED: organic cation/carnitine transporter 3-like [Nicotiana 
sylvestris]
Length=284

 Score =   184 bits (468),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 154/197 (78%), Gaps = 3/197 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GS+WR LYL+T +P I+YS +VY +  ESPRWLY+RG  + FV+T+K++APP TRSS+T 
Sbjct  83   GSTWRILYLWTCLPTILYSFLVYFIVPESPRWLYIRGNKEGFVQTLKSIAPPTTRSSLTL  142

Query  182  tt--iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLG  355
            +    F + ++Q ++D +  +DLYSA+++L+ + W+ RRL+TV+ V  GIG+ YYG+PLG
Sbjct  143  SFFGSFIEFENQEVLD-NNTVDLYSAIRMLVERNWSFRRLVTVICVGFGIGMTYYGMPLG  201

Query  356  VGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEE  535
            VG + FNLYLS TLNA+SELP+S++ L LI KL R+ +++G  +LSG+C++GCV+F  E+
Sbjct  202  VGSLNFNLYLSITLNALSELPSSILILFLIGKLSRKGSLLGFAMLSGICSIGCVIFEREK  261

Query  536  LKAVQIGLEIVAFFTAC  586
             K VQIG+E++++F+AC
Sbjct  262  FKEVQIGVELISYFSAC  278



>ref|XP_010688763.1| PREDICTED: organic cation/carnitine transporter 2-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=430

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 115/288 (40%), Positives = 189/288 (66%), Gaps = 6/288 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSWR LYL T IPG+I S++ +    ESPRWL++RG T D V  +K++   +   S + 
Sbjct  144  NSSWRILYLCTSIPGVICSILTHFFLCESPRWLFMRGRTTDAVNVLKSIGSLDDHLSSSL  203

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            + +      QG+ + +   + +S++K+L+ K WA++RL+  M ++ G+G++Y+G+ LGVG
Sbjct  204  SNMLVF--KQGIPNTNGN-NPFSSVKILVKKRWAIQRLIVAMVLSFGVGMMYFGMLLGVG  260

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLL-IDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
             +  N+YLS+  NA+  L +SL+T L  I +  RRS+V+G   +SGV ++  +V  G   
Sbjct  261  GLGLNIYLSSIFNALLLLSSSLLTFLFWIPRCNRRSSVLGFCTISGVASIISIV-AGHHH  319

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
            K V +GLE++A F AC  FNIL +Y +ELFPTC+RN+A +++RQA++      P+LV +G
Sbjct  320  KIVHVGLELMALFCACMVFNILFMYVVELFPTCIRNTAASLSRQALLFASIFVPVLVVIG  379

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNR  862
            R  + +S+ +FG+  + C L ++ LPET G  LCD+++E+E+++  NR
Sbjct  380  RRIQLFSHLIFGVTILSCGLLVIFLPETRGRVLCDSMEEQEAQDK-NR  426



>emb|CDX88538.1| BnaC06g39820D [Brassica napus]
Length=514

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 164/283 (58%), Gaps = 7/283 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T +P  I+SV++YL A ESPRWL+++G  ++ +E +K ++P         +
Sbjct  230  ASWRVLYLCTSVPAAIHSVLIYLFALESPRWLHVQGKNEEAIEVLKRISPASRGYLEAVS  289

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +      D        +    S++K L  + WA RR+L VM +  G+G++YYG+PL V +
Sbjct  290  SRLPSKDDV-------ENTPSSSIKDLFIRKWAFRRILVVMTIMFGLGMMYYGVPLAVRD  342

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA  ELP  ++  +L++K  RR++V+   ++ G   + C V     L  
Sbjct  343  IDVNIYLSEALNAAVELPTFVIAPILLEKFNRRTSVLANCLVGGALAVFCFVLALLGLTN  402

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+ +FF A   FN++ +Y +E++PTCVRN A  M R ++V+GGA  P++ ++GR 
Sbjct  403  IAFVFELGSFFCARIGFNLMAVYMIEMYPTCVRNFATTMLRLSLVLGGAACPIIASVGRN  462

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
                S+ VFG        F + LPET G  LCDT++ +E +E 
Sbjct  463  VPSLSFAVFGFTMSGLGFFALFLPETKGASLCDTMEAQEQRER  505



>ref|XP_010688758.1| PREDICTED: organic cation/carnitine transporter 2-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688760.1| PREDICTED: organic cation/carnitine transporter 2-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688761.1| PREDICTED: organic cation/carnitine transporter 2-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688762.1| PREDICTED: organic cation/carnitine transporter 2-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=512

 Score =   187 bits (476),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 115/288 (40%), Positives = 189/288 (66%), Gaps = 6/288 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSWR LYL T IPG+I S++ +    ESPRWL++RG T D V  +K++   +   S + 
Sbjct  226  NSSWRILYLCTSIPGVICSILTHFFLCESPRWLFMRGRTTDAVNVLKSIGSLDDHLSSSL  285

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            + +      QG+ + +   + +S++K+L+ K WA++RL+  M ++ G+G++Y+G+ LGVG
Sbjct  286  SNMLVF--KQGIPNTNGN-NPFSSVKILVKKRWAIQRLIVAMVLSFGVGMMYFGMLLGVG  342

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLL-IDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
             +  N+YLS+  NA+  L +SL+T L  I +  RRS+V+G   +SGV ++  +V  G   
Sbjct  343  GLGLNIYLSSIFNALLLLSSSLLTFLFWIPRCNRRSSVLGFCTISGVASIISIV-AGHHH  401

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
            K V +GLE++A F AC  FNIL +Y +ELFPTC+RN+A +++RQA++      P+LV +G
Sbjct  402  KIVHVGLELMALFCACMVFNILFMYVVELFPTCIRNTAASLSRQALLFASIFVPVLVVIG  461

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNR  862
            R  + +S+ +FG+  + C L ++ LPET G  LCD+++E+E+++  NR
Sbjct  462  RRIQLFSHLIFGVTILSCGLLVIFLPETRGRVLCDSMEEQEAQDK-NR  508



>ref|XP_009104532.1| PREDICTED: LOW QUALITY PROTEIN: organic cation/carnitine transporter 
5-like [Brassica rapa]
Length=516

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/292 (36%), Positives = 170/292 (58%), Gaps = 7/292 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR++YL T IP  I+SV +Y  A ESPRWL+++G  ++ +E +K ++P +       +
Sbjct  232  ASWRFIYLCTSIPAAIHSVFIYFFALESPRWLHVQGNNKEAIEVLKRISPGKRGYLEKVS  291

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     +        EQ    S + L I + WA RR++ +M +  G+G++YYG+PL V +
Sbjct  292  SRLPSKETL------EQSPSSSIMDLFIRR-WAFRRIIVIMIIMFGLGMMYYGVPLAVRD  344

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA+ ELP  ++T +L++K  RRS+V+   ++ G   + C V        
Sbjct  345  IKVNIYLSEALNAMVELPTFVITPILLEKFNRRSSVLVNCLVGGALGVFCFVLTTLGRTN  404

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+ +FF A   FN++ +Y +E+FPTCVRN A  M RQA+V+GGA  P++ ++GR 
Sbjct  405  IAFVFELCSFFCARIGFNLMAVYMIEMFPTCVRNFATTMLRQALVIGGACCPIIASVGRN  464

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV*TLNC  880
                S+ VFG        F + LPET G  LCDT+DE+E  +   +   ++C
Sbjct  465  VPSISFAVFGFVVSGLGFFALLLPETKGAGLCDTMDEQEQSDQAMKSSHVSC  516



>ref|XP_006416824.1| hypothetical protein EUTSA_v10007384mg [Eutrema salsugineum]
 gb|ESQ35177.1| hypothetical protein EUTSA_v10007384mg [Eutrema salsugineum]
Length=516

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 164/285 (58%), Gaps = 10/285 (4%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR+LYL+T +P  +Y + +YL   ESPRWL+++G   + +  +  ++P       +  
Sbjct  233  SSWRFLYLYTAVPAALYCIFLYLFTLESPRWLHMQGEDGEAIGVLGKISPKSIPYLESVI  292

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            T     ++       EQ   +S     I + WA RR+  VM +  G+G+ YYG+PL   +
Sbjct  293  TKLPLEKETF-----EQGPSHSIKDFFIRR-WASRRISVVMVIMFGLGISYYGVPLAARD  346

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvl--sgvcnlgcvvFVGEEL  538
            +  N+YLS TLNA+ ELP  ++T +L+ +  RRS+V+   +L  +          VG+  
Sbjct  347  IDVNIYLSETLNALVELPTFVITPVLMKRFNRRSSVLVNTLLGGASGVLCFVPSVVGK--  404

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
              V    E+  FF A   FN++ +Y +E+FPTCVR+SA  M RQA+VVGGA  PL+ +LG
Sbjct  405  TGVAFAFELGTFFCARIGFNLMAVYMVEMFPTCVRSSATMMFRQALVVGGACCPLIASLG  464

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            R     S+ +FG+A     LF++ LPET G  LCDT++E+E ++ 
Sbjct  465  RDLPSVSFAIFGIAMSGLGLFVLILPETKGLSLCDTMEEQEKRDQ  509



>dbj|BAD54717.1| putative solute carrier family 22 member 3 [Oryza sativa Japonica 
Group]
 dbj|BAD54724.1| putative solute carrier family 22 member 3 [Oryza sativa Japonica 
Group]
Length=583

 Score =   186 bits (473),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 120/287 (42%), Positives = 182/287 (63%), Gaps = 7/287 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y++T +P + Y+V++YL+ +ESPRWL +RG  Q+ +E ++ +A          T
Sbjct  281  ASWRNMYVWTSLPSLCYAVLLYLLVQESPRWLLVRGRKQEAIEAVRQIASLNGGGGGITT  340

Query  185  tiFSDNQDQGLIDL-DEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            + FS   D   ++L D    +++ L  +  +  ALRRL  +   + G+G+VYYG+PL VG
Sbjct  341  SSFS-MLDACAVELGDGGEGMFATLHSIWERRRALRRLAAITAASFGVGMVYYGMPLNVG  399

Query  362  EM-PFNLYLSTTLNAVSELPASLVTLLLIDK-LRRRSTvvglgvlsgvcnlgcvvFVGEE  535
             + P NLYLS   NAV+ELP+S++  LL+ +   RR +VV L   SG+C+L   V     
Sbjct  400  SLSPSNLYLSVAYNAVAELPSSILAWLLMGRWFNRRGSVVALTTASGLCSLAACVPAVVL  459

Query  536  LKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVAL  715
                ++  E+ +FF +CTA++++L+YT+ELFPT VRNSAV + RQA+ +GG ++P+LVAL
Sbjct  460  PDGARMAAEVASFFASCTAYDMMLMYTIELFPTSVRNSAVGLVRQAVALGGVVAPVLVAL  519

Query  716  GRGNRFY---SYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            GR    Y   S+GVFGLA     L +  LPET G  L DT++EEE+ 
Sbjct  520  GRETTSYWSSSFGVFGLAVGCLGLLVTCLPETRGRRLSDTMEEEEAA  566



>gb|KFK42345.1| hypothetical protein AALP_AA2G244200 [Arabis alpina]
Length=515

 Score =   185 bits (470),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 102/284 (36%), Positives = 166/284 (58%), Gaps = 7/284 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LYL T +P  ++S+ +Y  A ESPRWL+L G  ++ +E +  ++  +        
Sbjct  232  ASWRVLYLCTSVPAAVHSIFIYFFALESPRWLHLEGKNEEAIEVLTKISSADNAYLKEVF  291

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     +   L++        S++K L  + WA RR++ VM +  G+G+ YYG+PL V +
Sbjct  292  SRLPTKEK--LLEAPS-----SSIKDLFIRKWASRRIVVVMIIMFGLGMSYYGVPLAVRD  344

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS  LNA+ ELP  ++T +L+++  RRS+++  G++ G   + C V        
Sbjct  345  IKVNIYLSEALNAMVELPTFVITPILLERFSRRSSLIVNGLIGGASGVFCFVLSLLGRTN  404

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +   LE+ +FF A   FN++ +Y +ELFPTCVRN A  M RQA+++GGA  P++ ++G  
Sbjct  405  MAFALELASFFCARIGFNLMAVYMVELFPTCVRNFATTMLRQALILGGACCPIIASVGTN  464

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
                S+ VFGLA     LF + LPET G  LCDT++ +E ++  
Sbjct  465  VPSLSFAVFGLAMSGLGLFALLLPETKGSSLCDTMEAQEERDQS  508



>ref|XP_010532008.1| PREDICTED: organic cation/carnitine transporter 5 [Tarenaya hassleriana]
Length=519

 Score =   185 bits (469),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 166/293 (57%), Gaps = 6/293 (2%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSWR LYL T +P  +Y V +Y+   ESPRWL L+G   + ++ ++ ++      S + 
Sbjct  232  NSSWRVLYLCTSVPAALYCVFLYIFVLESPRWLNLQGRNDEAIDVLRKLSTARGTHSESI  291

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                   Q+       E+   YS   L + K WA R++L V  +  G+G+ YYG+PL   
Sbjct  292  FNRLPLKQET-----LERGRKYSIRDLFVRK-WAFRQILAVTVIMFGLGMSYYGVPLAAR  345

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
            ++  N+YLS TLNA+ ELP+ ++T  L++   RRS+V+   ++ G+  + C +       
Sbjct  346  DINVNIYLSETLNALVELPSFVLTPFLLENCSRRSSVLVSNLVGGISGILCFLLSVLGRT  405

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
                  E+  FF+A   FN++ +Y +E+FPTCVRNSA  + RQA+VVGG  SP+  +LG 
Sbjct  406  KTAFAFELATFFSARIGFNLMAVYVVEMFPTCVRNSATTIMRQALVVGGVCSPIFTSLGT  465

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV*TLNC  880
                 S+ +FG +  +  LF++ LPET G  LCDT++E+E ++   ++   +C
Sbjct  466  NLPSLSFAIFGFSMFVFGLFVLLLPETKGSSLCDTMEEQEQRDQAVKLGVHSC  518



>ref|NP_001172311.1| Os01g0330500 [Oryza sativa Japonica Group]
 dbj|BAH91041.1| Os01g0330500 [Oryza sativa Japonica Group]
Length=691

 Score =   187 bits (475),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 120/287 (42%), Positives = 182/287 (63%), Gaps = 7/287 (2%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y++T +P + Y+V++YL+ +ESPRWL +RG  Q+ +E ++ +A          T
Sbjct  389  ASWRNMYVWTSLPSLCYAVLLYLLVQESPRWLLVRGRKQEAIEAVRQIASLNGGGGGITT  448

Query  185  tiFSDNQDQGLIDL-DEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            + FS   D   ++L D    +++ L  +  +  ALRRL  +   + G+G+VYYG+PL VG
Sbjct  449  SSFS-MLDACAVELGDGGEGMFATLHSIWERRRALRRLAAITAASFGVGMVYYGMPLNVG  507

Query  362  EM-PFNLYLSTTLNAVSELPASLVTLLLIDK-LRRRSTvvglgvlsgvcnlgcvvFVGEE  535
             + P NLYLS   NAV+ELP+S++  LL+ +   RR +VV L   SG+C+L   V     
Sbjct  508  SLSPSNLYLSVAYNAVAELPSSILAWLLMGRWFNRRGSVVALTTASGLCSLAACVPAVVL  567

Query  536  LKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVAL  715
                ++  E+ +FF +CTA++++L+YT+ELFPT VRNSAV + RQA+ +GG ++P+LVAL
Sbjct  568  PDGARMAAEVASFFASCTAYDMMLMYTIELFPTSVRNSAVGLVRQAVALGGVVAPVLVAL  627

Query  716  GRGNRFY---SYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            GR    Y   S+GVFGLA     L +  LPET G  L DT++EEE+ 
Sbjct  628  GRETTSYWSSSFGVFGLAVGCLGLLVTCLPETRGRRLSDTMEEEEAA  674



>ref|XP_010462739.1| PREDICTED: organic cation/carnitine transporter 6-like [Camelina 
sativa]
Length=518

 Score =   185 bits (469),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 165/285 (58%), Gaps = 10/285 (4%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSW+YLY  T +P I Y + +YL A ESPRWL+++G  ++ +  +  M+P       +  
Sbjct  234  SSWKYLY--TSVPAIFYCIFLYLFALESPRWLHMQGKDKEAINVLTKMSPKNRAYLESVI  291

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+        Q+  YS +K +  + WA +R+  VM +  G+G+ YYG+PL   +
Sbjct  292  SKLPLEQEN-----HTQVPTYS-IKDVFFRRWAFQRIYVVMIIMFGLGISYYGVPLAARD  345

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS TLNA+ ELP  ++T +L+++  RRS+V+   +L G   +   +        
Sbjct  346  IDVNIYLSETLNALVELPTFVITPILLERFNRRSSVLINTLLGGASGVLIFLLSILGQTE  405

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+  FF A   FN++ ++ +E+FPTCVR+SA  M +QA+VVGGA  PL+ ++GR 
Sbjct  406  IAFAFELATFFCARIGFNLMAVFMVEMFPTCVRSSATMMFQQALVVGGACCPLIASIGRD  465

Query  725  NRF--YSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
                  S+ VFG A     LF++ LPET G  LCDT++E+E ++ 
Sbjct  466  IHIPSVSFAVFGTAMSGLGLFVLILPETKGLSLCDTMEEQEKRDQ  510



>gb|EPS74210.1| hypothetical protein M569_00551, partial [Genlisea aurea]
Length=487

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 113/278 (41%), Positives = 178/278 (64%), Gaps = 13/278 (5%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR++Y+++ IP +IYS +V    RESPRWL+LR   ++F  TI+ +A  E +++     
Sbjct  223  SWRWIYIWSSIPCLIYSFLVMFFGRESPRWLFLRRRREEFERTIRYLAASENKTA-----  277

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
              ++N      D +E+     A+ +L++K W+ RRL  V+    G+GLVYYG+PLG+  +
Sbjct  278  --TNNFFFTRWDEEEECIETHAITILLSKRWSFRRLAAVIMAGFGLGLVYYGLPLGLETL  335

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV  547
             FN+YLS  LNA SE+PA+++T + + + RRR  ++ L V+S + ++ C +        +
Sbjct  336  SFNIYLSVALNAASEIPAAILTFVFVGRFRRRILILNLAVVSAISSIVCGMV---RFDRI  392

Query  548  QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGN  727
            QI LE+ +F  A  AF+I LIY LELFPTCVRN+A+++ RQA+++GGA+ PL  A G+GN
Sbjct  393  QISLELASFVAAVIAFDIFLIYVLELFPTCVRNTAMSIFRQAVMLGGAMGPLAAAAGKGN  452

Query  728  RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEE  841
               ++ ++  A+ L    ++ LPET G    DT+DEEE
Sbjct  453  ---AFAIYAAANALYGSMVIFLPETKGRIWADTMDEEE  487



>ref|XP_010688757.1| PREDICTED: organic cation/carnitine transporter 2-like [Beta 
vulgaris subsp. vulgaris]
Length=526

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 108/292 (37%), Positives = 178/292 (61%), Gaps = 4/292 (1%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            G SWR LYL T IPGII++++ Y    ESPRWL L+G  +D ++ + ++    +      
Sbjct  233  GYSWRILYLLTSIPGIIFTILAYFFMYESPRWLLLQGRERDAIDVLTSLGRHTSSQMSLS  292

Query  182  ttiFSDNQDQGLIDLDEQMDL--YSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLG  355
              +      Q L +     +   +++ K+L++K WA +RL+  M +A GIGL+Y+G+ LG
Sbjct  293  LEMIVKYTQQNLRNNTSNSNSNPFASYKILMSKRWAAKRLIVSMLLAFGIGLMYFGMFLG  352

Query  356  VGEMPFNLYLSTTLNAVSELPASLVTLLL-IDKLRRR-STvvglgvlsgvcnlgcvvFVG  529
            VG +  ++YL++  +A+  L +SL+  L  I +  RR S +    +   +  +  ++  G
Sbjct  353  VGGLGSDIYLTSVYHALLSLSSSLLAFLFWIPRCNRRISLLGFCTLSGAMSMILSIIGKG  412

Query  530  EELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLV  709
            +    + +G+E+V+ F+AC A+N+ ++Y +ELFPTC+R+SA ++ RQA  +G  + P+LV
Sbjct  413  KVGGGLLLGMELVSMFSACMAYNMAMMYIVELFPTCIRSSASSLVRQATNLGTVLDPILV  472

Query  710  ALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV  865
             LGRGN  YSYGVFGLA +LC   ++ LPET    LCDT++E+E ++    V
Sbjct  473  LLGRGNLLYSYGVFGLAMLLCGFLVILLPETRNQVLCDTMEEQELRDKEKTV  524



>ref|XP_010688821.1| PREDICTED: organic cation/carnitine transporter 3-like [Beta 
vulgaris subsp. vulgaris]
Length=399

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 99/250 (40%), Positives = 160/250 (64%), Gaps = 1/250 (0%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LYL+T +P  I+SV+ Y    ESPRWL L+G  QD ++ + ++    T      +
Sbjct  142  SSWRTLYLYTSVPTFIFSVLAYFFMYESPRWLLLQGREQDAMDVLMSLGRSRTGQISLSS  201

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
             +   +  Q + +     + +++L +LI+K WA++RL+  M ++ GIGL+Y+G+ LGVG+
Sbjct  202  PLIIKHTKQKVPNRKSNANPFASLHILISKKWAVKRLVASMLLSFGIGLMYFGMFLGVGD  261

Query  365  MPFNLYLSTTLNAVSELPASLVTLLL-IDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
            +  ++YL++ L+A+  L + LV  L  I K  RR +++G   LSG  ++   +    +++
Sbjct  262  LGSDIYLTSVLHALLALISYLVAFLFWIPKCNRRVSLLGYCTLSGATSIVLAITGKGKIE  321

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             + +G+E+V+ F AC A+NI  +Y +ELFPTCVR+S+ ++ RQAM+ G  + PLLV LGR
Sbjct  322  GILLGMELVSMFCACMAYNISTMYVVELFPTCVRSSSSSLVRQAMIFGSVLDPLLVLLGR  381

Query  722  GNRFYSYGVF  751
            GN  YSYGVF
Sbjct  382  GNLLYSYGVF  391



>ref|XP_009620576.1| PREDICTED: organic cation/carnitine transporter 3-like [Nicotiana 
tomentosiformis]
Length=546

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 107/271 (39%), Positives = 162/271 (60%), Gaps = 7/271 (3%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LYL+T +P IIY +++     ESPRWL  +G  ++    +KT   P  ++      
Sbjct  247  SWRVLYLWTSLPTIIYCMLLQFCVYESPRWLLSKGKNREAFAVLKTFIAPHCKNLSLNDL  306

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
            +   +     ID D    L   +K+L+ + W L +LL  +    GIGL+YYG+PLG+G  
Sbjct  307  VLKHDHKLK-IDNDFNQPL---IKILLKERWILGQLLLAVSTGFGIGLMYYGMPLGLGNF  362

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV  547
              NLYLST LNA+ ELPA L+   L++K  RRST   +G+       G +  + ++ K +
Sbjct  363  SLNLYLSTGLNALLELPAFLIIFFLVEKCNRRST--LVGLSVLSGVCGMLCMIVDKWKVL  420

Query  548  QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLV-ALGRG  724
            Q+ LE+++FF+ACTAF+ LLIYT ELFPT +RN+ V++  Q++V+GG +SP+LV A G  
Sbjct  421  QLVLELISFFSACTAFDFLLIYTSELFPTSIRNATVSIVWQSVVLGGVVSPVLVDAGGDR  480

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDL  817
            +    Y V G+ + +    ++ LPET G +L
Sbjct  481  SNILPYLVLGIMTSIAGSLVIFLPETKGLEL  511



>ref|XP_010045676.1| PREDICTED: organic cation/carnitine transporter 3-like [Eucalyptus 
grandis]
 gb|KCW83960.1| hypothetical protein EUGRSUZ_B00845 [Eucalyptus grandis]
Length=476

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/272 (38%), Positives = 168/272 (62%), Gaps = 7/272 (3%)
 Frame = +2

Query  32   TGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQ  211
            T +P +IY+ + + + RESP+WL+++G  ++ + T+     P   S +        ++ +
Sbjct  207  TSVPALIYTSVTFFLVRESPKWLFMQGRDKEALATLTRFTLPAKHSRLELYLSRLLHKKE  266

Query  212  GLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLST  391
                   ++ LYS++K ++ + WA +RLL VM +  G G++ YG+ LGVG + F+LYLS 
Sbjct  267  -----PTKLGLYSSVKYILEQQWASKRLLKVMALGFGTGMMDYGMLLGVGSLGFDLYLSV  321

Query  392  TLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIGLEIVA  571
            T NA+  LP+ + +  LI++ +RR +V+   +LSG  ++ C   +      +++GLE+ +
Sbjct  322  TFNALVILPSYVASYFLIERWKRRDSVLSFTMLSGSLSIVCA--IAGSGSLLELGLELAS  379

Query  572  FFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVF  751
            FF  C  +N+LLIYT ELFPT VRNSA++M RQA+V+G  + P L++ GR  R+ ++ VF
Sbjct  380  FFCTCVVYNVLLIYTTELFPTRVRNSAISMMRQAVVLGVLLDPTLISAGRDIRYLTFLVF  439

Query  752  GLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            GL  + C      LPET G  LCDT+DE+E +
Sbjct  440  GLTIICCGCAAAFLPETRGVTLCDTLDEQEQR  471



>ref|XP_010476745.1| PREDICTED: LOW QUALITY PROTEIN: organic cation/carnitine transporter 
6-like [Camelina sativa]
Length=511

 Score =   173 bits (438),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 163/278 (59%), Gaps = 8/278 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWRYLYL+T +P I Y + +YL A ESPRWL+++G  ++ ++ +  M+P       +  
Sbjct  236  SSWRYLYLYTSVPAISYCIFIYLFALESPRWLHMQGKDKEAIDVLTKMSPKNRAYLESVI  295

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +     Q+        Q+  YS +K    + WA RR+  VM +  G+G+ YYG+PL   +
Sbjct  296  SKLPLEQES-----HAQVPTYS-IKDFFFRRWAFRRISVVMIIMFGLGISYYGVPLAARD  349

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            +  N+YLS TLNA+ ELP  ++T +L+++  RRS+++   +L G   + C +        
Sbjct  350  IDVNIYLSETLNALVELPTFVITPILLERFNRRSSILINTLLGGASGVLCFLLSILGQTE  409

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            +    E+  FF A   FN++ ++ +E+FPTCVR+SA  M +QA+VVGGA  PL+ ++GR 
Sbjct  410  IAFAFELATFFCARIGFNLMAVFMVEMFPTCVRSSATMMFQQALVVGGACCPLIASIGRD  469

Query  725  NRF--YSYGVFGLASVLCCLFLVSLPETLGGDLCDTID  832
                  S+ VFG A     LF++ LPET G  LCDT++
Sbjct  470  IHIPSVSFAVFGTAMSGLGLFVLILPETKGLSLCDTME  507



>ref|XP_002465179.1| hypothetical protein SORBIDRAFT_01g033430 [Sorghum bicolor]
 gb|EER92177.1| hypothetical protein SORBIDRAFT_01g033430 [Sorghum bicolor]
Length=518

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/279 (39%), Positives = 173/279 (62%), Gaps = 10/279 (4%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y +T +P + Y V++Y +  ESPRWL +RG   D +E +K +       +    
Sbjct  237  ASWRNMYFWTSVPCLCYCVLLYFLVPESPRWLLVRGRKLDAMEALKQIISLNGSCATASF  296

Query  185  tiFSDNQDQGLIDLDEQM-----DLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIP  349
            ++     D+  +  D+        +++ L+ +  + WA +RL   M  + G+G+ Y+G+P
Sbjct  297  SLL----DRCTVHEDDDGASSGGGVFATLQAMWERRWAFQRLAATMAASFGVGMFYFGMP  352

Query  350  LGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG  529
            L VG +  +LYLS TLNA++EL A+++T LL+ +  RRS V+ L   +G C+L CV  + 
Sbjct  353  LNVGSLGSDLYLSVTLNALAELAAAVLTWLLVSRSDRRSAVIALTAAAGACSLACVA-IP  411

Query  530  EELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLV  709
                + ++  E+++FF ACTAF++LLIY+ E+FPT VRNSAV + RQ MV+GGA +P+L+
Sbjct  412  RRAASARMAAEVLSFFAACTAFDVLLIYSTEMFPTSVRNSAVGLVRQTMVLGGAAAPVLI  471

Query  710  ALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDT  826
            ALGR +  +S+GVFG+A     LF+  LPET G  +  T
Sbjct  472  ALGRESSLWSFGVFGIAIGCSGLFIPCLPETRGKRMSST  510



>ref|XP_004246113.1| PREDICTED: organic cation/carnitine transporter 3-like [Solanum 
lycopersicum]
Length=516

 Score =   171 bits (434),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 119/298 (40%), Positives = 173/298 (58%), Gaps = 31/298 (10%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LYL T +P I+Y +++     ESPRWL  +G   +    + T             +
Sbjct  238  SWRVLYLSTSLPAIVYCLLIQFCVYESPRWLLSKGKVIEAYAVLNT-------------S  284

Query  188  iFSDNQDQGLIDLDEQMDLYSAL--------KLLINKGWALRRLLTVMWVALGIGLVYYG  343
             F + +     +LD     ++ +        K+L+ K   L +LL  +    GIGL+YYG
Sbjct  285  HFKNERS----NLDHNKLSFTTMRGSDPPLIKILLRKKSILGQLLLAVVAGFGIGLMYYG  340

Query  344  IPLGVGEMPF--NLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcv  517
            +PLG+G   F  NLYLST LNA+ ELP+ L+   L +K +RRST+VGL V+SGVC + C 
Sbjct  341  MPLGLGNGNFSLNLYLSTGLNALLELPSFLIVFFLAEKCKRRSTLVGLSVVSGVCGMLC-  399

Query  518  vFVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAIS  697
              +  E K +Q+ LE  +FF+ACTAF++LLIYT ELF T +RN+AV++  QA+V+GG +S
Sbjct  400  -MIVSERKVLQMVLEFTSFFSACTAFDLLLIYTSELFHTSIRNAAVSIVWQAVVLGGVVS  458

Query  698  PLLVALG--RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV  865
            P+LV  G    N+  +Y V G+ + +    +V LPET G ++C  I+E E K   N V
Sbjct  459  PVLVDAGGDSNNKILAYLVLGIITAIAGCLVVFLPETKGLEICKKIEELEQKGCINDV  516



>ref|XP_007133865.1| hypothetical protein PHAVU_011G215500g [Phaseolus vulgaris]
 gb|ESW05859.1| hypothetical protein PHAVU_011G215500g [Phaseolus vulgaris]
Length=603

 Score =   166 bits (421),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 128/206 (62%), Gaps = 2/206 (1%)
 Frame = +2

Query  239  DLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELP  418
             LYS++ +L    WA +R++ VM +  GIG+VY+G+PL VG + +N+YL+   + + ++P
Sbjct  399  QLYSSIAMLFRASWAPKRMVAVMGLGFGIGMVYFGMPLAVGNLDYNIYLAVVFHGLMKIP  458

Query  419  ASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIGLEIVAFFTACTAFN  598
            + +VT  L +  R+ S           C +  V+  G E   V++ + + +FF AC AFN
Sbjct  459  SCVVTYFLGNCSRKLSIFAFSLGSGICCIVCVVISNGGE--GVKVWVAVASFFCACIAFN  516

Query  599  ILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCL  778
            + LIY +ELFPTCVRN+A ++ARQA+V G    P L++ GR N  +SYGVFG+  +    
Sbjct  517  VFLIYMIELFPTCVRNTAASLARQAVVFGCIFCPFLISAGRNNNIFSYGVFGVLIICSTF  576

Query  779  FLVSLPETLGGDLCDTIDEEESKENG  856
             L+SLPET G  L DT+D++E KE  
Sbjct  577  TLLSLPETRGVTLSDTMDQQEKKETS  602


 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIK  142
             S W+YLYL+T +P I YS+I YL   ESPRWL ++G  ++ +  +K
Sbjct  225  NSPWKYLYLWTSVPAISYSLIAYLFVTESPRWLLMQGRVKEAMAMLK  271



>ref|XP_010688755.1| PREDICTED: organic cation/carnitine transporter 2-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=463

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 143/221 (65%), Gaps = 1/221 (0%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LYL+T IPGI+ S++ Y    ESPRWL+++G T+D +  ++ +           T+
Sbjct  234  SWRMLYLWTSIPGILCSIVCYFFLLESPRWLFMQGRTKDSMAVLRKLGSTTHDYYTNTTS  293

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
            + ++ + Q     D     +++LK+L  K WA++RLL  + +A GIGL+Y+G+ LGVG +
Sbjct  294  LMTNIRTQQETPNDSSTSSFASLKILFKKRWAIKRLLAAVILAFGIGLMYFGMFLGVGNL  353

Query  368  PFNLYLSTTLNAVSELPASLVTLLL-IDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
             FN+YL++T +A+  L + L+T L  + +  RRS+++G  V+SG  ++   +   +  + 
Sbjct  354  GFNIYLTSTFSALISLASYLLTFLFWVQRCNRRSSLLGFCVISGATSIMFSILGKDGHEG  413

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMAR  667
            + IGLE+V+ F AC A+N++L+YT+ELFPTCVRNSA ++  
Sbjct  414  ILIGLELVSLFCACMAYNLVLMYTVELFPTCVRNSAASVGE  454



>ref|XP_010688754.1| PREDICTED: organic cation/carnitine transporter 2-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 143/221 (65%), Gaps = 1/221 (0%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LYL+T IPGI+ S++ Y    ESPRWL+++G T+D +  ++ +           T+
Sbjct  265  SWRMLYLWTSIPGILCSIVCYFFLLESPRWLFMQGRTKDSMAVLRKLGSTTHDYYTNTTS  324

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
            + ++ + Q     D     +++LK+L  K WA++RLL  + +A GIGL+Y+G+ LGVG +
Sbjct  325  LMTNIRTQQETPNDSSTSSFASLKILFKKRWAIKRLLAAVILAFGIGLMYFGMFLGVGNL  384

Query  368  PFNLYLSTTLNAVSELPASLVTLLL-IDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
             FN+YL++T +A+  L + L+T L  + +  RRS+++G  V+SG  ++   +   +  + 
Sbjct  385  GFNIYLTSTFSALISLASYLLTFLFWVQRCNRRSSLLGFCVISGATSIMFSILGKDGHEG  444

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMAR  667
            + IGLE+V+ F AC A+N++L+YT+ELFPTCVRNSA ++  
Sbjct  445  ILIGLELVSLFCACMAYNLVLMYTVELFPTCVRNSAASVGE  485



>ref|XP_009340553.1| PREDICTED: organic cation/carnitine transporter 3-like [Pyrus 
x bretschneideri]
Length=441

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 127/202 (63%), Gaps = 2/202 (1%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
              SWR LY +T IP ++YS++V+ +  ESPRWL++RG  +D +ET+K +AP  + ++   
Sbjct  236  AHSWRTLYFWTSIPTLLYSIMVHFLVCESPRWLFVRGRKEDAIETLKCIAPVNSTTTKAP  295

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             T  S            ++DLYSA+  L+ + WA RRL  VM +  GIG+VYYG+PL +G
Sbjct  296  LTS-SFISSLSFEQETSKVDLYSAIDALVKRKWAFRRLSAVMAIGYGIGMVYYGMPLALG  354

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvls-gvcnlgcvvFVGEEL  538
             + FNLYLS TLNA+SELPASL+T   IDK+ R+++V+    LS     +  +  +    
Sbjct  355  SLEFNLYLSVTLNALSELPASLITFFFIDKMNRKTSVLVFTSLSGVCNIMSVLKGIHPIW  414

Query  539  KAVQIGLEIVAFFTACTAFNIL  604
              +QIG E+V+FF+AC AF  L
Sbjct  415  TRLQIGFELVSFFSACLAFGAL  436



>ref|XP_010535281.1| PREDICTED: organic cation/carnitine transporter 1 [Tarenaya hassleriana]
Length=533

 Score =   157 bits (397),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/296 (35%), Positives = 158/296 (53%), Gaps = 23/296 (8%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LY       ++Y+V++   A ESPRWL ++G  ++ +ET++ +A           
Sbjct  239  ASWRNLYRIMAFQPLVYAVLLLPFAFESPRWLLVKGYNKEALETLRKLA-----------  287

Query  185  tiFSDNQ---DQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLG  355
              F+  Q   D  L+D     D     KL   + WA++R++ VM V  G G VYYGI L 
Sbjct  288  -RFNGRQIPADLCLVDPIPANDQTQPEKLWKTR-WAVKRVVMVMLVGFGTGFVYYGIQLN  345

Query  356  VGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRR-----STvvglgvlsgvcnlgcvv  520
               + FNLYL+  +NA+ E+PA  +  +L+  + RR     S+ +          L    
Sbjct  346  SENLDFNLYLTVAVNALMEIPAVFIGSILLGIMNRRPLFSNSSYLAGVSCVLCAVLSLPR  405

Query  521  FVGEEL--KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAI  694
             +      K +Q+  E V F  + TA+++L +Y +ELFPT VRN AV+  RQA ++G + 
Sbjct  406  VINANAVSKYLQLAAEAVGFMASSTAYDVLYVYCVELFPTNVRNLAVSFLRQAFMLGASA  465

Query  695  SPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNR  862
            +PLLVALGR +   S+ VF +ASVL  +  + L ET    L DT+ ++E +EN  R
Sbjct  466  APLLVALGRVSPLMSFIVFAVASVLSGVLSLWLRETWNAPLYDTLKQQEKEENLER  521



>ref|XP_010270825.1| PREDICTED: organic cation/carnitine transporter 1 [Nelumbo nucifera]
Length=539

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 103/289 (36%), Positives = 158/289 (55%), Gaps = 21/289 (7%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y    +   +YS+++     ESPRWL +RG T++ +E ++ +A    +      
Sbjct  236  TSWRNIYKIISLLPFVYSILILPFVSESPRWLVVRGRTKEALEVLRVLARMNGKKLPMNL  295

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
             I + +    L + D    L+SA        WA RR++TVM   LG+G +YYGI L V  
Sbjct  296  HISNPSTSSKLNEPDVTKSLWSAR-------WATRRMITVMIAGLGVGFMYYGIQLNVEN  348

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV------  526
            + FNLYL+  +NA  E+PA  +  LL+  + RR        ++G   + C+ F       
Sbjct  349  LNFNLYLTVVVNATMEIPAVFIGSLLLSFMNRRLLFSSSTYIAGASCIICIFFSRKNSTV  408

Query  527  ------GEELKA--VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVV  682
                   EE K    Q+ +E + F  A TAF+IL IY +ELFPT VRNSAV++ RQA+++
Sbjct  409  MGGQGKNEEEKGNWTQLIIEAIGFMAASTAFDILYIYCVELFPTNVRNSAVSLLRQALML  468

Query  683  GGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
            G +I+PLLV LGR +   S+ +FG  ++L  +  + LPET    L +T+
Sbjct  469  GASIAPLLVVLGRLSPSLSFLIFGGFAILSGILTLWLPETRNAPLYETL  517



>gb|EEE54473.1| hypothetical protein OsJ_01577 [Oryza sativa Japonica Group]
Length=591

 Score =   155 bits (393),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 108/285 (38%), Positives = 159/285 (56%), Gaps = 45/285 (16%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y++T +P + Y+V++YL+ +ESPRWL +RG  Q+ +E ++ +A          T
Sbjct  329  ASWRNMYVWTSLPSLCYAVLLYLLVQESPRWLLVRGRKQEAIEAVRQIASLNGGGGGITT  388

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            + FS                                +L    V LG G        G G 
Sbjct  389  SSFS--------------------------------MLDACAVELGDG--------GEGI  408

Query  365  M-PFNLYLSTTLNAVSELPASLVTLLLIDK-LRRRSTvvglgvlsgvcnlgcvvFVGEEL  538
            + P NLYLS   NAV+ELP+S++  LL+ +   RR +VV L   SG+C+L   V      
Sbjct  409  LSPSNLYLSVAYNAVAELPSSILAWLLMGRWFNRRGSVVALTTASGLCSLAACVPAVVLP  468

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
               ++  E+ +FF +CTA++++L+YT+ELFPT VRNSAV + RQA+ +GG ++P+LVALG
Sbjct  469  DGARMAAEVASFFASCTAYDMMLMYTIELFPTSVRNSAVGLVRQAVALGGVVAPVLVALG  528

Query  719  RGNRFY---SYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEES  844
            R    Y   S+GVFGLA     L +  LPET G  L DT++EEE+
Sbjct  529  RETTSYWSSSFGVFGLAVGCLGLLVTCLPETRGRRLSDTMEEEEA  573



>gb|KDP25005.1| hypothetical protein JCGZ_23988 [Jatropha curcas]
Length=555

 Score =   153 bits (386),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/299 (33%), Positives = 159/299 (53%), Gaps = 18/299 (6%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMA-------PPEt  163
            +SWR LY    +  ++YS++      ESPRWL +RG +++ +  +K  A       P   
Sbjct  257  TSWRNLYRIISLFPLVYSILFIPFISESPRWLLVRGRSKEAIYILKRYAKLNGKKLPSNL  316

Query  164  rssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYG  343
              +    +   +N      + + ++D   +L    N  WA +R++ VM    G+G VYYG
Sbjct  317  TLANPSISKVVENGAGVASESEAKVDTNESL---WNNKWAAKRMIMVMIAGFGVGFVYYG  373

Query  344  IPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvF  523
            I L V  + FNLY +  LNA+ E+PA  +  +L+    RR        ++G+  + C++F
Sbjct  374  IQLNVENLDFNLYFTVALNALMEIPAVFIGSVLLSFTNRRLLFSQSAYIAGISCILCILF  433

Query  524  VGEELKA-------VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVV  682
                 KA        Q+ +E + F  A TAF+++ IY +ELFPT VRN AV+M RQ++++
Sbjct  434  -SRRAKADKSGGSWTQLTIEGIGFMAASTAFDVMYIYCVELFPTNVRNFAVSMLRQSLML  492

Query  683  GGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGN  859
            G +I+PLLV +GR +   S+ VFGL S+      + LPET    L +T+ ++E  E  N
Sbjct  493  GASIAPLLVVVGRWSPSLSFLVFGLLSIFSGTLSLWLPETRNAPLYETLKQQEEDEKQN  551



>gb|EYU22280.1| hypothetical protein MIMGU_mgv1a004461mg [Erythranthe guttata]
Length=526

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 151/285 (53%), Gaps = 22/285 (8%)
 Frame = +2

Query  11   WRYLYLFTGIPGIIYSVIVYL-VARESPRWLYLRGLTQDFVETIKTMA-------PPEtr  166
            WR LY       ++YS+ V +    ESPRWL +RG +++ ++ ++  A       PP   
Sbjct  227  WRNLYKIISFLPLVYSIFVLIPFVSESPRWLLVRGRSEEALDVLRNYARINGKEIPPNIT  286

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
                       N + G  D     +  S ++ L    WA+RR+  +M+   GIG +YYGI
Sbjct  287  LLE------PSNSNNGKKD----ENTLSPIEKLWTTRWAVRRMALIMFTGFGIGFMYYGI  336

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
             L V  + FNLY +  +NA  E+PA  V   L+    RR        L+G   L C+VF 
Sbjct  337  QLNVENLSFNLYFTVAINATMEIPAVFVGSFLLGTTNRRRLFSTSAFLAGAFCLFCIVFS  396

Query  527  GEELKA----VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAI  694
             E+ +      Q+ +E + F  A TAFN+L  Y +ELFPT VRN AV+M RQA+++G +I
Sbjct  397  TEKNRGGGSLPQLTMEALGFMAAATAFNVLYTYCVELFPTNVRNFAVSMMRQALMLGASI  456

Query  695  SPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
            SPLLV  GR +   S+ VFG++SV+  L  + LPET    L +T+
Sbjct  457  SPLLVVYGRLSPSLSFFVFGVSSVVSGLLSLWLPETRNAPLYETL  501



>ref|XP_011000788.1| PREDICTED: organic cation/carnitine transporter 1-like [Populus 
euphratica]
Length=546

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 106/306 (35%), Positives = 163/306 (53%), Gaps = 26/306 (8%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP------PEtr  166
            ++WR LY    +  + YSV+ +    ESPRWL +RG +++ ++ +KT A       PE  
Sbjct  245  TNWRNLYKILSLLPLAYSVLFFPFVSESPRWLLVRGRSKEALDVLKTFARLNGKTLPENL  304

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
                 +      +++ L     +  L+          WA +R++TVM    GIG VYYG+
Sbjct  305  CLANPSAPGEGGENEALTKNCTKESLW-------RTKWAAKRMITVMMAGFGIGFVYYGV  357

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
             L V  + FNLY S  LNA+ E+PA ++  +L+    RR        L+G+  L C+VF 
Sbjct  358  QLNVENLNFNLYFSVGLNALMEVPAVVIGTILLGLTGRRLLFSLSAFLAGISCLLCIVFA  417

Query  527  -GEELKAV---------QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAM  676
             G+  K           Q+ +E + F  A  AF++L +Y +ELFPT VRN AV+ +RQA+
Sbjct  418  HGKRAKNADKSSTGNWAQLAIEGIGFMAASVAFDVLYVYCIELFPTNVRNFAVSQSRQAL  477

Query  677  VVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN-  853
            ++G +I+PLLVA GR +   S+ VFG+ S+   +    LPET    L DT+ +EE  E  
Sbjct  478  MLGASIAPLLVAAGRLSPSLSFLVFGILSIFSGVLSWWLPETRNAPLYDTLKQEEEDEKN  537

Query  854  --GNRV  865
              GN++
Sbjct  538  KVGNQI  543



>ref|XP_011014754.1| PREDICTED: organic cation/carnitine transporter 1-like [Populus 
euphratica]
Length=546

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/306 (34%), Positives = 164/306 (54%), Gaps = 26/306 (8%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP------PEtr  166
            ++WR LY    +  + YSV+ +    ESPRWL +RG +++ ++ +KT A       PE  
Sbjct  245  TNWRNLYKILSLLPLAYSVLFFPFVSESPRWLLVRGRSKEALDVLKTFARLNGKTLPENL  304

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
                 +      +++ L     +  L+          WA +R++TVM    G+G VYYG+
Sbjct  305  CLANPSAPGEGGENEALTKNCTKESLW-------RTKWAAKRMITVMMAGFGVGFVYYGV  357

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
             L V  + FNLY S  LNA+ E+PA ++  +L+    RR        L+G+  L C+VF 
Sbjct  358  QLNVENLNFNLYFSVGLNALMEVPAVVIGTILLGLTGRRLLFSLSAFLAGISCLLCIVFA  417

Query  527  -GEELKA---------VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAM  676
             G+  K          VQ+ +E + F  A  AF++L +Y +ELFPT VRN AV+ +RQA+
Sbjct  418  HGKRAKNADKSSTGNWVQLAIEGIGFMAASVAFDVLYVYCIELFPTNVRNFAVSQSRQAL  477

Query  677  VVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN-  853
            ++G +I+PLLVA GR +   S+ VFG+ S+   +    LPET    L DT+ ++E  E  
Sbjct  478  MLGASIAPLLVAAGRLSPSLSFLVFGILSIFSGVLSWWLPETRNAPLYDTLKQQEEDEKN  537

Query  854  --GNRV  865
              GN++
Sbjct  538  KVGNQI  543



>emb|CDY12590.1| BnaA02g12580D [Brassica napus]
Length=354

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 139/267 (52%), Gaps = 52/267 (19%)
 Frame = +2

Query  50   IYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLIDLD  229
            +Y + +YL A ESPRWL+L+G  ++ +E +K ++P                         
Sbjct  129  VYCIFLYLFAVESPRWLHLQGKDEEAIEMLKKISP-------------------------  163

Query  230  EQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVS  409
                        +NKG                GL YYG+PL V ++  N+YLS  LNAV 
Sbjct  164  ------------VNKGS---------------GLSYYGVPLAVRDIKVNIYLSEALNAVV  196

Query  410  ELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAVQIGLEIVAFFTACT  589
            ELP  ++T +L++K  RRS+VV   ++ G   + C V     +      LE+  FF    
Sbjct  197  ELPTFVITPILLEKFSRRSSVVVNCLIGGASGMLCFVLSLLGMTNTAFALELACFFCGRI  256

Query  590  AFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVL  769
             FN++ +Y +ELFPTCVRN+A  M RQA+VV GA SP++ ++GR     S+ +FGLA   
Sbjct  257  QFNLMAVYMVELFPTCVRNTATLMLRQALVVAGACSPIIASIGRDVPSLSFALFGLAMAG  316

Query  770  CCLFLVSLPETLGGDLCDTIDEEESKE  850
              LF + LPET G  LCDT++ +E ++
Sbjct  317  LGLFALLLPETKGSSLCDTMEAQEERD  343



>ref|XP_008813162.1| PREDICTED: organic cation/carnitine transporter 1 [Phoenix dactylifera]
Length=522

 Score =   150 bits (378),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 157/287 (55%), Gaps = 13/287 (5%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            + WR +Y    +  + YS+++     ESPRWL ++G T++ ++ +   A    R      
Sbjct  232  TQWRNIYKVISLLPLAYSLLILPFVSESPRWLAVKGRTEEALDVLTKFAKLNGRKLPQNI  291

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +I S +        +    L+SA        WA+RR+ TVM    G+G VYYG+ L V  
Sbjct  292  SISSPSHAT-TSSAERNESLWSAR-------WAVRRIATVMIAGFGVGFVYYGVQLNVEN  343

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FNLY S   N + E+PA L+  +L+    RR        ++G+  + C++F  EE K+
Sbjct  344  LNFNLYFSVATNTLMEIPAVLLGSVLLSFTDRRILFSLSAFIAGISCILCILFT-EETKS  402

Query  545  ----VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
                 Q+ +E + F  A  AF++L +Y++ELFPT VRN AV+M RQA+++G AI+PLLV 
Sbjct  403  KGSWSQLTVEAIGFMAASMAFDVLYVYSVELFPTNVRNFAVSMLRQALMLGAAIAPLLVV  462

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            LGR +   S+ +FG  S+   L    LPET    L +T++++E +E 
Sbjct  463  LGRLSPKISFLIFGCFSIFSGLLTFWLPETRNAPLYETLEQQEKEEK  509



>gb|AAM67370.1| unknown [Arabidopsis thaliana]
Length=328

 Score =   146 bits (368),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 154/293 (53%), Gaps = 23/293 (8%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
             SWR LY       + Y+V +   A ESPRWL ++G  ++ +  +K +A           
Sbjct  38   KSWRNLYRIISFLPLGYAVCLLPFAYESPRWLLVKGRNKEAMVVLKKLA-----------  86

Query  185  tiFSDNQ---DQGLID-LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPL  352
               +  Q   D  L+D + E+ D  S+ +      WA++R++ VM    G G VYYGI L
Sbjct  87   -RLNGKQLPADLSLVDPIPERDDQTSSSEKFWKTKWAVKRIIMVMMAGFGSGFVYYGIQL  145

Query  353  GVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGE  532
                + FNLYL+  +NA+ E PA  +   L+  + RR        L+G   L C V    
Sbjct  146  NAENLNFNLYLTVAVNALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGFACLLCAVLSIH  205

Query  533  EL-------KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGA  691
             +       K +Q+ +E V F  + TA+++L +Y +ELFPT VRN+AV++ RQA ++G +
Sbjct  206  RVIRAISVAKWLQLAVEAVGFMASSTAYDVLYVYCVELFPTNVRNTAVSLLRQAFMLGAS  265

Query  692  ISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             +PLLVALGR +   S+ VFG+ASVL  +  + L ET    L +T+ ++   E
Sbjct  266  AAPLLVALGRESAMMSFIVFGVASVLSGIVSLWLRETRNAPLYETLAQQGKAE  318



>emb|CDO98595.1| unnamed protein product [Coffea canephora]
Length=550

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/301 (34%), Positives = 161/301 (53%), Gaps = 26/301 (9%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYL-VARESPRWLYLRGLTQDFVETIKTMA-------PPE  160
            +SWR LY       ++YS+ V L    ESPRWL +RG  ++ ++ ++  A       PP 
Sbjct  248  NSWRSLYKIISFLPLVYSIFVLLPFVSESPRWLLVRGRRKEALDVLRRYARLNGRKIPPN  307

Query  161  trssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYY  340
               S       +    +G   L E        + L N  WA +R+  VM    GIG VY+
Sbjct  308  LCISEPSVA--TQETSKGEEVLQE--------RTLWNTKWAAKRMALVMMTGFGIGFVYF  357

Query  341  GIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvv  520
            G+ L V  + FNLY +   NA+ E+ A  +  +L+   +RR     L  ++G+ ++ C++
Sbjct  358  GVQLNVENLNFNLYFAVAANAMMEISAVFIGGVLLSVAKRRLIFSQLAFIAGLSSILCIL  417

Query  521  FVGEELKAV--------QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAM  676
            F G +   +        +  LE + F  A TAFN+L +YT+ELFPT VR+ AV++ RQAM
Sbjct  418  FSGGKQGILDKSGGSWPEFALEAIEFMAASTAFNVLFVYTVELFPTNVRSFAVSVLRQAM  477

Query  677  VVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            V+G +I+PLLVA+GR +   ++ +FG  S+   L ++ LPET    L +T++++E +   
Sbjct  478  VLGASIAPLLVAVGRYSPALAFLIFGALSIFSGLMILWLPETRNSPLYETLEQQEQEGQL  537

Query  857  N  859
            N
Sbjct  538  N  538



>ref|XP_010471381.1| PREDICTED: organic cation/carnitine transporter 1 [Camelina sativa]
Length=536

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 156/289 (54%), Gaps = 17/289 (6%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY       + Y+V +   A ESPRWL ++G  ++ +  +K +A    +       
Sbjct  247  SWRNLYRIISFLPLGYAVCLLPFAYESPRWLLVKGRNKEAMVILKKLARRNGKQLPA---  303

Query  188  iFSDNQDQGLID-LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                  D  L+D + E+ D  S+ +      WA++R++ VM    G G VYYGI L    
Sbjct  304  ------DLSLVDPIPERNDQTSSSEKFWKTKWAVKRIILVMMAGFGSGFVYYGIQLNAEN  357

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL--  538
            + FNLYL+  +NA+ E PA  +   L+  + RR        L+GV  L C V     +  
Sbjct  358  LNFNLYLTVAVNALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGVACLLCAVLSLHRVIR  417

Query  539  -----KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
                 K +Q+ +E V F  + TA++++ +Y++ELFPT VRN+AV++ RQA ++G + +PL
Sbjct  418  AVSIAKWLQLAVEAVGFMASSTAYDVMYVYSVELFPTNVRNTAVSLLRQAFMLGASAAPL  477

Query  704  LVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            LVALGR +   S+ VFG+ASVL  +  + L ET    L +T+ ++ + E
Sbjct  478  LVALGRESAMMSFIVFGVASVLSGVVSIWLRETRNAPLYETLAQQGNAE  526



>gb|AFW88028.1| hypothetical protein ZEAMMB73_834314 [Zea mays]
Length=469

 Score =   147 bits (371),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP-PEtrssitrt  184
            SWR +Y +  +P + Y+ +++L+A+ESPRWL +RG  +D +E+++ +A   ++    T  
Sbjct  238  SWRSMYFWMVVPCLFYAALIHLLAQESPRWLLVRGHKRDAIESLRQIATLDDSGGHTTTN  297

Query  185  tiFSDNQDQGLIDLDEQ-------MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYG  343
                + + +  + +  +         +++ L+++  + WA+RRL  +M    G+G+VY+G
Sbjct  298  LSMLELELEACVSMHNEDGASSSGSGVFATLQVMWERPWAIRRLAAIMVAGFGVGMVYFG  357

Query  344  IPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvF  523
            +PL VG +  NLYLST  NA++E+P+S+++ LLI +  RR T V +   S          
Sbjct  358  MPLTVGSLGSNLYLSTAYNALAEVPSSILSWLLIARANRR-TSVVVLAASAGVLSLACAA  416

Query  524  VGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAV  655
            + +  +A ++  E+++FF  CTA++++L+Y++ELFPT VRNSAV
Sbjct  417  MPQRAEAARMAGELLSFFATCTAYDVILVYSIELFPTSVRNSAV  460



>ref|XP_010416114.1| PREDICTED: organic cation/carnitine transporter 1-like [Camelina 
sativa]
Length=562

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 155/289 (54%), Gaps = 17/289 (6%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY       + Y+V +   A ESPRWL ++G  ++ +  +K +A    +       
Sbjct  273  SWRNLYRIISFLPLGYAVCLLPFAYESPRWLLVKGRNKEAMVILKKLARRNGKQLPA---  329

Query  188  iFSDNQDQGLID-LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                  D  L+D + E+ D  S+ +      WA++R++ VM    G G VYYGI L    
Sbjct  330  ------DLSLVDPIPERNDQTSSSEKFWKTKWAVKRIILVMMAGFGSGFVYYGIQLNAEN  383

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL--  538
            + FNLYL+  +NA+ E PA  +   L+  + RR        L+GV  L C V     +  
Sbjct  384  LNFNLYLTVAVNALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGVACLLCAVLSLHRVIR  443

Query  539  -----KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
                 K +Q+ +E V F  + TA++++ +Y++ELFPT VRN+AV++ RQA ++G + +PL
Sbjct  444  AVSIAKWLQLAVEAVGFMASSTAYDVMYVYSVELFPTNVRNTAVSLLRQAFMLGASAAPL  503

Query  704  LVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            LVALGR +   S+ VFG+ASVL  +  + L ET    L +T+ ++   E
Sbjct  504  LVALGRESAMMSFIVFGVASVLSGVVSIWLRETRNAPLYETLAQQGKAE  552



>ref|XP_002267247.1| PREDICTED: organic cation/carnitine transporter 1 [Vitis vinifera]
 emb|CBI35459.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 152/280 (54%), Gaps = 16/280 (6%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR +Y    +  + YS+++     ESPRWL +RG  Q+ V+ +   A    +      
Sbjct  228  SSWRNVYRIISLFPVSYSLLILPFVSESPRWLLVRGRGQEAVDVLNKFARLNGKKLPQNL  287

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
             +     + G +D   + D     K L + GWA +R++ VM    G+G VYYG+ L V  
Sbjct  288  RL----ANPGGVD---EGDAIKRKKSLWSTGWAAKRMVMVMLAGFGVGFVYYGVQLNVEN  340

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FNLYL+  +NA+ E+PA L+  +L+    RR        L+GV  + C+ F     + 
Sbjct  341  LSFNLYLTVAINAIMEIPAVLIGSVLLSFTNRRLLFSSSICLAGVACIVCIFFSEAGGRR  400

Query  545  V---------QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAIS  697
                      Q+ +E + F  A TAF++L IY +ELFPT VRN AV+M RQ++++G +I+
Sbjct  401  RREESRGSWPQLSIEAIGFMAASTAFDVLYIYCVELFPTNVRNFAVSMLRQSLMLGASIA  460

Query  698  PLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDL  817
            PLLV +GR +   S+ +FG+ S++  L  +SLPET    L
Sbjct  461  PLLVVVGRLSPARSFLIFGILSMVSGLLGMSLPETKNAPL  500



>ref|XP_010428233.1| PREDICTED: organic cation/carnitine transporter 1-like [Camelina 
sativa]
Length=536

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 155/289 (54%), Gaps = 17/289 (6%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY       + Y+V +   A ESPRWL ++G  ++ +  +K +A    +       
Sbjct  247  SWRNLYRIISFLPLGYAVCLLPFAYESPRWLLVKGRNKEAMVILKKLARRNGKQLPA---  303

Query  188  iFSDNQDQGLID-LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                  D  L+D + E+ D  S+ +      WA++R++ VM    G G VYYGI L    
Sbjct  304  ------DLSLVDPIPERNDQTSSSEKFWKTKWAVKRIILVMLAGFGSGFVYYGIQLNAEN  357

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL--  538
            + FNLYL+  +NA+ E PA  +   L+  + RR        L+GV  L C V     +  
Sbjct  358  LNFNLYLTVAVNALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGVACLLCAVLSLHRVIR  417

Query  539  -----KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
                 K +Q+ +E V F  + TA++++ +Y++ELFPT VRN+AV++ RQA ++G + +PL
Sbjct  418  AVSIAKWLQLAVEAVGFMASSTAYDVMYVYSVELFPTNVRNTAVSLLRQAFMLGASAAPL  477

Query  704  LVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            LVALGR +   S+ VFG+ASVL  +  + L ET    L +T+ ++   E
Sbjct  478  LVALGRESAMMSFIVFGVASVLSGVVSIWLRETRNAPLYETLAQQGKAE  526



>emb|CDX82092.1| BnaC02g21980D [Brassica napus]
Length=536

 Score =   147 bits (371),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 98/290 (34%), Positives = 157/290 (54%), Gaps = 18/290 (6%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY  T +  + Y+V +   A ESPRWL ++GL ++ +  +K +A    +       
Sbjct  247  SWRNLYRITSLLPLGYAVFLLPFAYESPRWLLVKGLNKEAMVVLKKLARRNGKQLPA---  303

Query  188  iFSDNQDQGLIDLDEQMD--LYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                  D  L+D  +  D   +S+ +      WA++R++ VM    G G VYYGI L   
Sbjct  304  ------DLSLVDPIQGRDDPTFSSSENFWRTKWAVKRIVMVMMAGFGTGFVYYGIQLNAE  357

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRR----STvvglgvlsgvcnlgcvvFVG  529
             + FNLYL+  +NA+ E PA  +   L+  + RR    ++    G+   +C +  +  V 
Sbjct  358  NLNFNLYLTVAVNALMEFPAIFIGSFLLGVMNRRPLFSNSSYLAGICCLLCAVLSLHRVT  417

Query  530  EEL---KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISP  700
              L   K +Q+ +E + F  + TA+++L +Y +ELFPT VRN AV++ RQA ++G + +P
Sbjct  418  RALPVSKWLQLAVEAIGFMASSTAYDVLYVYGVELFPTNVRNFAVSLLRQAFMLGASAAP  477

Query  701  LLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            LLVALGR +   S+ VFG+ASVL  +  + L ET    L +T+ ++   E
Sbjct  478  LLVALGRESAMMSFIVFGVASVLSGVVSIWLRETRNAPLYETLTQQGKAE  527



>ref|XP_011047773.1| PREDICTED: organic cation/carnitine transporter 1-like [Populus 
euphratica]
Length=547

 Score =   147 bits (371),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 161/299 (54%), Gaps = 23/299 (8%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP------PEtr  166
            ++WR LY    +  + YSV+ +    ESPRWL +RG +++ ++ +KT A       PE  
Sbjct  245  ANWRNLYRIISLLPLSYSVLFFPFVSESPRWLLVRGRSKEALDVLKTFAKRNGKTLPENL  304

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
            S    +      +++ L     +  L+          WA +R++TVM    G+G VYYG+
Sbjct  305  SLANPSEPEEGGENEALTKTCTKESLW-------RTKWAAKRMITVMIAGFGVGFVYYGV  357

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
             L V  + FNLY S  +NA+ E+PA +   +L+    RR        L+G+  L C++F 
Sbjct  358  QLNVENLNFNLYFSVGINALMEIPAIVFGTILLGLTSRRLLFSLSAFLAGISCLLCIIFA  417

Query  527  -GEELKAV---------QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAM  676
             G+ +K           Q+ +E + F  A  AF++L IY +ELFPT VRN A++ +R ++
Sbjct  418  HGKHVKKAEKSSAGSWAQLIIEGIGFMAASIAFDVLYIYCVELFPTNVRNFALSQSRLSL  477

Query  677  VVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            ++G +I+PLLVA GR +   S+ +FG+ S+   +  + LPET    L D++ ++E +E 
Sbjct  478  MLGASIAPLLVAAGRLSPSLSFLIFGILSIFSGVISLWLPETKNAPLYDSLKQQEEEEK  536



>ref|XP_006301012.1| hypothetical protein CARUB_v10021403mg [Capsella rubella]
 gb|EOA33910.1| hypothetical protein CARUB_v10021403mg [Capsella rubella]
Length=535

 Score =   146 bits (369),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 155/293 (53%), Gaps = 23/293 (8%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
             SWR LY       + Y+V +   A ESPRWL ++G  ++ +  +K +A           
Sbjct  245  KSWRNLYRIISFLPLGYAVCLLPFAYESPRWLLVKGRNKEAMVVLKKLA-----------  293

Query  185  tiFSDNQ---DQGLID-LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPL  352
               +  Q   D  L+D + E+ D  S+ +      WA++R++ VM    G G VYYGI L
Sbjct  294  -RLNGKQLPADLSLVDPIPERGDQTSSSEKFWKTKWAVKRIIMVMMAGFGSGFVYYGIQL  352

Query  353  GVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGE  532
                + FNLYL+  +NA+ E PA  +   L+  + RR        L+GV  L C V    
Sbjct  353  NAENLNFNLYLTVAVNALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGVACLLCAVLSIH  412

Query  533  EL-------KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGA  691
             +       K +Q+ +E V F  + TA+++L +Y +ELFPT VRN+AV++ RQA ++G +
Sbjct  413  RVIRAMSVAKWLQLAVEAVGFMASSTAYDVLYVYCVELFPTNVRNTAVSLLRQAFMLGAS  472

Query  692  ISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             +PLLVALGR +   S+ VFG+ASVL  +  + L ET    L +T+ ++   E
Sbjct  473  AAPLLVALGRESAMMSFIVFGVASVLSGVVSLWLRETRNAPLYETLAQQGKAE  525



>ref|XP_007021813.1| Organic cation/carnitine transporter 2, putative [Theobroma cacao]
 gb|EOY13338.1| Organic cation/carnitine transporter 2, putative [Theobroma cacao]
Length=421

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 90/282 (32%), Positives = 143/282 (51%), Gaps = 51/282 (18%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY  TGIP  +Y VI Y +  ESPRWL++ G T++ +  ++ M             
Sbjct  177  SWRVLYRCTGIPVFVYCVIAYHLVVESPRWLFMGGYTEEAITALRQM-------------  223

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
              S   D  LI+L +   L                                        +
Sbjct  224  --SQKTDWTLINLGQLPPLQRE-----------------------------------NTI  246

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV  547
             F+LYLS   N ++E+P  L+T  L+ K  R S+++   ++ G+  +     VG   +  
Sbjct  247  NFSLYLSAMFNGLTEMPLLLITFFLLKKCNRMSSLLSSSIIGGIGCILTW-LVGTGQRVP  305

Query  548  QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGN  727
            Q+ LE+ ++F  C A+ ILL+Y++ELFPTCVRN A     QA+V+GG + P+L+++ + N
Sbjct  306  QLMLELCSYFAICMAYGILLVYSIELFPTCVRNFATMAVGQAIVLGGVVCPVLISVAKEN  365

Query  728  RFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             F+SYG+FG   +   LF++ LPET G  L D+++++E  E+
Sbjct  366  HFFSYGLFGCIVLFPGLFVLCLPETKGKSLYDSMEDQERNES  407



>ref|NP_565059.2| organic cation/carnitine transporter1 [Arabidopsis thaliana]
 sp|Q9CAT6.1|OCT1_ARATH RecName: Full=Organic cation/carnitine transporter 1; Short=AtOCT1 
[Arabidopsis thaliana]
 gb|AAG52125.1|AC010556_7 putative transporter; 29320-27598 [Arabidopsis thaliana]
 gb|AAO00815.1| putative transporter [Arabidopsis thaliana]
 gb|AAP68333.1| At1g73220 [Arabidopsis thaliana]
 gb|AEE35431.1| organic cation/carnitine transporter1 [Arabidopsis thaliana]
Length=539

 Score =   146 bits (369),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 154/293 (53%), Gaps = 23/293 (8%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
             SWR LY       + Y+V +   A ESPRWL ++G  ++ +  +K +A           
Sbjct  249  KSWRNLYRIISFLPLGYAVCLLPFAYESPRWLLVKGRNKEAMVVLKKLA-----------  297

Query  185  tiFSDNQ---DQGLID-LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPL  352
               +  Q   D  L+D + E+ D  S+ +      WA++R++ VM    G G VYYGI L
Sbjct  298  -RLNGKQLPADLSLVDPIPERDDQTSSSEKFWKTKWAVKRIIMVMMAGFGSGFVYYGIQL  356

Query  353  GVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGE  532
                + FNLYL+  +NA+ E PA  +   L+  + RR        L+G   L C V    
Sbjct  357  NAENLNFNLYLTVAVNALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGFACLLCAVLSIH  416

Query  533  EL-------KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGA  691
             +       K +Q+ +E V F  + TA+++L +Y +ELFPT VRN+AV++ RQA ++G +
Sbjct  417  RVIRAISVAKWLQLAVEAVGFMASSTAYDVLYVYCVELFPTNVRNTAVSLLRQAFMLGAS  476

Query  692  ISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
             +PLLVALGR +   S+ VFG+ASVL  +  + L ET    L +T+ ++   E
Sbjct  477  AAPLLVALGRESAMMSFIVFGVASVLSGIVSLWLRETRNAPLYETLAQQGKAE  529



>ref|XP_002318335.2| sugar transporter family protein [Populus trichocarpa]
 gb|EEE96555.2| sugar transporter family protein [Populus trichocarpa]
Length=546

 Score =   146 bits (369),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 101/303 (33%), Positives = 161/303 (53%), Gaps = 24/303 (8%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP------PEtr  166
            ++WR LY    +  + YSV+ +    ESPRWL +RG +++ ++ +K  A       PE  
Sbjct  245  TNWRNLYKILSLLPLAYSVLFFPFVSESPRWLLVRGRSEEALDVLKNFARLNGKTLPENL  304

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
                 +      +++ L     +  L+          WA +R++TVM    G+G VYYG+
Sbjct  305  CLANPSAPGEGGENEALTKNCTEESLW-------RTKWAAKRMITVMIAGFGVGFVYYGV  357

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
             L +  + FNLY S  LNA+ E+PA ++  +L+    RR        L+G+  L C++F 
Sbjct  358  QLNIENLNFNLYFSVGLNALMEVPAVVIGTILLGLTGRRLLFSLSAFLAGISCLLCILFA  417

Query  527  -GEELKAV---------QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAM  676
             G+  K           Q+ +E + F  A  AF++L +Y +ELFPT VRN AV+ +RQA+
Sbjct  418  HGKRAKKADKSSTGNWAQLAIEGIGFMAASVAFDVLYVYCVELFPTNVRNFAVSQSRQAL  477

Query  677  VVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENG  856
            ++G +I+PLLVA GR +   S+ VFG+ S+   +    LPET    L DT+ ++E  E  
Sbjct  478  MLGASIAPLLVAAGRLSPSLSFLVFGILSIFSGVISWWLPETRNAPLYDTLKQQEEDEK-  536

Query  857  NRV  865
            N+V
Sbjct  537  NKV  539



>ref|XP_002887477.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63736.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=528

 Score =   146 bits (368),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 100/289 (35%), Positives = 154/289 (53%), Gaps = 17/289 (6%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY       + Y+V +   A ESPRWL ++G  ++ +  +K +A    +       
Sbjct  239  SWRNLYRIISFLPLGYAVCLLPFAYESPRWLLVKGRNKEAMVVLKKLARLNGKQLPA---  295

Query  188  iFSDNQDQGLID-LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                  D  L+D + E+ D  S+ +      WA++R++ VM    G G VYYGI L    
Sbjct  296  ------DLSLVDPIPERDDQTSSSEKFWKTKWAVKRIIMVMMAGFGSGFVYYGIQLNAEN  349

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL--  538
            + FNLYL+  +NA+ E PA  +   L+  + RR        L+GV  L C V     +  
Sbjct  350  LNFNLYLTVAVNALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGVACLLCAVLSIHRVIR  409

Query  539  -----KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
                 K +Q+ +E V F  + TA+++L +Y +ELFPT VRN+AV++ RQA ++G + +PL
Sbjct  410  AISVAKWLQLAVEAVGFMASSTAYDVLYVYCVELFPTNVRNTAVSLLRQAFMLGASAAPL  469

Query  704  LVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            LVALGR +   S+ VFG+ASVL  +  + L ET    L +T+ ++   E
Sbjct  470  LVALGRESAMMSFIVFGVASVLSGVVSLWLRETRNAPLYETLAQQGKAE  518



>ref|XP_010910050.1| PREDICTED: organic cation/carnitine transporter 1 [Elaeis guineensis]
Length=521

 Score =   145 bits (367),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 95/287 (33%), Positives = 158/287 (55%), Gaps = 13/287 (5%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            + WR +Y    +  + YS+++  +  ESPRWL ++G T++ ++ +   A    R      
Sbjct  231  TQWRNIYKAISLLPLAYSLLILPLISESPRWLAVKGRTEEALDVLTKFAKLNGRKLPQNI  290

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            +  S   D    +++    L+SA        WA++R+ T M    G+G VYYG+ L V  
Sbjct  291  S-ISSPIDAKTSNVERNESLWSAR-------WAIKRIATAMMAGFGVGFVYYGVQLNVEN  342

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FNLY +  +NA+ E+PA L+  +L+    RR        ++G+  + CV+F  +E K+
Sbjct  343  LNFNLYFTVAVNALMEIPAVLLGSVLLSFTDRRILFSLSAYIAGISCILCVLF-NKEAKS  401

Query  545  ----VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
                 Q+ +E + F  A  AF++L +Y +ELFPT VRN AV+M RQA+++G AI+P LV 
Sbjct  402  KGSWSQLTVEAIGFMAASMAFDVLYVYCVELFPTNVRNFAVSMLRQALMLGAAIAPQLVV  461

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            LGR +   S+ +FG  ++   L    LPET    L +T++++E +E 
Sbjct  462  LGRLSPSISFLIFGSFAIFSGLLTFWLPETRNAPLYETLEQQEKEEK  508



>ref|XP_006374264.1| sugar transporter family protein [Populus trichocarpa]
 gb|ERP52061.1| sugar transporter family protein [Populus trichocarpa]
Length=562

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 162/299 (54%), Gaps = 23/299 (8%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP------PEtr  166
            ++WR LY    +  + YSV+ +    ESPRWL +RG +++ ++ +KT A       PE  
Sbjct  260  ANWRNLYRIISLLPLSYSVLFFPFVSESPRWLLVRGRSKEALDVLKTFARRNGKTLPENL  319

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
            S +  +      +++ L     +  L+          WA +R++TVM    G+G VYYG+
Sbjct  320  SLLNPSEPKEGGENEALTKTCTKESLW-------RTKWAAKRMITVMIAGFGVGFVYYGV  372

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
             L V  + FNLY S  +NA+ E+PA +   +L+    RR        L+G+  L C++F 
Sbjct  373  QLNVENLNFNLYFSVGINALMEIPAIVFGTILLGLTSRRLLFSLSAFLAGISCLLCIIFA  432

Query  527  -GEELKAV---------QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAM  676
             G+ +K           Q+ +E + F  A  AF++L IY +ELFPT VRN A++ +R ++
Sbjct  433  HGKHVKKAEKSSAGSWAQLIIEGIGFMAASIAFDVLYIYCVELFPTNVRNFALSQSRLSL  492

Query  677  VVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            ++G +I+PLLVA GR +   S+ +FG+ S+   +  + LPET    L D++ ++E +E 
Sbjct  493  MLGASIAPLLVAAGRLSPSLSFLIFGILSIFSGVVSLWLPETKNAPLYDSLKQQEEEEK  551



>ref|XP_010694556.1| PREDICTED: organic cation/carnitine transporter 1 [Beta vulgaris 
subsp. vulgaris]
Length=530

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/287 (34%), Positives = 150/287 (52%), Gaps = 14/287 (5%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR L+    +   +Y +I+     ESPRWL ++G   +   +I T         I   
Sbjct  236  SSWRSLHRILSLQVFLYCIIILPFVVESPRWLLIKGRKTE-AHSILTKLATRNGKKIPDH  294

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
               +D       + ++QM L+          WA  R+   M    G+G VYYG+ L V  
Sbjct  295  VELTDPSLSN--EQNKQMRLWQC-------KWARIRMWKAMIAGFGVGFVYYGVQLNVEN  345

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV----GE  532
            + F+ YLS  +NA+ E+P+  +   L+  ++RR  +     ++G     CV F     G 
Sbjct  346  LNFSKYLSVVINALLEIPSVFIGGYLLGFMKRRLLLSLSCFIAGSSCFLCVAFTRGKGGT  405

Query  533  ELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVA  712
                +Q+G+E + F  A  AF+I+ IY +ELFPT VRN AV++ RQA+V+GGA++PLLVA
Sbjct  406  LWNWIQLGIEGIGFMAASVAFDIMFIYCVELFPTNVRNFAVSLMRQALVLGGAVAPLLVA  465

Query  713  LGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             GR +  +S+ V G +S+L  L    LPET    L +T+++ E +E 
Sbjct  466  AGRLSPTFSFLVIGTSSILSGLMSFWLPETKNAPLFETLEQHEMEEK  512



>ref|XP_009409152.1| PREDICTED: organic cation/carnitine transporter 1 [Musa acuminata 
subsp. malaccensis]
Length=534

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 92/291 (32%), Positives = 154/291 (53%), Gaps = 20/291 (7%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y    +  ++YS+++     ESPRWL ++G T + ++ +   A           
Sbjct  240  TSWRTIYKVISLLPLVYSILIIPFVSESPRWLAVKGRTGEALDVLTKFAK----------  289

Query  185  tiFSDNQDQGLIDLDEQMDLY--SALK--LLINKGWALRRLLTVMWVALGIGLVYYGIPL  352
               + ++  G I +   +D    SA K   L +  WA RR+ T+M     +G VYYG  L
Sbjct  290  --LNGSKLPGNIAISNPIDTNAGSATKPESLWSSRWATRRIATIMVTGFAVGFVYYGFQL  347

Query  353  GVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGE  532
             V  + FNLY +  +NA+ E+PA  +  + +    RR+       ++GV  + C++F  +
Sbjct  348  NVENLNFNLYFTVGVNALMEIPAVFIGSVFLSFANRRTLFSSSAFVAGVSCILCILFTKK  407

Query  533  ELKA----VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISP  700
                     Q+  E V F  A T F++L +Y +ELFP  VRN AV+  RQ++++G AI+P
Sbjct  408  PTTRGGNFAQLSAESVGFMAASTVFDVLYVYCVELFPANVRNLAVSKLRQSLMLGAAIAP  467

Query  701  LLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             LV LGR + + S+ +FG  S+   L  + LPET    +C+T++++E +E 
Sbjct  468  HLVTLGRLSPWISFLIFGGLSIFGGLMTIWLPETRNAPVCETLEQQEKQEK  518



>emb|CDX72965.1| BnaC06g34130D [Brassica napus]
Length=537

 Score =   144 bits (364),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 97/289 (34%), Positives = 156/289 (54%), Gaps = 17/289 (6%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY    +  + Y++ +   A ESPRWL ++G  ++ +  +K +A    +       
Sbjct  249  SWRNLYRIISVLPLGYALFLLPFAYESPRWLLVKGRNKEAMVVLKKLARLNGKQLPA---  305

Query  188  iFSDNQDQGLID-LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                  +  L+D ++ + D  S+ +      WA++R++ VM    G G VYYGI L    
Sbjct  306  ------ELSLVDPIEGRDDQTSSSENFWKTKWAVKRIVMVMMAGFGSGFVYYGIQLNAEN  359

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL--  538
            + FNLYL+  +NA+ E PA  +   L+  + RR        L+G+  L C V   + +  
Sbjct  360  LNFNLYLTVAVNAMMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGISCLLCAVLSLQRVTK  419

Query  539  -----KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
                 K +Q+ +E V F  + TA+++L +Y +ELFPT VRN AV++ RQA ++G + +PL
Sbjct  420  AMPVAKWLQLAVEAVGFMASSTAYDVLYVYAVELFPTNVRNFAVSLLRQAFMLGASAAPL  479

Query  704  LVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            LVALGR +   S+ VFG+ASVL  +  + L ET    L +T+ ++E  E
Sbjct  480  LVALGRESAMMSFIVFGVASVLSGVVSLWLRETRNAPLYETLRQQEKAE  528



>ref|XP_011072052.1| PREDICTED: organic cation/carnitine transporter 1 isoform X2 
[Sesamum indicum]
Length=524

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 154/288 (53%), Gaps = 13/288 (5%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYL-VARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            + WR LY       ++YS+ + L    ESPRWL  RG +++ +E +K  A    +     
Sbjct  204  TCWRNLYKIISFIPLVYSIFILLPFVSESPRWLLRRGRSEEALEVLKRYARINGKELPLN  263

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             ++   + ++  +   E  +  S ++ L N  WA +R+  VM    GIG VYYG+ L V 
Sbjct  264  ISLLEPSGNEKNLAAGEGENNTSTIEKLWNTRWAAKRMSMVMLTGFGIGFVYYGVQLNVE  323

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLY +  +NA+ E+PA  +  +L+  + RR       VL+G+  + C++F   E K
Sbjct  324  NLNFNLYFAVAINAMMEIPAVFIGSVLLSFMNRRLLFSSSAVLAGISCISCIIFSSTEDK  383

Query  542  AV------------QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVG  685
             V            Q+ +E + F    TAF++L IY +ELFPT VRN AV+M RQ +++G
Sbjct  384  NVDKLSMTERGSLPQLMIEALGFMAVSTAFDVLYIYCVELFPTNVRNFAVSMLRQTLMLG  443

Query  686  GAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
             ++S L+V  GR +   S+ VFG+ S++   F + LPET    L +T+
Sbjct  444  ASVSSLVVVFGRLSPSVSFLVFGVLSIVSGFFSMWLPETRNFPLYETL  491



>ref|XP_011072051.1| PREDICTED: organic cation/carnitine transporter 1 isoform X1 
[Sesamum indicum]
Length=557

 Score =   144 bits (363),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 154/288 (53%), Gaps = 13/288 (5%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYL-VARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            + WR LY       ++YS+ + L    ESPRWL  RG +++ +E +K  A    +     
Sbjct  237  TCWRNLYKIISFIPLVYSIFILLPFVSESPRWLLRRGRSEEALEVLKRYARINGKELPLN  296

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             ++   + ++  +   E  +  S ++ L N  WA +R+  VM    GIG VYYG+ L V 
Sbjct  297  ISLLEPSGNEKNLAAGEGENNTSTIEKLWNTRWAAKRMSMVMLTGFGIGFVYYGVQLNVE  356

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELK  541
             + FNLY +  +NA+ E+PA  +  +L+  + RR       VL+G+  + C++F   E K
Sbjct  357  NLNFNLYFAVAINAMMEIPAVFIGSVLLSFMNRRLLFSSSAVLAGISCISCIIFSSTEDK  416

Query  542  AV------------QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVG  685
             V            Q+ +E + F    TAF++L IY +ELFPT VRN AV+M RQ +++G
Sbjct  417  NVDKLSMTERGSLPQLMIEALGFMAVSTAFDVLYIYCVELFPTNVRNFAVSMLRQTLMLG  476

Query  686  GAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
             ++S L+V  GR +   S+ VFG+ S++   F + LPET    L +T+
Sbjct  477  ASVSSLVVVFGRLSPSVSFLVFGVLSIVSGFFSMWLPETRNFPLYETL  524



>emb|CDY33334.1| BnaC05g12490D [Brassica napus]
Length=207

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 116/182 (64%), Gaps = 0/182 (0%)
 Frame = +2

Query  311  VALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvl  490
            +  G+G+ YYG+PL   ++  N+YLS TLNAV ELP+ ++T ++++++ RRS+V+   +L
Sbjct  20   ILFGLGISYYGVPLAARDIDVNIYLSETLNAVVELPSFVITPIILERVNRRSSVLVNTLL  79

Query  491  sgvcnlgcvvFVGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQ  670
             G   + C V        +    E+  FF A   FN++ +Y +E+FPTCVR+SA  M RQ
Sbjct  80   GGASGVLCFVLSVLGKTGIAFAFELATFFCARIGFNLMAVYMVEMFPTCVRSSATMMFRQ  139

Query  671  AMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            A+VVGGA  PL+ ++GR     S+ +FG+A     LF++ LPET G  LCDT++E+E ++
Sbjct  140  ALVVGGACCPLIASIGRDLPSVSFAIFGVAMSGLGLFVLILPETKGSSLCDTMEEQEKRD  199

Query  851  NG  856
              
Sbjct  200  QA  201



>ref|XP_009105974.1| PREDICTED: organic cation/carnitine transporter 1 [Brassica rapa]
 emb|CDX96456.1| BnaA07g30670D [Brassica napus]
Length=537

 Score =   144 bits (362),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 155/289 (54%), Gaps = 17/289 (6%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY    +  + Y++ +   A ESPRWL ++G  ++ +  +K +A    +       
Sbjct  249  SWRNLYRIISVLPLGYALFLLPFAYESPRWLLVKGRNKEAMVVLKKLARLNGKQLPA---  305

Query  188  iFSDNQDQGLID-LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                  +  L+D +  + D  S+ +      WA++R++ VM    G G VYYGI L    
Sbjct  306  ------ELSLVDPIQGRDDQTSSSENFWKTKWAVKRIVMVMMAGFGSGFVYYGIQLNAEN  359

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL--  538
            + FNLYL+  +NA+ E PA  +   L+  + RR        L+G+  L C +   + +  
Sbjct  360  LNFNLYLTVAVNAMMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGISCLLCAILSLQRVTK  419

Query  539  -----KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
                 K +Q+ +E V F  + TA+++L +Y +ELFPT VRN AV++ RQA ++G + +PL
Sbjct  420  AMPVAKWLQLAVEAVGFMASSTAYDVLYVYAVELFPTNVRNFAVSLLRQAFMLGASAAPL  479

Query  704  LVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            LVALGR +   S+ VFG+ASVL  +  + L ET    L +T+ ++E  E
Sbjct  480  LVALGRESAMMSFIVFGVASVLSGVVSLWLRETRNAPLYETLRQQEKAE  528



>gb|KFK41759.1| hypothetical protein AALP_AA2G168500 [Arabis alpina]
Length=539

 Score =   143 bits (360),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 158/294 (54%), Gaps = 18/294 (6%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY       + Y++++   A ESPRWL ++G  ++ +  +K +A    +       
Sbjct  251  SWRNLYRIISYLPLAYALLLLPFAYESPRWLLVKGRNKEAMVVLKKLARLNGKQLPA---  307

Query  188  iFSDNQDQGLID-LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
                  D  L+D +  + D  S  +      WA++R++ VM    G G VYYGI L    
Sbjct  308  ------DLSLVDPIPTRDDQTSQQEKFWKTKWAVKRVVMVMMAGFGCGFVYYGIQLNAEN  361

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL--  538
            + FNLYL+  +NA+ E PA  +   L+  + RR        L+G+  L C V     +  
Sbjct  362  LNFNLYLTVAVNALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGISCLLCAVLSLNRVTR  421

Query  539  -----KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
                 K +Q+ +E V F  + TA+++L +Y +ELFPT VRN AV++ RQA ++G + +PL
Sbjct  422  AVSVAKWLQLAVEAVGFMASSTAYDVLYVYCVELFPTNVRNFAVSLLRQAFMLGASAAPL  481

Query  704  LVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEE-ESKENGNR  862
            LVALGR N   S+ VFG+ASVL  +  + L ET    L +T+ ++ +++E GNR
Sbjct  482  LVALGRENAMMSFLVFGIASVLSGVVSLWLTETRDAPLYETLTQQGKAEEIGNR  535



>ref|XP_003534097.1| PREDICTED: organic cation/carnitine transporter 1-like [Glycine 
max]
 gb|KHN23600.1| Organic cation/carnitine transporter 1 [Glycine soja]
Length=543

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 154/300 (51%), Gaps = 11/300 (4%)
 Frame = +2

Query  11   WRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtti  190
            WR LY    +  + YSV++  +  ESPRWL +RG +++ ++ +   A    +  +     
Sbjct  239  WRNLYKLLSLLPLAYSVLLLPLVSESPRWLLIRGRSKEALQVLDKFARLNGKKKLPDNLS  298

Query  191  FSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMP  370
              +       + DE     +   L   K WA  R++TVM    G+G VYYG+ L V  + 
Sbjct  299  LVNPCGSQNGESDETSPNNNKENLWTTK-WAAIRMVTVMLSGFGVGFVYYGVQLNVENLN  357

Query  371  FNLYLSTTLNAVSELPASLVTLLLIDKLRRRS--TvvglgvlsgvcnlgcvvFVGEELKA  544
            FNLY+S  +NA+ E+PA ++   L+    RR   ++              +   G   K 
Sbjct  358  FNLYVSVAINALMEIPAVVIGTFLLGFTNRRLLLSMSSYIAAVSSILCTFLSHKGSTSKV  417

Query  545  V--------QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISP  700
                     Q+ +E + F  A TAF+IL IY +ELFPT VRN AV+M RQA+++G +++P
Sbjct  418  HNNNSGNWGQLIIEAIGFMGASTAFDILYIYCVELFPTNVRNFAVSMLRQALMLGASVAP  477

Query  701  LLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKENGNRV*TLNC  880
            LLV LGR +   S+ VFG+ ++   +  + LPET    L +T+ ++E +E  N V   +C
Sbjct  478  LLVVLGRLSPSISFLVFGVLAISSGVLSICLPETRNAPLYETLKQQEEEEKHNWVSHNDC  537



>ref|XP_006832993.1| hypothetical protein AMTR_s01775p00001430 [Amborella trichopoda]
 gb|ERM98271.1| hypothetical protein AMTR_s01775p00001430 [Amborella trichopoda]
Length=125

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +2

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
            G+     Q+G EIVAFF+ CTAFNILLIY LELFPT VRNSA+++ RQA V  G  SPLL
Sbjct  12   GDIKNGSQLGAEIVAFFSCCTAFNILLIYCLELFPTSVRNSALSLLRQATVFAGVFSPLL  71

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            VALGR N F+S+GVFGL  + C +F + LPET G  LCDT++E+E +E
Sbjct  72   VALGRENAFWSFGVFGLVIICCGMFSLLLPETRGRPLCDTMEEQECEE  119



>gb|AET02317.2| organic cation/carnitine transporter, putative [Medicago truncatula]
Length=490

 Score =   140 bits (354),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 98/288 (34%), Positives = 154/288 (53%), Gaps = 49/288 (17%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
             SSW+ LY+++ +P I          RE           ++ ++ +K ++  E+      
Sbjct  229  NSSWKSLYIWSSVPAI---------CRE-----------KEILKMLKRVSSEESADDD--  266

Query  182  ttiFSDNQDQGLIDLDEQ-----MDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGI  346
                S N    L  L  +       LYS++  L +K WA+ R++ VM + +G+G+VY  +
Sbjct  267  ----SVNLASNLPKLPPKEKVSFFQLYSSIGELFHKRWAVIRMIAVMILGIGLGMVYLVV  322

Query  347  PLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFV  526
                             +A  ELP+ + T  L + LRR+ +++   +L G+C + C V +
Sbjct  323  ----------------FSASMELPSCVATYFL-ENLRRKPSILVFSILGGICCVKCAV-L  364

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
               + A ++ L +VAFF ACTA+N+ LIY +ELFPTCVRN+  ++ RQA+V G    P L
Sbjct  365  ENRVPAAKVVLAMVAFFGACTAYNVFLIYIIELFPTCVRNTTTSLVRQAIVFGCIFCPFL  424

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            ++ GR N  YSYGVFG+  +L    L  LPET+G  LCDT+D++E KE
Sbjct  425  ISAGRKNNIYSYGVFGVVIMLSNFTLFFLPETIGIVLCDTMDQQEKKE  472



>ref|XP_007152580.1| hypothetical protein PHAVU_004G142000g [Phaseolus vulgaris]
 gb|AAO83155.1|AF402773_1 putative organic cation transport protein [Phaseolus vulgaris]
 gb|ESW24574.1| hypothetical protein PHAVU_004G142000g [Phaseolus vulgaris]
Length=547

 Score =   140 bits (354),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 100/313 (32%), Positives = 162/313 (52%), Gaps = 28/313 (9%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            + WR LY    +  + YSV++  +  ESPRWL +RG T++ ++ +   A    +  +   
Sbjct  236  THWRSLYKLLSLLPLAYSVLILPLVSESPRWLLIRGRTKEALQVLDRFARLNGKQKLPTN  295

Query  185  tiFSD-----------NQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGL  331
               ++             + G    + + +L++         WA  R++TVM    G+G 
Sbjct  296  LTLTNPSGSSNVAPCTTSEGGERTPNNKENLWTT-------KWAAIRMVTVMLAGFGVGF  348

Query  332  VYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlg  511
            VYYG+ L V  + FNLY+S  LNA+ E+PA ++   L+    RR  +     ++ V ++ 
Sbjct  349  VYYGVQLNVENLNFNLYVSVALNALMEIPAVVIGTFLLGFTNRRLLLSVSSYIAAVSSIL  408

Query  512  cvvFV--GEELKA--------VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAM  661
            C  F   G+  K          Q+ +E + F  A T F+IL IY +ELFPT VRN AV+M
Sbjct  409  CTFFSHRGKTSKVHSNHGGSWAQLIIEAIGFMGASTTFDILYIYCVELFPTNVRNFAVSM  468

Query  662  ARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEE  841
             RQA+++G +++PLLV LGR +   S+ VFG  S+   +  + LPET    L +T+ ++E
Sbjct  469  LRQAIMLGASVAPLLVVLGRLSPSLSFFVFGAFSISSGVLSLWLPETRNAPLYETLKQQE  528

Query  842  SKENGNRV*TLNC  880
             +E  N V   +C
Sbjct  529  EEEKHNWVSHNDC  541



>ref|XP_006848005.1| hypothetical protein AMTR_s00029p00167630 [Amborella trichopoda]
 gb|ERN09586.1| hypothetical protein AMTR_s00029p00167630 [Amborella trichopoda]
Length=519

 Score =   140 bits (354),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 94/289 (33%), Positives = 155/289 (54%), Gaps = 17/289 (6%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR +Y    +  ++Y + ++    ESPRWL LR   ++ ++ +  +A    +      
Sbjct  226  NSWRNIYRSISLLPLLYCLFIFPSISESPRWLSLRERKEEAMQVLTKLAQSNGKKIPKNL  285

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            TI + +  Q         +L+S+        WA +R+  VM V LG+G VYYG+ L    
Sbjct  286  TISNPSCTQ---PGSRTCNLWSS-------KWARKRMALVMAVGLGVGFVYYGVQLNAQN  335

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKA  544
            + FNLY +  LNA+ E+PA  +  +L+  + RR       +++G+    CV+   +  K 
Sbjct  336  LYFNLYFTVALNALMEIPAVFLGSVLLSCMDRRVLFSLSAIIAGISCFLCVILSRDRQKN  395

Query  545  -------VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
                    Q+ +E + F    TAF+++ IY +ELFPT VRN AV+M RQA++ G +++P+
Sbjct  396  KDQAGNWSQLSVESIGFMCISTAFDVMYIYCVELFPTSVRNFAVSMLRQALMFGASMAPM  455

Query  704  LVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            LVA GR + F SY VFG   +   +F   LPET    L +T++++E +E
Sbjct  456  LVAQGRLSPFVSYLVFGGVGIFSGIFGSWLPETRNRPLYETLEQQEHEE  504



>ref|XP_006390577.1| hypothetical protein EUTSA_v10018374mg [Eutrema salsugineum]
 gb|ESQ27863.1| hypothetical protein EUTSA_v10018374mg [Eutrema salsugineum]
Length=537

 Score =   140 bits (353),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 158/294 (54%), Gaps = 18/294 (6%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            +SWR LY       + Y++++   A ESPRWL ++G  ++ +  +K +A    +      
Sbjct  248  NSWRNLYRIISFLPLGYALLLLPFAYESPRWLLVKGRNKEAMVVLKKLARLNGKQLPA--  305

Query  185  tiFSDNQDQGLID-LDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
                   D  L+D +  + D  S+ +      WA++R+L VM    G G VYYGI L   
Sbjct  306  -------DLSLVDPIPTRDDQTSSPESFWKTKWAVKRVLMVMMAGFGSGFVYYGIQLNAE  358

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL-  538
             + FNLYL+  +NA+ E PA  +   L+  + RR        L+G+  L C V     + 
Sbjct  359  NLNFNLYLTVAVNALMEFPAVFIGSFLLGVMNRRPLFSNSSYLAGISCLLCAVLSLHRVT  418

Query  539  ------KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISP  700
                  K +Q+ +E   F  + TA+++L +Y +ELFPT VRN AV++ RQA ++G + +P
Sbjct  419  RAISVAKWLQLAVEAFGFMASSTAYDVLYVYCVELFPTNVRNFAVSLLRQAFMLGASAAP  478

Query  701  LLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEE-ESKENGN  859
            LLVALGR N   S+ VFG+ASVL  +  + L ET    L +T+ ++ +++E GN
Sbjct  479  LLVALGRDNAMMSFLVFGVASVLSGVVSLWLRETRNAPLYETLTQQGKAEEMGN  532



>ref|XP_006466118.1| PREDICTED: organic cation/carnitine transporter 1-like [Citrus 
sinensis]
Length=574

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/307 (31%), Positives = 153/307 (50%), Gaps = 40/307 (13%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIK--------------  142
            +SWR LY    +    Y+ ++     ESPRWL + G + + ++ +K              
Sbjct  269  TSWRTLYKILSLFPFCYATLLLPFVSESPRWLLVMGRSGEALDELKKFARLNGKKLPTNL  328

Query  143  TMAPPEtrssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALG  322
            T+A P    + +     SDN+++ L                    WA +RL+ VM    G
Sbjct  329  TLANPSAAKTGSNN---SDNKNESLWGTK----------------WAAKRLIMVMTAGFG  369

Query  323  IGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvc  502
            +G VYYGI L VG + FNLY S  LNA+ E+PA ++  + +    RR  +     ++G  
Sbjct  370  VGFVYYGIQLNVGNLNFNLYFSVALNALMEIPAVVIGTVFLSFTNRRLLLSRSAYVAGSA  429

Query  503  nlgcvvFVGEELKAV-------QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAM  661
            ++ C +F               Q+ +E V F  A TAF+++ IY +ELFPT VRN AV+ 
Sbjct  430  SILCTLFSNNNNNKGKGGGSWPQLIIEGVGFMAASTAFDVMYIYCVELFPTNVRNIAVSF  489

Query  662  ARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEE  841
             RQA+++G ++SPLLV +GR +   S+ VFG  S+   +  + LPET    L +T+ ++ 
Sbjct  490  LRQALMLGASVSPLLVVVGRMSPSLSFLVFGALSIFSGVLSLWLPETKNAPLYETLKQQG  549

Query  842  SKENGNR  862
             +E   +
Sbjct  550  EEEEKQK  556



>emb|CDY65092.1| BnaAnng20110D [Brassica napus]
Length=536

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 150/288 (52%), Gaps = 14/288 (5%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY  T +  + Y+V +   A ESPRWL ++G  ++ +  +K +A    +      +
Sbjct  247  SWRNLYRITSLLPLGYAVFLLPFAYESPRWLLVKGRNKEAMVVLKKLARRNGKQLPADLS  306

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
            +   N  QG  D        S+ K    K WA++R++ VM    G G VYYGI L    +
Sbjct  307  LV--NPIQGRDDRASS----SSEKFWRTK-WAVKRIVIVMMAGFGTGFVYYGIQLNAENL  359

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvF-------V  526
             FNLYL+  +NA+ E PA  V   L+  + RR        L+G   L C V        V
Sbjct  360  NFNLYLTVAVNALMEFPAVFVGSFLLGVMNRRPLFSISSYLAGTACLLCAVLSLHCVTTV  419

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
                K +Q+ +E V F  + TA+++L +Y +ELFPT VRN AV++  QA ++G + +PLL
Sbjct  420  LPATKWLQLAVEAVGFMASSTAYDVLYVYGVELFPTNVRNFAVSLLCQAFMLGASAAPLL  479

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            VALGR N   S+ V G ASVL  +  + L ET    L +T+ ++   E
Sbjct  480  VALGRENAMMSFIVIGAASVLSGVVSLWLKETRNAPLYETLTQQGKAE  527



>ref|XP_010932380.1| PREDICTED: organic cation/carnitine transporter 2-like [Elaeis 
guineensis]
Length=394

 Score =   137 bits (345),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = +2

Query  2    GSSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitr  181
            GSSWR LYL+T +P   YS+++Y + +ESPRWL +RG  ++ V  +K +A        + 
Sbjct  232  GSSWRTLYLWTSVPSFCYSILLYFLVQESPRWLLVRGRREEAVHILKNIAASNGNVITSS  291

Query  182  ttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
             +     +D       E + +++A+K+L  K WA RRL+ +M VA G+G+VYYG+PL VG
Sbjct  292  FSTLVTPEDV------ENVGIFTAMKILWEKRWAFRRLIAIMTVAFGVGMVYYGMPLNVG  345

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRST  469
             +  N+YLS T NA++ELP+SL+T   I+   RRS+
Sbjct  346  NLTSNIYLSVTYNALAELPSSLITFFCIENFNRRSS  381



>ref|XP_009127984.1| PREDICTED: organic cation/carnitine transporter 1-like [Brassica 
rapa]
Length=568

 Score =   138 bits (347),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 149/288 (52%), Gaps = 14/288 (5%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY  T +  + Y+V +   A ESPRWL ++G  ++ +  +K +A    +      +
Sbjct  279  SWRNLYRITSLLPLGYAVFLLPFAYESPRWLLVKGRNKEAMVVLKKLARRNGKQLPADLS  338

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
            +   N  QG  D        S+ K    K WA++R++ VM    G G VYYGI L    +
Sbjct  339  LV--NPIQGRDDRASS----SSEKFWRTK-WAVKRIVIVMMAGFGTGFVYYGIQLNAENL  391

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvF-------V  526
             FNLYL+  +NA+ E PA  V   L+  + RR        L+G   L C V        V
Sbjct  392  NFNLYLTVAVNALMEFPAVFVGSFLLGVMNRRPLFSISSYLAGTACLLCAVLSLHCVTTV  451

Query  527  GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLL  706
                K +Q+ +E V F  + TA+++L +Y +ELFPT VRN AV++  QA ++G   +PLL
Sbjct  452  LPATKWLQLAVEAVGFMASSTAYDVLYVYGVELFPTNVRNFAVSLLCQAFMLGACAAPLL  511

Query  707  VALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
            VALGR N   S+ V G ASVL  +  + L ET    L +T+ ++   E
Sbjct  512  VALGRENAMMSFIVIGAASVLSGVVSLWLKETRNAPLYETLTQQGKAE  559



>ref|XP_006441384.1| hypothetical protein CICLE_v10019486mg [Citrus clementina]
 gb|ESR54624.1| hypothetical protein CICLE_v10019486mg [Citrus clementina]
Length=573

 Score =   136 bits (342),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/295 (33%), Positives = 148/295 (50%), Gaps = 39/295 (13%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIK--------------  142
            +SWR LY    +    Y+ ++     ESPRWL + G + + ++ +K              
Sbjct  269  TSWRTLYKILSLFPFCYATLLLPFVSESPRWLLVMGRSGEALDVLKKFARLNGKKLPTNL  328

Query  143  TMAPPEtrssitrttiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALG  322
            T+A P    + +     SDN+++ L                    WA +RL+ VM    G
Sbjct  329  TLANPSAAKTGSNN---SDNKNESLWGTK----------------WAAKRLIMVMAAGFG  369

Query  323  IGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvc  502
            +G VYYGI L V  + FNLY S  LNA+ E+PA ++  +L+    RR        ++G  
Sbjct  370  VGFVYYGIQLNVENLNFNLYFSVALNALMEIPAVVIGTVLLSFTNRRLLFSRSAYVAGSA  429

Query  503  nlgcvvFVGEELKAV------QIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMA  664
            ++ C +F     K        Q+ +E V F  A TAF+++ IY +ELFPT VRN AV+  
Sbjct  430  SILCTLFSNNNNKEKGGGSWPQLIIEGVGFMAASTAFDVMYIYCVELFPTNVRNIAVSFL  489

Query  665  RQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI  829
            RQA+++G ++SPLLV +GR +   S+ VFG  S+   +  + LPET    L +T+
Sbjct  490  RQALMLGASVSPLLVVVGRMSPSLSFLVFGALSIFSGVLSLWLPETKNAPLYETL  544



>emb|CDX82089.1| BnaC02g22010D [Brassica napus]
Length=446

 Score =   133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 135/262 (52%), Gaps = 16/262 (6%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
             SWR LY  T +  + Y+V +   A ESPRWL ++G  ++ +  +K +A    +      
Sbjct  185  KSWRNLYRITSLLPLGYAVFLLPFAYESPRWLLVKGRNKEAMVVLKKLARRNGKQLPA--  242

Query  185  tiFSDNQDQGLIDLDEQMD--LYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGV  358
                   D  L+D  +  D    S+ +      WA++R++ VM    G G VYYGI L V
Sbjct  243  -------DLSLVDPIQGRDDRASSSSEKFWRTKWAVKRIVMVMMAGFGTGFVYYGIQLNV  295

Query  359  GEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRR-----STvvglgvlsgvcnlgcvvF  523
              + FNLY +  +NA+ E PA  V   L+  + RR     S+ +          L     
Sbjct  296  ENLNFNLYSTVAVNALMEFPAVFVGSFLLGVMNRRPLFSISSYLAGTACLLCAVLSLHRV  355

Query  524  VGEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
            V    K +Q+G+E   F  + TA+++L +Y +ELFPT VRN AV++  QA ++G + +PL
Sbjct  356  VLPATKWLQLGVEAFGFMASSTAYDVLYVYGVELFPTNVRNFAVSLLCQAFMLGASAAPL  415

Query  704  LVALGRGNRFYSYGVFGLASVL  769
            LVALGR N   S+ V G AS+L
Sbjct  416  LVALGRENAMMSFIVIGAASML  437



>ref|XP_006853447.1| hypothetical protein AMTR_s00032p00183130 [Amborella trichopoda]
 gb|ERN14914.1| hypothetical protein AMTR_s00032p00183130 [Amborella trichopoda]
Length=176

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 103/164 (63%), Gaps = 26/164 (16%)
 Frame = +2

Query  305  MWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglg  484
            M V  G GLVYYG+PLG G + FNL+LS T NA++E P++L++  LI +L RR  V+ L 
Sbjct  1    MVVGFGAGLVYYGMPLGAGNLDFNLHLSVTFNALAEFPSALLSFFLISRLNRRCAVITLS  60

Query  485  vlsgvcnlgcvvFVGEELKA-------------------------VQIGLEIVAFFTACT  589
            ++SGV ++ CV F+  E K                           Q+G EIVAFF+ CT
Sbjct  61   MVSGVLSILCV-FLSRERKGGLSLPRERMWDVLVSVERKGDIKNGSQMGAEIVAFFSCCT  119

Query  590  AFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            A NILL+Y LELFPT VRNSA+++ RQA+V  GA SPLLV LGR
Sbjct  120  ASNILLLYCLELFPTSVRNSALSLLRQAIVFAGAFSPLLVVLGR  163



>gb|KDO36826.1| hypothetical protein CISIN_1g045196mg [Citrus sinensis]
Length=255

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 116/201 (58%), Gaps = 10/201 (5%)
 Frame = +2

Query  278  WALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLR  457
            WA +RL+ VM    G+G VYYGI L VG + FNLY S  LNA+ E+PA ++  +L+    
Sbjct  36   WAAKRLIMVMTAGFGVGFVYYGIQLNVGNLNFNLYFSVALNALMEIPAVVIGTVLLSFTN  95

Query  458  RRSTvvglgvlsgvcnlgcvvFVGEELKAV-------QIGLEIVAFFTACTAFNILLIYT  616
            RR  +     ++G  ++ C +F               Q+ +E V F  A TAF+++ IY 
Sbjct  96   RRLLLSRSAYVAGSASILCTLFSNNNNNKGKGGGSWPQLIIEGVGFMAASTAFDVMYIYC  155

Query  617  LELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLP  796
            +ELFPT VRN AV+  RQA+++G ++SPLLV +GR +   S+ VFG  S+   +  + LP
Sbjct  156  VELFPTNVRNIAVSFLRQALMLGASVSPLLVVVGRMSPSLSFLVFGALSIFSGVLSLWLP  215

Query  797  ETLGGDLCDTID---EEESKE  850
            ET    L +T+    EEE K+
Sbjct  216  ETKNAPLYETLKQQGEEEEKQ  236



>gb|KHN24524.1| Organic cation/carnitine transporter 1 [Glycine soja]
Length=498

 Score =   129 bits (325),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 141/268 (53%), Gaps = 16/268 (6%)
 Frame = +2

Query  83   ESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLIDLDEQMDLYSALKL  262
            ESPRWL +RG  ++ ++ +   A    +  +       +         DE     +   L
Sbjct  219  ESPRWLLIRGRDKEALQVLDRFARLNGKKKLPNNLTLVNPCGS---SCDETSPKNNKENL  275

Query  263  LINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLL  442
               K WA  R++TVM    G+G VYYG+ L V  + FNLY+S  +NA+ E+PA ++   L
Sbjct  276  WTTK-WAAIRMVTVMLAGFGVGFVYYGVQLNVENLNFNLYVSVAINALMEIPAVVIGTFL  334

Query  443  IDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV------------QIGLEIVAFFTAC  586
            +    RR  +     ++ V ++ C  F  +   +             Q+ +E + F  A 
Sbjct  335  LGFTNRRLLLSVSSYIAAVSSILCTFFSHKGGTSKVHNNNSYGGNWGQLIIEAIGFMGAS  394

Query  587  TAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASV  766
            TAF+IL IY +ELFPT VRN AV+M RQA+++G +++PLLV LGR +   S+ VFG+ ++
Sbjct  395  TAFDILYIYCVELFPTNVRNFAVSMLRQAIMLGASVAPLLVVLGRLSPSLSFLVFGVFAI  454

Query  767  LCCLFLVSLPETLGGDLCDTIDEEESKE  850
               +  + LPET    L +T+ ++E +E
Sbjct  455  SSGVLSIWLPETRNAPLYETLKQQEEEE  482



>ref|XP_003548308.1| PREDICTED: organic cation/carnitine transporter 1-like isoformX1 
[Glycine max]
 ref|XP_006599715.1| PREDICTED: organic cation/carnitine transporter 1-like isoform 
X3 [Glycine max]
 ref|XP_006599716.1| PREDICTED: organic cation/carnitine transporter 1-like isoform 
X4 [Glycine max]
Length=540

 Score =   129 bits (324),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 141/268 (53%), Gaps = 16/268 (6%)
 Frame = +2

Query  83   ESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLIDLDEQMDLYSALKL  262
            ESPRWL +RG  ++ ++ +   A    +  +       +         DE     +   L
Sbjct  261  ESPRWLLIRGRDKEALQVLDRFARLNGKKKLPNNLTLVNPCGS---SCDETSPNNNKENL  317

Query  263  LINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLL  442
               K WA  R++TVM    G+G VYYG+ L V  + FNLY+S  +NA+ E+PA ++   L
Sbjct  318  WTTK-WAAIRMVTVMLAGFGVGFVYYGVQLNVENLNFNLYVSVAINALMEIPAVVIGTFL  376

Query  443  IDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV------------QIGLEIVAFFTAC  586
            +    RR  +     ++ V ++ C  F  +   +             Q+ +E + F  A 
Sbjct  377  LGFTNRRLLLSVSSYIAAVSSILCTFFSHKGGTSKVHNNNSYGGNWGQLIIEAIGFMGAS  436

Query  587  TAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASV  766
            TAF+IL IY +ELFPT VRN AV+M RQA+++G +++PLLV LGR +   S+ VFG+ ++
Sbjct  437  TAFDILYIYCVELFPTNVRNFAVSMLRQAIMLGASVAPLLVVLGRLSPSLSFLVFGVFAI  496

Query  767  LCCLFLVSLPETLGGDLCDTIDEEESKE  850
               +  + LPET    L +T+ ++E +E
Sbjct  497  SSGVLSIWLPETRNAPLYETLKQQEEEE  524



>ref|XP_006599714.1| PREDICTED: organic cation/carnitine transporter 1-like isoform 
X2 [Glycine max]
Length=549

 Score =   129 bits (324),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 88/268 (33%), Positives = 141/268 (53%), Gaps = 16/268 (6%)
 Frame = +2

Query  83   ESPRWLYLRGLTQDFVETIKTMAPPEtrssitrttiFSDNQDQGLIDLDEQMDLYSALKL  262
            ESPRWL +RG  ++ ++ +   A    +  +       +         DE     +   L
Sbjct  270  ESPRWLLIRGRDKEALQVLDRFARLNGKKKLPNNLTLVNPCGS---SCDETSPNNNKENL  326

Query  263  LINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLL  442
               K WA  R++TVM    G+G VYYG+ L V  + FNLY+S  +NA+ E+PA ++   L
Sbjct  327  WTTK-WAAIRMVTVMLAGFGVGFVYYGVQLNVENLNFNLYVSVAINALMEIPAVVIGTFL  385

Query  443  IDKLRRRSTvvglgvlsgvcnlgcvvFVGEELKAV------------QIGLEIVAFFTAC  586
            +    RR  +     ++ V ++ C  F  +   +             Q+ +E + F  A 
Sbjct  386  LGFTNRRLLLSVSSYIAAVSSILCTFFSHKGGTSKVHNNNSYGGNWGQLIIEAIGFMGAS  445

Query  587  TAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASV  766
            TAF+IL IY +ELFPT VRN AV+M RQA+++G +++PLLV LGR +   S+ VFG+ ++
Sbjct  446  TAFDILYIYCVELFPTNVRNFAVSMLRQAIMLGASVAPLLVVLGRLSPSLSFLVFGVFAI  505

Query  767  LCCLFLVSLPETLGGDLCDTIDEEESKE  850
               +  + LPET    L +T+ ++E +E
Sbjct  506  SSGVLSIWLPETRNAPLYETLKQQEEEE  533



>gb|EMS52482.1| Organic cation transporter protein [Triticum urartu]
Length=572

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 91/284 (32%), Positives = 155/284 (55%), Gaps = 9/284 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY+ T +P +++++ V     ESPRW  +R  T D V  ++ +A    RS     
Sbjct  280  SSWRLLYVVTSMPSLVFALAVMPFVSESPRWYLVRRRTDDAVRILRNIASSNGRSIPDGV  339

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALR-RLLTVMWVALGIGLVYYGIPLGVG  361
            T+  D++D    DL+++++  S+  L + +  A R RL+  + ++     VY+G+ L V 
Sbjct  340  TLKLDDED----DLNKKVEESSSTILDVFRSRATRGRLVLSVIISFLCSAVYFGLSLNVV  395

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG-EEL  538
             +  NLY+S   N ++E+P  L+T +L+ +  R+   +G  +LSG+      +  G   L
Sbjct  396  NLKLNLYISVVANCLAEMPGFLLTTVLLQRFGRKPLAIGSMILSGIFCTSASLIAGVGAL  455

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
            + V++   +V  F     +++L++YT ELFPT VR +A+    QA  +G  ++PL+V LG
Sbjct  456  RVVRMACGMVGIFGMAATYSLLVVYTAELFPTAVRTAAMGCTAQASQMGAILAPLVVVLG  515

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKE  850
                F  +GVFG   ++  L ++ LPET+   L DT+   E  E
Sbjct  516  EQVPFAVFGVFG---IIGGLLVICLPETMNKPLYDTMFGLEKGE  556



>gb|KHG00913.1| Organic cation/carnitine transporter 1 -like protein [Gossypium 
arboreum]
Length=297

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/198 (38%), Positives = 114/198 (58%), Gaps = 3/198 (2%)
 Frame = +2

Query  278  WALRRLLTVMWVALGIGLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLR  457
            WA +R++T+M    G+G VYYGI L    + FNLYL+  +NA  E+PA  +  +L+    
Sbjct  92   WAAKRMITMMLFGFGVGFVYYGIQLNAENLNFNLYLTVIINAAMEIPAVFIGGILLGFTD  151

Query  458  RRSTvvglgvlsgvcnlgcvvFVGEELKAV---QIGLEIVAFFTACTAFNILLIYTLELF  628
            RR       + +GV  L C++F           Q+ +E + F  A  AFN+  IY +ELF
Sbjct  152  RRLLSSLSAISAGVSCLLCIIFSAASSTTSSWPQLTIEAIGFMAASIAFNVSYIYCVELF  211

Query  629  PTCVRNSAVAMARQAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLG  808
            PT VRN AV+M RQ++++G ++SPLLV +GR +   S+ VFG  +++     V LPET  
Sbjct  212  PTNVRNFAVSMLRQSLMLGASLSPLLVVVGRLSPSLSFAVFGALAIVSGTLSVWLPETKN  271

Query  809  GDLCDTIDEEESKENGNR  862
              L +T+ ++E +E   R
Sbjct  272  APLYETLKQQEEEEVKRR  289



>gb|EMT05263.1| Organic cation transporter protein [Aegilops tauschii]
Length=583

 Score =   127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/285 (32%), Positives = 155/285 (54%), Gaps = 9/285 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY+ T +P +++++ V     ESPRW  +R  T D +  ++ +A    RS     
Sbjct  105  SSWRLLYVVTSMPSLVFALAVMPFVSESPRWYLVRRRTDDAMRILRNIASTNGRSIPDGV  164

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALR-RLLTVMWVALGIGLVYYGIPLGVG  361
            T+  D++D    DL+++++  S+  L + +  A R RL+  + ++     VY+G+ L V 
Sbjct  165  TLKLDDED----DLNKKVEESSSTILDVFRSRATRGRLVLSVIISFLCSAVYFGLSLNVV  220

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG-EEL  538
             +  NLY+S   N ++E+P  L+T +L+ +  R+   +G  +LSG+      +  G   L
Sbjct  221  NLKLNLYISVVANCLAEMPGFLLTTVLLQRFGRKPLAIGSMILSGIFCTSASLIAGVGAL  280

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
            + V++   +V  F     +++L++YT ELFPT VR +A+    QA  +G  ++PL+V LG
Sbjct  281  RVVRMACGMVGIFGMAATYSLLVVYTAELFPTAVRTAAMGCTAQASQMGAILAPLVVVLG  340

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
                F  +GVFG   ++  L ++ LPET+   L DT+   E  E 
Sbjct  341  EQVPFAVFGVFG---IIGGLLVICLPETMNKPLYDTMFGLEKGER  382



>emb|CDY29451.1| BnaC05g32190D [Brassica napus]
Length=392

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 91/290 (31%), Positives = 153/290 (53%), Gaps = 9/290 (3%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR L++ + +P + + +IV     ESPRW  +RG   + +E + T+A    R+     T
Sbjct  107  SWRELFIVSSLPSLFFLLIVIPFISESPRWYLVRGKVDEAMELMHTIAKTNGRNIPAGVT  166

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
            +  D+++    + +  ++   +L  ++N   A  RL+  + ++  + +VYYG+ L VG +
Sbjct  167  LSLDDEEDKEGERNNVVE--GSLHDVLNSPLARIRLILAIAISFTVSIVYYGLSLNVGNL  224

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG-EELKA  544
              NLYL+  LNAV+E+PA  +T +L+D+  R+   +G    S V  +   V  G    K 
Sbjct  225  KTNLYLNVFLNAVTEMPAFAITAVLLDRYGRKPLTIGTQWFSCVFCITGFVVGGVGPWKT  284

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            V++   ++  F     +N+L IY  ELFPT VRN+A+  A QA  +G  ++P +V LG G
Sbjct  285  VRMVSGVLGIFGMAGTYNLLFIYIAELFPTVVRNAALGCATQAAQMGAILAPFVVVLGEG  344

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDT---IDEEESKENGNRV  865
                 +GVF +  ++       LPETL   + DT   + E ES    ++V
Sbjct  345  ---LPFGVFAVCGLVGGGLAFYLPETLNKPMYDTMFGMHEAESNRGRDQV  391



>ref|XP_009145601.1| PREDICTED: organic cation/carnitine transporter 4 [Brassica rapa]
Length=520

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 91/290 (31%), Positives = 152/290 (52%), Gaps = 9/290 (3%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR L++ + +P + + +IV     ESPRW  +RG   + +E + T+A    R      T
Sbjct  235  SWRELFIVSSLPSLFFLLIVIPFISESPRWYLVRGRVDEAMELMHTIAKTNGRHIPAGVT  294

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
            +  D+++    + +  ++   +LK ++N      RL+  + ++  + +VYYG+ L VG +
Sbjct  295  LSLDDEEDKEGERNNVVE--GSLKDVLNSPLTRIRLILAIAISFTVSIVYYGLSLNVGNL  352

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG-EELKA  544
              NLYL+  LNAV+E+PA  +T +L+D+  R+   +G    S V  +   V  G    K 
Sbjct  353  KTNLYLNVFLNAVTEMPAFAITAVLLDRYGRKPLTIGTQWFSCVFCITGFVVGGVGPWKT  412

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            V++   ++  F     +N+L IY  ELFPT VRN+A+  A QA  +G  ++P +V LG G
Sbjct  413  VRMVSGVLGIFGMAGTYNLLFIYIAELFPTVVRNAALGCATQAAQMGAILAPFVVVLGEG  472

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDT---IDEEESKENGNRV  865
                 +GVF +  ++       LPETL   + DT   + E ES    ++V
Sbjct  473  ---LPFGVFAVCGLVGGGLAFYLPETLNKPMYDTMFGMHEAESNRGRDQV  519



>emb|CDY19617.1| BnaA05g20250D [Brassica napus]
Length=520

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 91/290 (31%), Positives = 152/290 (52%), Gaps = 9/290 (3%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR L++ + +P + + +IV     ESPRW  +RG   + +E + T+A    R      T
Sbjct  235  SWRELFIVSSLPSLFFLLIVIPFISESPRWYLVRGRVDEAMELMHTIAKTNGRHIPAGVT  294

Query  188  iFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGEM  367
            +  D+++    + +  ++   +LK ++N      RL+  + ++  + +VYYG+ L VG +
Sbjct  295  LSLDDEEDKEGERNSVVE--GSLKDVLNSPLTRIRLILAIAISFTVSIVYYGLSLNVGNL  352

Query  368  PFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG-EELKA  544
              NLYL+  LNAV+E+PA  +T +L+D+  R+   +G    S V  +   V  G    K 
Sbjct  353  KTNLYLNVFLNAVTEMPAFAITAVLLDRYGRKPLTIGTQWFSCVFCITGFVVGGVGPWKT  412

Query  545  VQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGRG  724
            V++   ++  F     +N+L IY  ELFPT VRN+A+  A QA  +G  ++P +V LG G
Sbjct  413  VRMVSGVLGIFGMAGTYNLLFIYIAELFPTVVRNAALGCATQAAQMGAILAPFVVVLGEG  472

Query  725  NRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDT---IDEEESKENGNRV  865
                 +GVF +  ++       LPETL   + DT   + E ES    ++V
Sbjct  473  ---LPFGVFAVCGLVGGGLAFYLPETLNKPMYDTMFGMHEAESNRGRDQV  519



>dbj|BAJ87305.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=478

 Score =   125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 89/296 (30%), Positives = 153/296 (52%), Gaps = 12/296 (4%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY  T +P ++++++V     ESPRW  +R  T D +  ++ +A    RS     
Sbjct  187  SSWRLLYAVTSMPSLVFALVVMPFVSESPRWYLVRRRTDDAMRVLRNIASTNGRSIPDGV  246

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            T+  D++D     ++E   +    +    +G    RL+  ++++     VY+G+ L V  
Sbjct  247  TLKLDDEDDINKKVEESSSILDVFRSRATRG----RLVLSVFISFLCSAVYFGLSLNVVN  302

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG-EELK  541
            +  NLY+S   N ++E+P  L+T +L+ ++ R+   +G  +LSGV      +  G   L+
Sbjct  303  LKLNLYISVVANCLAEMPGFLLTTVLLQRVGRKPLAIGSMILSGVFCTSAGLIAGVGALR  362

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             V++   +V  F     +N+L++YT ELFPT VR +A+    QA  +G  ++PL+V LG 
Sbjct  363  VVRMACGMVGIFGMAATYNLLIVYTAELFPTTVRTAAMGCTAQASQMGAILAPLVVVLGE  422

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI----DEEESKENGNRV*TLN  877
               F  +G FG+      L +  LPET+   L DT+      E + ++G  V + N
Sbjct  423  QVPFAVFGAFGIVG---GLLVFCLPETMNKPLYDTMFGLEKGERAPKSGEEVISGN  475



>ref|XP_009355559.1| PREDICTED: organic cation/carnitine transporter 4-like [Pyrus 
x bretschneideri]
Length=547

 Score =   126 bits (316),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 97/300 (32%), Positives = 147/300 (49%), Gaps = 26/300 (9%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP------PEtrs  169
             WR LY+ + IP +++ +IV     ESPRW  +RG   + ++ ++T+A       PE   
Sbjct  251  QWRELYIASSIPSLLFLLIVLPFVSESPRWYLVRGRILEAMKLMRTIAKSNKKHLPEGVV  310

Query  170  sitrttiFSDN-----QDQGLIDLDEQMDLYSALKLLINKGWALR-RLLTVMWVALGIGL  331
                    +D       DQ   +L E  +  S   + + K    R RL   + +     +
Sbjct  311  LTLDEEASNDTTTTNEDDQTYKELLESKEAISGSLIDVIKSPVTRIRLFLAVAINFLCSV  370

Query  332  VYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlg  511
            VYYG+ L V  +  NLY++  LNAV+E+PA  +T +L+DK  R+        +  +   G
Sbjct  371  VYYGLSLNVVNLETNLYINVLLNAVAEMPAFTITAILLDKYGRKP-----LAIGTLWFSG  425

Query  512  cvvFVGEEL------KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQA  673
               FVG  +      K V++   I+  F     +N+L IYT+ELFPT VRN+A+  A QA
Sbjct  426  VFCFVGSLVGNVGMWKVVRMVCGILGIFGMAGTYNLLFIYTMELFPTVVRNAALGCATQA  485

Query  674  MVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
              +G  ++P +V LG G  F    VF +  V+  +F   LPETL   L DT+   E KE 
Sbjct  486  AQMGAILAPFVVVLGGGLPF---SVFAVCGVVGGMFAFYLPETLNKPLYDTMAGMEDKEG  542



>gb|EMT05261.1| Solute carrier family 22 member 15-like protein [Aegilops tauschii]
Length=515

 Score =   125 bits (315),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 86/284 (30%), Positives = 151/284 (53%), Gaps = 8/284 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY+ T +P +++ + +     ESPRW  +R   +D +  I+ +A    +S     
Sbjct  224  SSWRLLYVVTSMPSLVFVLTIMPFVSESPRWYLVRRRAEDAMRIIRDIASTNRKSIPDGI  283

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            T+  D++D    +++E   +    +    +G    RL+  + ++    +VYYG+ L V  
Sbjct  284  TLKIDDEDDINKNIEESSSILDVFRSRTTRG----RLVLSVLISFLCSVVYYGLSLNVVN  339

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG-EELK  541
            +  NLY+S  +N+++E+PA L+T +L+  L R+   +G  +LSGV      +  G   ++
Sbjct  340  LKINLYISVAVNSLAEMPAFLLTTVLLQHLGRKPLAIGSMLLSGVFCTSASLITGVGAMR  399

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
            A+++   +V  F     +N+L++YT ELFPT VR +A+    QA  +G  ++P++V LG 
Sbjct  400  ALRMACGVVGIFGMAATYNLLVVYTAELFPTTVRTAAMGCTLQASKMGAILAPMVVLLGE  459

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
               F    VFG+  ++  L +  LPET+   L DT+   E  E 
Sbjct  460  RMPF---AVFGMLGIIGGLLVFCLPETMHKPLYDTMFGLEKGEG  500



>dbj|BAJ91383.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=516

 Score =   125 bits (314),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 89/296 (30%), Positives = 153/296 (52%), Gaps = 12/296 (4%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY  T +P ++++++V     ESPRW  +R  T D +  ++ +A    RS     
Sbjct  225  SSWRLLYAVTSMPSLVFALVVMPFVSESPRWYLVRRRTDDAMRVLRNIASTNGRSIPDGV  284

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            T+  D++D     ++E   +    +    +G    RL+  ++++     VY+G+ L V  
Sbjct  285  TLKLDDEDDINKKVEESSSILDVFRSRATRG----RLVLSVFISFLCSAVYFGLSLNVVN  340

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG-EELK  541
            +  NLY+S   N ++E+P  L+T +L+ ++ R+   +G  +LSGV      +  G   L+
Sbjct  341  LKLNLYISVVANCLAEMPGFLLTTVLLQRVGRKPLAIGSMILSGVFCTSAGLIAGVGALR  400

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             V++   +V  F     +N+L++YT ELFPT VR +A+    QA  +G  ++PL+V LG 
Sbjct  401  VVRMACGMVGIFGMAATYNLLIVYTAELFPTTVRTAAMGCTAQASQMGAILAPLVVVLGE  460

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI----DEEESKENGNRV*TLN  877
               F  +G FG+      L +  LPET+   L DT+      E + ++G  V + N
Sbjct  461  QVPFAVFGAFGIVG---GLLVFCLPETMNKPLYDTMFGLEKGERAPKSGEEVISGN  513



>dbj|BAJ90311.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=516

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 89/296 (30%), Positives = 153/296 (52%), Gaps = 12/296 (4%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY  T +P ++++++V     ESPRW  +R  T D +  ++ +A    RS     
Sbjct  225  SSWRLLYAVTSMPSLVFALVVMPFVSESPRWYLVRRRTDDAMRVLRNIASTNGRSIPDGV  284

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVGE  364
            T+  D++D     ++E   +    +    +G    RL+  ++++     VY+G+ L V  
Sbjct  285  TLKLDDEDDINKKVEESSSILDVFRSRATRG----RLVLSVFISFLCSAVYFGLSLNVVN  340

Query  365  MPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG-EELK  541
            +  NLY+S   N ++E+P  L+T +L+ ++ R+   +G  +LSGV      +  G   L+
Sbjct  341  LKLNLYISVVANCLAEMPGFLLTTVLLQRVGRKPLAIGSMILSGVFCTSAGLIAGVGALR  400

Query  542  AVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALGR  721
             V++   +V  F     +N+L++YT ELFPT VR +A+    QA  +G  ++PL+V LG 
Sbjct  401  VVRMACGMVGIFGMAATYNLLIVYTAELFPTTVRTAAMGCTAQASQMGAILAPLVVVLGE  460

Query  722  GNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTI----DEEESKENGNRV*TLN  877
               F  +G FG+      L +  LPET+   L DT+      E + ++G  V + N
Sbjct  461  QVPFAVFGAFGIVG---GLLVFCLPETMNKPLYDTMFGLEKGERAPKSGEEVISGN  513



>ref|XP_003580618.1| PREDICTED: organic cation/carnitine transporter 4 [Brachypodium 
distachyon]
Length=522

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 158/299 (53%), Gaps = 20/299 (7%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP------PEtr  166
            SSWR LY+FT +P + +++ V     ESPRW  +R    D +  ++ +A       P+  
Sbjct  224  SSWRALYVFTSLPSLAFALAVLPFVSESPRWFLVRHRAHDALRVLRDIASKNGRVFPDGV  283

Query  167  ssitrttiFSDNQDQGLIDLDEQMDLYSA-----LKLLINKGWALRRLLTVMWVALGIGL  331
            +      +  D+++    +  E+ +  SA     L +  ++    R +L+V+ + L   +
Sbjct  284  TLKLDDDVEEDDENVDKNNKVEEQERNSASDSSILDVFRSRTTRARLVLSVL-INLLCSV  342

Query  332  VYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlg  511
            VYYG+ L V  +  NLY+S  +N+++E+PA L+T LL+D+  R+   +G  +LSG   + 
Sbjct  343  VYYGLSLNVVNLKTNLYVSVAINSLAEMPAYLLTALLLDRFGRKPLGIGTMLLSGAFCIA  402

Query  512  cvvFV-----GEELKAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAM  676
              + V     G  ++ V++G  +V  F     +N+L IYT ELFPT VRN+A+    QA 
Sbjct  403  GSLIVPGAGAGGAMRIVRMGCGVVGIFGMAATYNLLFIYTAELFPTVVRNAALGCTSQAS  462

Query  677  VVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
             +G  ++PL+V LG    F    VFG++ ++  L +  LPET+   L DT+   E  E 
Sbjct  463  QMGAILAPLVVVLGERVPF---AVFGVSGIVGGLLVFYLPETMNKPLYDTMAGLEEGEK  518



>ref|XP_008365852.1| PREDICTED: organic cation/carnitine transporter 4 [Malus domestica]
Length=548

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 146/305 (48%), Gaps = 28/305 (9%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAP------PEtrs  169
             WR LY+ + IP +++ ++V     ESPRW  +RG   + ++ ++ +A       PE   
Sbjct  250  QWRELYIVSSIPSLLFLIVVLPFVSESPRWYLIRGRISEAMKLMRVIANSNKNYLPEGVV  309

Query  170  sitrttiFSDNQ-------DQGLIDLDEQMDLYSALKLLINKGWALR-RLLTVMWVALGI  325
                    +DN        DQ   +L E  +  S   + + K    R RL   + +    
Sbjct  310  LTLDEEASNDNSTTITNEDDQTYKELLESKEAISGSLIDVMKSPVTRIRLFLAVAINFLC  369

Query  326  GLVYYGIPLGVGEMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcn  505
             +VYYG+ L V  +  NLY++  LNAV+E+PA  +T +L+DK  R+        +  +  
Sbjct  370  SVVYYGLSLNVVNLETNLYINVLLNAVAEMPAFTITAILLDKYGRKP-----LAIGTLWF  424

Query  506  lgcvvFVGEEL------KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMAR  667
             G   F+G  +      K V++   I+  F     +N+L IYT ELFPT VRN+A+  A 
Sbjct  425  SGVFCFLGSLVGNVGVWKVVRMVCGILGIFGMAGTYNLLFIYTTELFPTVVRNAALGCAT  484

Query  668  QAMVVGGAISPLLVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESK  847
            QA  +G  ++P +V LG G  F    VF +  V+  +F   LPETL   L DT+   E  
Sbjct  485  QAAQMGAILAPFVVVLGGGLPF---AVFAMCGVVGGMFAFYLPETLNKPLYDTMTGMEDG  541

Query  848  ENGNR  862
            E   R
Sbjct  542  EGAFR  546



>dbj|BAJ89186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=515

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 88/285 (31%), Positives = 154/285 (54%), Gaps = 9/285 (3%)
 Frame = +2

Query  5    SSWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrt  184
            SSWR LY+ T +P + + + +     ESPRW  +R  T+D +  ++ +A    +S     
Sbjct  223  SSWRLLYVVTSMPSLAFMLTIMPFVSESPRWYLVRRRTKDAMRILRDIASTNRKSIPDGI  282

Query  185  tiFSDNQDQGLIDLDEQMDLYSALKL-LINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            T+  D++D    D++++++  S+  L +   G    RL+  + ++    +VYYG+ L V 
Sbjct  283  TLKLDDED----DIEKKIEESSSSILDVFRSGTTRSRLVLSVLISFLCSVVYYGLSLNVV  338

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVG-EEL  538
             +  N+Y+S  +N+++E+PA L+T +L+  L R+   +G  +LSGV      +  G   +
Sbjct  339  NLKINIYISVAVNSLAEMPAFLLTTVLLQHLGRKPLAIGSMLLSGVFCTFASLITGVGSM  398

Query  539  KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPLLVALG  718
            +AV++   +V  F     +N+L++YT ELFPT VR +A+    QA  +G  ++P++V LG
Sbjct  399  RAVRMACGVVGIFGMAATYNLLVVYTAELFPTTVRTAAMGCTLQASKMGAILAPMVVLLG  458

Query  719  RGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
                F  +G+ G+   L   F   LPET+   L DT+   E  E 
Sbjct  459  ERMPFAVFGMLGIMGGLLVFF---LPETMNKPLYDTMFGLEKGEG  500



>ref|XP_007021161.1| Organic cation/carnitine transporter4 isoform 3 [Theobroma cacao]
 gb|EOY12686.1| Organic cation/carnitine transporter4 isoform 3 [Theobroma cacao]
Length=384

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/290 (31%), Positives = 140/290 (48%), Gaps = 16/290 (6%)
 Frame = +2

Query  8    SWRYLYLFTGIPGIIYSVIVYLVARESPRWLYLRGLTQDFVETIKTMAPPEtrssitrtt  187
            SWR LY+ + IP II+ V+V     ESPRW  +RG   + ++ ++T+A    +       
Sbjct  102  SWRALYIASSIPSIIFLVLVVPFISESPRWYLVRGKMNEAMKIMRTIAKSNGQYLPDGVI  161

Query  188  iFSDNQDQGLIDLDEQMD--LYSALKLLINKGWALRRLLTVMWVALGIGLVYYGIPLGVG  361
            +  D++     + +      +  +L  +I       RL   + +     +VYYG+ L V 
Sbjct  162  LALDDESNDASNDNRSCKEPISGSLLDVIRSPITRIRLFLTVGINFTCSVVYYGLSLNVV  221

Query  362  EMPFNLYLSTTLNAVSELPASLVTLLLIDKLRRRSTvvglgvlsgvcnlgcvvFVGEEL-  538
             +  NLYL+  LNAV+E+PA  +T L++DK  R+        +          F+G  + 
Sbjct  222  NLETNLYLNVLLNAVAEMPAFTITALMLDKFGRKP-----LAIGTQWFSAIFCFMGSLVG  276

Query  539  -----KAVQIGLEIVAFFTACTAFNILLIYTLELFPTCVRNSAVAMARQAMVVGGAISPL  703
                 K +++   I+  F     +N+L IYT ELFPT VRN+A+  A QA  +G  ++P 
Sbjct  277  NVGMWKVIRMFCGILGIFGMAGTYNLLFIYTAELFPTVVRNAALGCATQAAQMGAILAPF  336

Query  704  LVALGRGNRFYSYGVFGLASVLCCLFLVSLPETLGGDLCDTIDEEESKEN  853
            +V  G G  F  +GV GL   +   +   LPETL   L DT+   E  E 
Sbjct  337  VVVWGGGLPFLVFGVCGLIGGMLAYY---LPETLNKPLYDTMTGMEEGET  383



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2339198799562