BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10172_g1_i1 len=1357 path=[1335:0-904 2240:905-1356]

Length=1357
                                                                      Score     E

ref|XP_009762215.1|  PREDICTED: 2-methylene-furan-3-one reductase...    455   5e-155   
ref|XP_010661585.1|  PREDICTED: 2-methylene-furan-3-one reductase...    453   4e-154   
emb|CBI38793.3|  unnamed protein product                                452   1e-153   
ref|XP_006445221.1|  hypothetical protein CICLE_v10024569mg             451   1e-153   
ref|XP_010056274.1|  PREDICTED: 2-methylene-furan-3-one reductase...    443   2e-150   
gb|AIX10953.1|  putative quinone oxidoreductase-like protein            442   7e-150   
ref|XP_002511744.1|  alcohol dehydrogenase, putative                    438   2e-148   Ricinus communis
ref|XP_009600433.1|  PREDICTED: 2-methylene-furan-3-one reductase...    436   1e-147   
gb|EYU32018.1|  hypothetical protein MIMGU_mgv1a009985mg                428   1e-144   
gb|KDP28730.1|  hypothetical protein JCGZ_14501                         427   6e-144   
ref|XP_011094581.1|  PREDICTED: 2-methylene-furan-3-one reductase...    425   2e-143   
ref|XP_008803292.1|  PREDICTED: 2-methylene-furan-3-one reductase...    419   2e-141   
ref|XP_010272640.1|  PREDICTED: 2-methylene-furan-3-one reductase...    417   3e-140   
ref|XP_008803293.1|  PREDICTED: 2-methylene-furan-3-one reductase...    412   1e-138   
ref|XP_004510932.1|  PREDICTED: quinone oxidoreductase-like prote...    398   1e-132   
ref|XP_010934157.1|  PREDICTED: 2-methylene-furan-3-one reductase...    398   2e-132   
ref|XP_003627658.1|  Quinone oxidoreductase-like protein                391   6e-130   
ref|XP_003627678.1|  Quinone oxidoreductase-like protein                386   7e-128   
ref|XP_006857996.1|  hypothetical protein AMTR_s00069p00186560          358   2e-117   
emb|CDP17797.1|  unnamed protein product                                343   7e-112   
gb|ABK22154.1|  unknown                                                 332   3e-107   Picea sitchensis
ref|XP_003636240.1|  Quinone oxidoreductase-like protein                332   4e-107   
gb|KCW72924.1|  hypothetical protein EUGRSUZ_E01364                     308   6e-99    
gb|ABK21418.1|  unknown                                                 300   7e-95    Picea sitchensis
gb|ABK25870.1|  unknown                                                 300   8e-95    Picea sitchensis
gb|ABK26019.1|  unknown                                                 298   8e-94    Picea sitchensis
gb|ABR16979.1|  unknown                                                 297   1e-93    Picea sitchensis
gb|ABK23140.1|  unknown                                                 295   1e-92    Picea sitchensis
gb|ABK27011.1|  unknown                                                 294   3e-92    Picea sitchensis
gb|KDP26584.1|  hypothetical protein JCGZ_17742                         286   2e-88    
ref|XP_009762380.1|  PREDICTED: 2-methylene-furan-3-one reductase       286   3e-88    
ref|XP_008230611.1|  PREDICTED: 2-methylene-furan-3-one reductase...    282   1e-87    
gb|EAZ06824.1|  hypothetical protein OsI_29063                          281   2e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_004297634.1|  PREDICTED: quinone oxidoreductase-like prote...    284   2e-87    
ref|XP_007215684.1|  hypothetical protein PRUPE_ppa008680mg             281   2e-87    
ref|XP_006659368.1|  PREDICTED: quinone oxidoreductase-like prote...    283   3e-87    
gb|EMT05900.1|  Quinone oxidoreductase-like protein                     280   4e-87    
ref|XP_011071085.1|  PREDICTED: 2-methylene-furan-3-one reductase...    280   6e-87    
ref|NP_001061691.1|  Os08g0379400                                       281   2e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004238663.1|  PREDICTED: 2-methylene-furan-3-one reductase       280   4e-86    
ref|XP_008221813.1|  PREDICTED: 2-methylene-furan-3-one reductase...    280   8e-86    
ref|XP_003574429.1|  PREDICTED: 2-methylene-furan-3-one reductase       280   8e-86    
gb|ABK24155.1|  unknown                                                 276   9e-86    Picea sitchensis
ref|XP_008340026.1|  PREDICTED: 2-methylene-furan-3-one reductase...    280   1e-85    
ref|XP_007216016.1|  hypothetical protein PRUPE_ppa014808mg             276   2e-85    
ref|XP_009626671.1|  PREDICTED: 2-methylene-furan-3-one reductase       278   3e-85    
ref|XP_008348028.1|  PREDICTED: 2-methylene-furan-3-one reductase...    275   9e-85    
ref|XP_010925514.1|  PREDICTED: 2-methylene-furan-3-one reductase       277   1e-84    
ref|XP_010100462.1|  Quinone oxidoreductase-like protein                276   1e-84    
ref|XP_008230609.1|  PREDICTED: 2-methylene-furan-3-one reductase...    273   2e-84    
ref|NP_001151204.1|  quinone oxidoreductase-like protein At1g23740      275   3e-84    Zea mays [maize]
ref|XP_008801828.1|  PREDICTED: 2-methylene-furan-3-one reductase       275   4e-84    
gb|EYU31261.1|  hypothetical protein MIMGU_mgv1a008015mg                275   4e-84    
ref|XP_010108766.1|  Quinone oxidoreductase-like protein                273   4e-84    
gb|EPS62233.1|  hypothetical protein M569_12557                         273   7e-84    
ref|XP_006483850.1|  PREDICTED: quinone oxidoreductase-like prote...    274   2e-83    
ref|XP_008230614.1|  PREDICTED: 2-methylene-furan-3-one reductase...    271   2e-83    
ref|XP_007215682.1|  hypothetical protein PRUPE_ppa008661mg             271   2e-83    
ref|XP_001784490.1|  predicted protein                                  272   2e-83    
ref|XP_010108763.1|  Quinone oxidoreductase-like protein                271   2e-83    
ref|XP_010108765.1|  Quinone oxidoreductase-like protein                271   3e-83    
ref|XP_011086568.1|  PREDICTED: 2-methylene-furan-3-one reductase...    273   3e-83    
ref|XP_002525379.1|  alcohol dehydrogenase, putative                    273   4e-83    Ricinus communis
ref|XP_002971209.1|  hypothetical protein SELMODRAFT_95183              270   5e-83    
gb|KDO82427.1|  hypothetical protein CISIN_1g016265mg                   272   6e-83    
ref|XP_011029885.1|  PREDICTED: 2-methylene-furan-3-one reductase...    270   8e-83    
ref|XP_004509819.1|  PREDICTED: quinone oxidoreductase-like prote...    271   2e-82    
gb|KHN26872.1|  Quinone oxidoreductase-like protein, chloroplastic      271   2e-82    
ref|XP_008230612.1|  PREDICTED: 2-methylene-furan-3-one reductase...    269   2e-82    
ref|XP_006365236.1|  PREDICTED: quinone oxidoreductase-like prote...    271   2e-82    
ref|XP_003532009.1|  PREDICTED: quinone oxidoreductase-like prote...    271   2e-82    
gb|ABK92721.1|  unknown                                                 267   6e-82    Populus trichocarpa [western balsam poplar]
gb|KHN27018.1|  Quinone oxidoreductase-like protein, chloroplastic      266   1e-81    
ref|XP_007151048.1|  hypothetical protein PHAVU_004G014100g             266   2e-81    
gb|AFK38435.1|  unknown                                                 265   3e-81    
ref|XP_010023565.1|  PREDICTED: 2-methylene-furan-3-one reductase       268   3e-81    
ref|XP_003552020.1|  PREDICTED: quinone oxidoreductase-like prote...    268   3e-81    
ref|XP_008379251.1|  PREDICTED: 2-methylene-furan-3-one reductase...    266   3e-81    
gb|ABK24706.1|  unknown                                                 267   6e-81    Picea sitchensis
gb|KHG10556.1|  hypothetical protein F383_11141                         266   7e-81    
gb|AFJ53076.1|  enone oxidoreductase                                    266   7e-81    
ref|XP_011002607.1|  PREDICTED: 2-methylene-furan-3-one reductase...    267   1e-80    
ref|XP_010251268.1|  PREDICTED: 2-methylene-furan-3-one reductase...    266   1e-80    
emb|CBI28522.3|  unnamed protein product                                263   1e-80    
ref|XP_008348027.1|  PREDICTED: 2-methylene-furan-3-one reductase...    264   1e-80    
ref|XP_004304618.1|  PREDICTED: quinone oxidoreductase-like prote...    264   1e-80    
gb|ACN40074.1|  unknown                                                 264   2e-80    Picea sitchensis
ref|XP_007223016.1|  hypothetical protein PRUPE_ppa006845mg             266   2e-80    
ref|XP_002323668.2|  hypothetical protein POPTR_0016s14310g             265   2e-80    Populus trichocarpa [western balsam poplar]
gb|ABK96279.1|  unknown                                                 265   2e-80    Populus trichocarpa x Populus deltoides
ref|XP_006470343.1|  PREDICTED: quinone oxidoreductase-like prote...    263   2e-80    
ref|XP_007215689.1|  hypothetical protein PRUPE_ppa008712mg             263   2e-80    
sp|Q84V25.1|ENOXE_FRAAN  RecName: Full=2-methylene-furan-3-one re...    263   3e-80    Fragaria x ananassa
gb|ACZ74701.1|  quinone oxidoreductase-like protein                     263   3e-80    Phaseolus vulgaris [French bean]
gb|AFK38797.1|  unknown                                                 263   3e-80    
ref|XP_003636314.1|  Quinone oxidoreductase-like protein                263   3e-80    
gb|KDO66209.1|  hypothetical protein CISIN_1g021628mg                   262   4e-80    
gb|KEH20011.1|  zinc-binding dehydrogenase family oxidoreductase        265   5e-80    
gb|KCW56039.1|  hypothetical protein EUGRSUZ_I01801                     262   7e-80    
ref|XP_010682556.1|  PREDICTED: 2-methylene-furan-3-one reductase       264   1e-79    
ref|XP_007031456.1|  Oxidoreductase, zinc-binding dehydrogenase f...    261   1e-79    
ref|XP_007140915.1|  hypothetical protein PHAVU_008G151800g             261   1e-79    
ref|XP_003631255.1|  PREDICTED: 2-methylene-furan-3-one reductase       263   1e-79    
ref|XP_007044642.1|  Quinone oxidoreductase-like protein isoform 1      263   2e-79    
ref|NP_001240976.1|  uncharacterized protein LOC100788619               261   2e-79    
gb|KCW59869.1|  hypothetical protein EUGRSUZ_H02605                     263   2e-79    
ref|XP_008230947.1|  PREDICTED: 2-methylene-furan-3-one reductase...    261   2e-79    
ref|XP_010477676.1|  PREDICTED: quinone oxidoreductase-like prote...    260   2e-79    
gb|AAC98029.1|  Strong similarity to gb|U20808 auxin-induced prot...    260   2e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010029191.1|  PREDICTED: 2-methylene-furan-3-one reductase...    261   2e-79    
ref|XP_008389642.1|  PREDICTED: 2-methylene-furan-3-one reductase...    263   2e-79    
ref|XP_008230613.1|  PREDICTED: LOW QUALITY PROTEIN: 2-methylene-...    261   2e-79    
ref|XP_002961594.1|  hypothetical protein SELMODRAFT_76590              260   3e-79    
ref|XP_010029192.1|  PREDICTED: 2-methylene-furan-3-one reductase...    260   3e-79    
gb|AAM62737.1|  Quinone oxidoreductase-like protein                     259   4e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009395684.1|  PREDICTED: 2-methylene-furan-3-one reductase       263   4e-79    
emb|CDP00161.1|  unnamed protein product                                261   8e-79    
gb|EYU22491.1|  hypothetical protein MIMGU_mgv1a009679mg                259   1e-78    
pdb|4IDA|A  Chain A, Structure Of The Fragaria X Ananassa Enone O...    259   1e-78    
ref|XP_007153730.1|  hypothetical protein PHAVU_003G060300g             261   1e-78    
emb|CDY47631.1|  BnaC05g18870D                                          261   1e-78    
ref|XP_010460148.1|  PREDICTED: quinone oxidoreductase-like prote...    261   1e-78    
gb|KHG13834.1|  hypothetical protein F383_18331                         259   1e-78    
ref|XP_004135246.1|  PREDICTED: quinone oxidoreductase-like prote...    261   1e-78    
ref|XP_009363557.1|  PREDICTED: 2-methylene-furan-3-one reductase...    261   1e-78    
gb|ACJ11721.1|  quinone oxidoreductase                                  258   2e-78    Gossypium hirsutum [American cotton]
ref|NP_173786.1|  alkenal/one oxidoreductase                            260   3e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008446207.1|  PREDICTED: 2-methylene-furan-3-one reductase       260   3e-78    
ref|XP_003553852.1|  PREDICTED: quinone oxidoreductase-like prote...    258   3e-78    
emb|CDY61544.1|  BnaA09g29920D                                          259   3e-78    
ref|XP_006305049.1|  hypothetical protein CARUB_v10009414mg             259   4e-78    
ref|XP_008230610.1|  PREDICTED: 2-methylene-furan-3-one reductase...    258   4e-78    
gb|AFK35692.1|  unknown                                                 259   5e-78    
ref|XP_008458755.1|  PREDICTED: 2-methylene-furan-3-one reductase...    257   5e-78    
dbj|BAJ23910.1|  chloroplastic alkenal/one oxidoreductase               259   6e-78    
ref|XP_004155355.1|  PREDICTED: quinone oxidoreductase-like prote...    259   7e-78    
gb|KEH22218.1|  zinc-binding dehydrogenase family oxidoreductase        256   9e-78    
ref|XP_004489284.1|  PREDICTED: quinone oxidoreductase-like prote...    256   1e-77    
sp|Q941I0.2|ENOXC_FRAAN  RecName: Full=2-methylene-furan-3-one re...    256   1e-77    Fragaria x ananassa
ref|XP_003618487.1|  Quinone oxidoreductase-like protein                256   2e-77    
gb|ACU19769.1|  unknown                                                 256   2e-77    Glycine max [soybeans]
ref|NP_001275527.1|  quinone oxidoreductase-like protein At1g2374...    255   2e-77    
gb|AAL06644.1|  putative quinone oxidoreductase                         256   2e-77    Fragaria x ananassa
gb|AFK33810.1|  unknown                                                 255   2e-77    
sp|O23939.2|ENOX_FRAVE  RecName: Full=2-methylene-furan-3-one red...    255   3e-77    Fragaria vesca [alpine strawberry]
ref|XP_009115505.1|  PREDICTED: quinone oxidoreductase-like prote...    257   3e-77    
emb|CAA04767.1|  ripening-induced protein                               254   7e-77    Fragaria vesca [alpine strawberry]
ref|NP_001241983.1|  uncharacterized protein LOC100817947               253   2e-76    
gb|KFK44450.1|  hypothetical protein AALP_AA1G258400                    254   3e-76    
ref|XP_009334069.1|  PREDICTED: 2-methylene-furan-3-one reductase       253   3e-76    
ref|XP_008230948.1|  PREDICTED: 2-methylene-furan-3-one reductase...    251   1e-75    
gb|AFK40629.1|  unknown                                                 251   1e-75    
ref|XP_004515401.1|  PREDICTED: quinone oxidoreductase-like prote...    249   4e-75    
gb|AAA87182.1|  auxin-induced protein                                   249   4e-75    Vigna radiata [mung bean]
ref|XP_010029190.1|  PREDICTED: 2-methylene-furan-3-one reductase...    249   4e-75    
ref|XP_010108764.1|  Quinone oxidoreductase-like protein                249   6e-75    
gb|KHN23541.1|  Quinone oxidoreductase-like protein, chloroplastic      249   7e-75    
ref|XP_003553854.1|  PREDICTED: quinone oxidoreductase-like prote...    249   8e-75    
gb|KDP45353.1|  hypothetical protein JCGZ_09602                         248   2e-74    
ref|XP_010530541.1|  PREDICTED: quinone oxidoreductase-like prote...    249   5e-74    
ref|XP_006844972.1|  hypothetical protein AMTR_s00058p00182650          248   2e-73    
ref|XP_003553850.1|  PREDICTED: quinone oxidoreductase-like prote...    244   3e-73    
ref|XP_010533157.1|  PREDICTED: quinone oxidoreductase-like prote...    248   4e-73    
gb|KHN27525.1|  Quinone oxidoreductase-like protein, chloroplastic      243   9e-73    
ref|XP_010498879.1|  PREDICTED: quinone oxidoreductase-like prote...    245   1e-72    
ref|XP_002893304.1|  oxidoreductase                                     244   4e-72    
ref|XP_004489907.1|  PREDICTED: quinone oxidoreductase-like prote...    242   5e-72    
emb|CDP10913.1|  unnamed protein product                                241   7e-72    
ref|XP_010029197.1|  PREDICTED: 2-methylene-furan-3-one reductase...    239   4e-71    
ref|XP_010029188.1|  PREDICTED: 2-methylene-furan-3-one reductase...    239   6e-71    
ref|XP_001761154.1|  predicted protein                                  238   9e-71    
gb|EPS71691.1|  alcohol dehydrogenase                                   237   1e-70    
gb|EPS71670.1|  quinone oxidoreductase-like protein                     237   2e-70    
ref|XP_004973313.1|  PREDICTED: quinone oxidoreductase-like prote...    239   4e-70    
gb|KCW56040.1|  hypothetical protein EUGRSUZ_I01801                     235   5e-70    
ref|XP_007031458.1|  Oxidoreductase, zinc-binding dehydrogenase f...    237   7e-70    
gb|AAK66565.1|AF384244_1  quinone oxidoreductase-like protein           235   8e-70    Helianthus annuus
ref|XP_006416058.1|  hypothetical protein EUTSA_v10007901mg             237   1e-69    
ref|XP_008348198.1|  PREDICTED: LOW QUALITY PROTEIN: 2-methylene-...    233   2e-69    
ref|XP_010029195.1|  PREDICTED: 2-methylene-furan-3-one reductase...    234   4e-69    
ref|XP_010029193.1|  PREDICTED: 2-methylene-furan-3-one reductase...    233   6e-69    
gb|KDO66208.1|  hypothetical protein CISIN_1g021628mg                   228   2e-67    
ref|XP_006379865.1|  hypothetical protein POPTR_0008s16150g             226   3e-66    
ref|XP_010029198.1|  PREDICTED: 2-methylene-furan-3-one reductase...    226   6e-66    
ref|XP_007216786.1|  hypothetical protein PRUPE_ppa023751mg             223   3e-65    
gb|KCW72925.1|  hypothetical protein EUGRSUZ_E01364                     219   3e-65    
ref|XP_003618486.1|  Quinone oxidoreductase-like protein                223   4e-65    
ref|XP_010030252.1|  PREDICTED: 2-methylene-furan-3-one reductase...    221   1e-64    
gb|KHN23538.1|  Quinone oxidoreductase-like protein, chloroplastic      218   9e-64    
gb|KCW56053.1|  hypothetical protein EUGRSUZ_I01807                     218   1e-63    
ref|XP_007216927.1|  hypothetical protein PRUPE_ppa016638mg             218   6e-63    
emb|CDP10306.1|  unnamed protein product                                217   1e-62    
gb|AFK39081.1|  unknown                                                 211   8e-62    
ref|XP_007151049.1|  hypothetical protein PHAVU_004G014200g             213   3e-61    
gb|ACZ74700.1|  quinone oxidoreductase-like protein                     213   4e-61    Phaseolus vulgaris [French bean]
gb|KCW56055.1|  hypothetical protein EUGRSUZ_I01808                     210   1e-60    
gb|AFK39993.1|  unknown                                                 207   2e-60    
ref|XP_008357880.1|  PREDICTED: 2-methylene-furan-3-one reductase...    199   4e-56    
gb|ABK23099.1|  unknown                                                 196   1e-55    Picea sitchensis
gb|KCW56044.1|  hypothetical protein EUGRSUZ_I01801                     192   8e-54    
ref|XP_007031457.1|  Oxidoreductase, zinc-binding dehydrogenase f...    191   1e-53    
gb|KDO66210.1|  hypothetical protein CISIN_1g021628mg                   191   2e-53    
gb|KCW56043.1|  hypothetical protein EUGRSUZ_I01801                     190   2e-53    
gb|ABR16968.1|  unknown                                                 185   1e-51    Picea sitchensis
ref|XP_010251269.1|  PREDICTED: 2-methylene-furan-3-one reductase...    187   5e-51    
gb|KCW56049.1|  hypothetical protein EUGRSUZ_I01803                     183   6e-51    
ref|XP_010029196.1|  PREDICTED: 2-methylene-furan-3-one reductase...    181   5e-50    
gb|EYU22492.1|  hypothetical protein MIMGU_mgv1a009679mg                181   6e-50    
ref|WP_029331573.1|  NADPH:quinone reductase                            182   2e-49    
ref|XP_010068096.1|  PREDICTED: 2-methylene-furan-3-one reductase...    179   2e-48    
gb|ACU18144.1|  unknown                                                 177   5e-48    Glycine max [soybeans]
gb|KCW56050.1|  hypothetical protein EUGRSUZ_I01805                     173   2e-47    
ref|WP_017379106.1|  NADPH:quinone reductase                            175   8e-47    
ref|XP_007044643.1|  Quinone oxidoreductase-like protein isoform 2      174   1e-46    
ref|WP_025728592.1|  NADPH:quinone reductase                            174   2e-46    
ref|WP_009960443.1|  NADPH:quinone oxidoreductase                       174   2e-46    
ref|WP_037195561.1|  NADPH:quinone oxidoreductase                       174   3e-46    
ref|WP_036262605.1|  NADPH:quinone oxidoreductase                       174   4e-46    
ref|WP_018663535.1|  hypothetical protein                               173   4e-46    
emb|CEG23753.1|  Zinc-type alcohol dehydrogenase-like protein           172   6e-46    
ref|WP_004651427.1|  chlorophyll synthesis pathway protein BchC         172   1e-45    
ref|WP_016988523.1|  zinc-type alcohol dehydrogenase                    172   1e-45    
ref|WP_004127496.1|  putative zinc-binding protein oxidoreductase       172   2e-45    
ref|WP_037319072.1|  NADPH:quinone reductase                            171   2e-45    
ref|XP_005713109.1|  unnamed protein product                            171   3e-45    
ref|WP_026915809.1|  NADPH:quinone reductase                            171   3e-45    
ref|WP_031365089.1|  NADPH:quinone oxidoreductase                       171   5e-45    
gb|KCW56054.1|  hypothetical protein EUGRSUZ_I01807                     167   5e-45    
ref|WP_007805493.1|  NADPH:quinone oxidoreductase                       170   7e-45    
ref|WP_026934229.1|  NADPH:quinone reductase                            170   8e-45    
ref|WP_006987246.1|  Alcohol dehydrogenase zinc-binding domain pr...    170   8e-45    
ref|WP_036058714.1|  NADPH:quinone reductase                            169   1e-44    
ref|WP_034852264.1|  NADPH:quinone oxidoreductase                       169   2e-44    
ref|WP_027052265.1|  NADPH:quinone oxidoreductase                       169   2e-44    
ref|WP_039692120.1|  NADPH:quinone oxidoreductase                       169   2e-44    
ref|WP_026716144.1|  NADPH:quinone reductase                            168   3e-44    
ref|WP_026709224.1|  NADPH:quinone reductase                            168   4e-44    
ref|WP_026839733.1|  NADPH:quinone reductase                            168   4e-44    
ref|WP_028784204.1|  NADPH:quinone reductase                            167   5e-44    
ref|WP_034889969.1|  NADPH:quinone reductase                            167   6e-44    
ref|WP_015471126.1|  hypothetical protein                               168   6e-44    
ref|WP_013316298.1|  NADPH:quinone oxidoreductase                       167   7e-44    
dbj|GAM30419.1|  putative oxydoreductase protein, zinc-containing...    167   9e-44    
ref|WP_038917797.1|  NADPH:quinone oxidoreductase                       167   1e-43    
ref|WP_018931929.1|  NADPH:quinone reductase                            166   1e-43    
ref|WP_017186128.1|  hypothetical protein                               166   1e-43    
ref|WP_036816858.1|  NADPH:quinone reductase                            166   1e-43    
ref|WP_013716602.1|  NADPH:quinone oxidoreductase                       167   2e-43    
ref|WP_006835167.1|  NADPH:quinone reductase                            166   2e-43    
ref|WP_003441048.1|  alcohol dehydrogenase and quinone reductase-...    166   3e-43    
ref|WP_036574238.1|  NADPH:quinone reductase                            165   3e-43    
ref|WP_036073648.1|  NADPH:quinone reductase                            165   3e-43    
ref|WP_006216904.1|  NADPH:quinone oxidoreductase                       166   4e-43    
gb|KHN67371.1|  NADPH:quinone oxidoreductase                            166   4e-43    
ref|WP_038662476.1|  NADPH:quinone oxidoreductase                       165   5e-43    
ref|WP_033570666.1|  NADPH:quinone oxidoreductase                       165   6e-43    
ref|WP_036101739.1|  NADPH:quinone oxidoreductase                       165   8e-43    
ref|WP_017389724.1|  NADPH:quinone oxidoreductase                       164   8e-43    
ref|WP_007475680.1|  zinc-binding dehydrogenase family protein          164   8e-43    
gb|ESY65433.1|  NADPH:quinone oxidoreductase                            164   9e-43    
ref|WP_020558417.1|  hypothetical protein                               164   9e-43    
ref|WP_005040270.1|  chlorophyll synthesis pathway protein BchC         164   1e-42    
ref|WP_036064330.1|  NADPH:quinone reductase                            164   1e-42    
ref|WP_027953342.1|  NADPH:quinone reductase                            164   1e-42    
ref|WP_038910218.1|  NADPH:quinone oxidoreductase                       164   1e-42    
ref|WP_034481351.1|  NADPH:quinone oxidoreductase                       164   1e-42    
ref|WP_013894302.1|  NADPH:quinone oxidoreductase                       164   1e-42    
ref|WP_038900257.1|  NADPH:quinone oxidoreductase                       164   1e-42    
ref|WP_029147933.1|  NADPH:quinone oxidoreductase                       164   1e-42    
ref|WP_033575781.1|  NADPH:quinone oxidoreductase                       164   1e-42    
ref|WP_007642584.1|  NADPH:quinone reductase                            163   2e-42    
ref|WP_014228709.1|  MULTISPECIES: alcohol dehydrogenase                164   2e-42    
ref|WP_037003340.1|  NADPH:quinone oxidoreductase                       164   2e-42    
ref|WP_007548188.1|  NADPH:quinone reductase                            163   2e-42    
ref|WP_012724498.1|  NADPH:quinone oxidoreductase                       164   2e-42    
ref|WP_028039572.1|  NADPH:quinone oxidoreductase                       164   2e-42    
gb|EFS04127.1|  alcohol dehydrogenase, zinc-dependent                   163   2e-42    
ref|WP_026042094.1|  NADPH:quinone oxidoreductase                       163   2e-42    
ref|WP_025106189.1|  NADPH:quinone oxidoreductase                       163   2e-42    
ref|WP_029446045.1|  NADPH:quinone reductase                            163   3e-42    
ref|WP_004642961.1|  chlorophyll synthesis pathway protein BchC         163   3e-42    
ref|WP_009717713.1|  dehydrogenase                                      163   3e-42    
ref|WP_010824954.1|  oxidoreductase, zinc-binding                       163   3e-42    
ref|WP_010819686.1|  oxidoreductase, zinc-binding                       163   3e-42    
ref|XP_007216537.1|  hypothetical protein PRUPE_ppa027122mg             160   3e-42    
ref|WP_004898334.1|  chlorophyll synthesis pathway protein BchC         163   4e-42    
gb|ESY76391.1|  NADPH:quinone oxidoreductase                            162   5e-42    
ref|WP_023719995.1|  NADPH:quinone oxidoreductase                       162   6e-42    
ref|WP_017848539.1|  NADPH:quinone oxidoreductase                       162   6e-42    
ref|WP_033625242.1|  NADPH:quinone reductase                            162   6e-42    
ref|WP_012984997.1|  NADPH:quinone reductase                            162   6e-42    
ref|WP_037701123.1|  NADPH:quinone oxidoreductase                       162   6e-42    
ref|WP_003745884.1|  NADPH:quinone reductase                            162   6e-42    
ref|WP_031257967.1|  NADPH:quinone oxidoreductase                       162   6e-42    
ref|WP_003651937.1|  NADPH:quinone oxidoreductase                       162   7e-42    
ref|WP_035722402.1|  NADPH:quinone reductase                            161   7e-42    
ref|WP_002387474.1|  NADPH:quinone reductase                            162   7e-42    
ref|WP_024480260.1|  NADPH:quinone reductase                            162   7e-42    
ref|WP_029448745.1|  NADPH:quinone reductase                            162   8e-42    
ref|WP_018418577.1|  NADPH:quinone oxidoreductase                       162   8e-42    
ref|WP_034668687.1|  NADPH:quinone reductase                            162   8e-42    
ref|WP_002401629.1|  NADPH:quinone reductase                            162   8e-42    
ref|WP_016129968.1|  quinone oxidoreductase                             161   9e-42    
ref|WP_010713633.1|  oxidoreductase, zinc-binding                       162   9e-42    
ref|WP_002389536.1|  MULTISPECIES: NADPH:quinone reductase              162   9e-42    
ref|WP_002414089.1|  NADPH:quinone reductase                            162   9e-42    
ref|WP_002394606.1|  NADPH:quinone reductase                            162   1e-41    
ref|WP_002410404.1|  NADPH:quinone reductase                            162   1e-41    
ref|WP_014553518.1|  NADPH:quinone reductase                            161   1e-41    
ref|WP_016618556.1|  putative chlorophyll synthesis pathway prote...    162   1e-41    
ref|WP_002383828.1|  NADPH:quinone reductase                            162   1e-41    
ref|WP_033595316.1|  NADPH:quinone reductase                            162   1e-41    
ref|WP_033600569.1|  NADPH:quinone reductase                            162   1e-41    
ref|WP_002419416.1|  NADPH:quinone reductase                            162   1e-41    
ref|WP_002417255.1|  NADPH:quinone reductase                            162   1e-41    
ref|WP_033592327.1|  NADPH:quinone reductase                            162   1e-41    
ref|WP_016622157.1|  putative chlorophyll synthesis pathway prote...    162   1e-41    
ref|WP_002403369.1|  NADPH:quinone reductase                            162   1e-41    
ref|WP_014007665.1|  NADPH:quinone oxidoreductase                       162   1e-41    
ref|WP_018068767.1|  NADPH:quinone oxidoreductase                       162   1e-41    
ref|WP_002381354.1|  NADPH:quinone reductase                            162   1e-41    
ref|WP_010818118.1|  oxidoreductase, zinc-binding                       162   1e-41    
ref|WP_002390350.1|  NADPH:quinone reductase                            162   1e-41    
ref|WP_017968761.1|  NADPH:quinone oxidoreductase                       161   1e-41    
dbj|GAE92262.1|  zinc-containing alcohol dehydrogenase                  162   1e-41    
ref|WP_010827081.1|  oxidoreductase, zinc-binding                       162   1e-41    
ref|WP_018927605.1|  MULTISPECIES: NADPH:quinone oxidoreductase         161   1e-41    
ref|WP_000848686.1|  NADPH:quinone reductase                            161   1e-41    
ref|WP_016626256.1|  putative chlorophyll synthesis pathway prote...    161   1e-41    
ref|WP_010711894.1|  oxidoreductase, zinc-binding                       161   1e-41    
ref|WP_033625716.1|  NADPH:quinone reductase                            161   1e-41    
ref|WP_002397688.1|  NADPH:quinone reductase                            161   1e-41    
ref|WP_002367613.1|  NADPH:quinone reductase                            161   1e-41    
ref|WP_010709130.1|  oxidoreductase, zinc-binding                       161   1e-41    
ref|WP_014092056.1|  NADPH:quinone reductase                            160   1e-41    
ref|WP_002392234.1|  NADPH:quinone reductase                            161   1e-41    
ref|WP_007131351.1|  NADPH:quinone reductase                            160   2e-41    
ref|WP_031455418.1|  NADPH:quinone oxidoreductase                       161   2e-41    
ref|WP_002404355.1|  NADPH:quinone reductase                            161   2e-41    
ref|WP_023171924.1|  alcohol dehydrogenase zinc-binding domain pr...    160   2e-41    
ref|WP_038424282.1|  NADPH:quinone oxidoreductase                       161   2e-41    
ref|WP_023172283.1|  alcohol dehydrogenase                              160   2e-41    
ref|WP_002388702.1|  NADPH:quinone reductase                            161   2e-41    
ref|WP_004882357.1|  molecular chaperone GroES                          161   2e-41    
ref|WP_010819141.1|  oxidoreductase, zinc-binding                       161   2e-41    
ref|WP_008592042.1|  NADPH:quinone reductase                            160   2e-41    
ref|WP_002391757.1|  NADPH:quinone reductase                            161   2e-41    
ref|WP_036066157.1|  NADPH:quinone reductase                            160   2e-41    
gb|EFR97908.1|  alcohol dehydrogenase, zinc-dependent                   160   2e-41    
ref|WP_010823364.1|  oxidoreductase, zinc-binding                       161   2e-41    
ref|WP_034924685.1|  NADPH:quinone reductase                            160   2e-41    
ref|WP_003770777.1|  NADPH:quinone reductase                            160   2e-41    
ref|WP_014618823.1|  NADPH:quinone oxidoreductase                       160   2e-41    
ref|WP_015144276.1|  Zn-dependent oxidoreductase                        161   2e-41    
ref|WP_002408181.1|  NADPH:quinone reductase                            160   2e-41    
ref|WP_026883360.1|  NADPH:quinone reductase                            160   2e-41    
ref|WP_006159896.1|  NADPH:quinone oxidoreductase                       160   2e-41    
ref|WP_016145378.1|  chlorophyll synthesis pathway protein BchC         160   3e-41    
ref|WP_033626836.1|  NADPH:quinone reductase                            160   3e-41    
ref|WP_038365885.1|  NADPH:quinone oxidoreductase                       160   3e-41    
ref|WP_031250559.1|  NADPH:quinone oxidoreductase                       160   3e-41    
ref|WP_010983495.1|  dehydrogenase                                      160   4e-41    
ref|WP_016724992.1|  NADPH:quinone oxidoreductase                       160   4e-41    
ref|WP_027925196.1|  NADPH:quinone oxidoreductase                       160   4e-41    
ref|WP_016616695.1|  putative chlorophyll synthesis pathway prote...    160   4e-41    
ref|WP_003760809.1|  alcohol dehydrogenase, zinc-dependent              159   4e-41    
ref|WP_023274459.1|  chlorophyll synthesis pathway protein BchC         160   4e-41    
gb|EEU83263.1|  oxidoreductase                                          160   4e-41    
ref|WP_003738293.1|  NADPH:quinone reductase                            159   4e-41    
ref|WP_035070340.1|  NADPH:quinone oxidoreductase                       160   4e-41    
ref|WP_002379249.1|  NADPH:quinone reductase                            160   4e-41    
ref|WP_034762365.1|  NADPH:quinone reductase                            159   4e-41    
ref|WP_036370280.1|  NADPH:quinone oxidoreductase                       160   5e-41    
ref|WP_015212143.1|  alcohol dehydrogenase, zinc-containing             160   5e-41    
ref|WP_002376363.1|  NADPH:quinone reductase                            160   5e-41    
ref|WP_002407563.1|  NADPH:quinone reductase                            160   5e-41    
ref|WP_025186975.1|  NADPH:quinone reductase                            160   5e-41    
ref|WP_025023562.1|  NADPH:quinone reductase                            159   5e-41    
ref|WP_010294464.1|  NADPH:quinone reductase                            159   5e-41    
ref|WP_010820596.1|  oxidoreductase, zinc-binding                       160   5e-41    
gb|EEU22904.1|  oxidoreductase                                          160   5e-41    
ref|WP_016630583.1|  MULTISPECIES: GroES-like protein                   160   6e-41    
ref|WP_031154274.1|  NADPH:quinone oxidoreductase                       159   6e-41    
gb|EEU71209.1|  oxidoreductase                                          160   6e-41    
ref|WP_010710970.1|  oxidoreductase, zinc-binding                       160   6e-41    
ref|WP_033918151.1|  NADPH:quinone reductase                            159   6e-41    
ref|WP_027689532.1|  NADPH:quinone oxidoreductase                       159   7e-41    
ref|WP_018496516.1|  NADPH:quinone oxidoreductase                       159   7e-41    
ref|WP_014524719.1|  NADPH:quinone reductase                            159   7e-41    
gb|EKD65362.1|  Alcohol dehydrogenase, zinc-containing                  159   7e-41    
ref|WP_036091777.1|  MULTISPECIES: NADPH:quinone reductase              159   7e-41    
ref|WP_010656341.1|  NADPH:quinone oxidoreductase                       159   7e-41    
gb|EEU67843.1|  oxidoreductase                                          159   7e-41    
ref|WP_004915907.1|  NADPH:quinone reductase                            159   7e-41    
gb|KGJ36176.1|  NADPH:quinone reductase                                 159   8e-41    
ref|WP_024323888.1|  NADPH:quinone oxidoreductase                       159   8e-41    
ref|WP_002379866.1|  NADPH:quinone reductase                            159   8e-41    
ref|WP_039552063.1|  NADPH:quinone oxidoreductase                       159   9e-41    
ref|WP_010990518.1|  NADPH:quinone reductase                            159   9e-41    
ref|WP_017811208.1|  hypothetical protein                               158   9e-41    
ref|WP_022713704.1|  NADPH:quinone oxidoreductase                       159   1e-40    
gb|EEU64040.1|  oxidoreductase                                          159   1e-40    
ref|WP_013197753.1|  NADPH:quinone oxidoreductase                       159   1e-40    
ref|WP_031421066.1|  NADPH:quinone reductase                            158   1e-40    
ref|WP_002386379.1|  NADPH:quinone reductase                            159   1e-40    
ref|WP_003724356.1|  NADPH:quinone reductase                            158   1e-40    
gb|EET98111.1|  oxidoreductase                                          159   1e-40    
ref|WP_031054303.1|  NADPH:quinone oxidoreductase                       159   1e-40    
ref|WP_036073576.1|  NADPH:quinone reductase                            158   1e-40    
ref|WP_013540894.1|  NADPH:quinone oxidoreductase                       159   1e-40    
ref|WP_036086808.1|  NADPH:quinone reductase                            158   1e-40    
ref|WP_032970279.1|  NADPH:quinone oxidoreductase                       159   1e-40    
ref|WP_033594774.1|  NADPH:quinone reductase                            158   1e-40    
ref|WP_003765730.1|  NADPH:quinone reductase                            158   1e-40    
ref|WP_003442319.1|  zinc-binding oxidoreductase                        158   2e-40    
ref|WP_027384563.1|  NADPH:quinone oxidoreductase                       158   2e-40    
ref|WP_031671670.1|  NADPH:quinone reductase                            158   2e-40    
ref|WP_015880840.1|  NADPH:quinone reductase                            157   2e-40    
ref|WP_016138023.1|  chlorophyll synthesis pathway protein BchC         158   2e-40    
gb|EPI40364.1|  GroES-like protein                                      158   2e-40    
ref|WP_015932797.1|  NADPH:quinone oxidoreductase                       158   2e-40    
ref|WP_003727252.1|  NADPH:quinone reductase                            157   2e-40    
ref|WP_019828885.1|  zinc-containing alcohol dehydrogenase superf...    158   2e-40    
ref|WP_003722809.1|  NADPH:quinone reductase                            157   2e-40    
gb|EPH74123.1|  GroES-like protein                                      157   2e-40    
ref|WP_029658295.1|  NADPH:quinone reductase                            158   2e-40    
ref|WP_025564191.1|  NADPH:quinone oxidoreductase                       158   2e-40    
ref|WP_018646156.1|  alcohol dehydrogenase                              158   2e-40    
ref|WP_033921978.1|  NADPH:quinone reductase                            158   2e-40    
ref|WP_016987756.1|  NADPH:quinone oxidoreductase                       158   2e-40    
ref|WP_030244219.1|  MULTISPECIES: NADPH:quinone oxidoreductase         158   3e-40    
gb|EEN70977.1|  GroES-like protein                                      157   3e-40    
gb|EFR88588.1|  alcohol dehydrogenase, zinc-dependent                   157   3e-40    
gb|EJU87760.1|  GroES-like protein                                      157   3e-40    
ref|WP_007832821.1|  NADPH:quinone oxidoreductase                       158   3e-40    
gb|EFU02197.1|  GroES-like protein                                      157   3e-40    
ref|WP_029693112.1|  NADPH:quinone reductase                            157   3e-40    
ref|WP_010225373.1|  NADPH:quinone oxidoreductase                       158   3e-40    
gb|EEU76781.1|  oxidoreductase                                          158   3e-40    
ref|WP_005305708.1|  chlorophyll synthesis pathway protein BchC         157   3e-40    
ref|WP_016180946.1|  oxidoreductase, zinc-binding                       157   3e-40    
gb|EFT39760.1|  GroES-like protein                                      157   3e-40    
ref|WP_027030359.1|  NADPH:quinone oxidoreductase                       157   3e-40    
gb|EFU16434.1|  GroES-like protein                                      157   3e-40    
ref|WP_036011500.1|  zinc-binding alcohol dehydrogenase                 157   3e-40    
ref|WP_032879988.1|  NADPH:quinone oxidoreductase                       158   3e-40    
ref|WP_027620834.1|  NADPH:quinone oxidoreductase                       157   3e-40    
gb|AHF67900.1|  alcohol dehydrogenase GroES-like domain/oxidoredu...    157   3e-40    
ref|WP_016774801.1|  NADPH:quinone reductase                            157   4e-40    
emb|CEI83640.1|  Zinc-type alcohol dehydrogenase-like protein           157   4e-40    
ref|WP_016122894.1|  quinone oxidoreductase                             157   4e-40    
ref|WP_036994674.1|  NADPH:quinone oxidoreductase                       157   4e-40    
ref|WP_007916007.1|  MULTISPECIES: NADPH:quinone oxidoreductase         157   4e-40    
ref|WP_027713132.1|  NADPH:quinone oxidoreductase                       157   5e-40    
ref|WP_012188270.1|  NADPH:quinone oxidoreductase                       157   5e-40    
ref|WP_010775485.1|  oxidoreductase, zinc-binding                       157   5e-40    
ref|WP_000643797.1|  NADPH:quinone reductase                            157   5e-40    
ref|WP_000643799.1|  NADPH:quinone reductase                            157   5e-40    
gb|EFT89037.1|  GroES-like protein                                      157   5e-40    
gb|EPI11125.1|  GroES-like protein                                      157   5e-40    
ref|WP_033695539.1|  NADPH:quinone reductase                            157   5e-40    
ref|WP_026832943.1|  NADPH:quinone reductase                            157   5e-40    
ref|WP_002399012.1|  NADPH:quinone reductase                            157   5e-40    
ref|WP_000643798.1|  NADPH:quinone reductase                            156   5e-40    
ref|WP_026080944.1|  NADPH:quinone reductase                            156   5e-40    
gb|EPI22906.1|  GroES-like protein                                      157   5e-40    
gb|ETC91552.1|  NADPH:quinone reductase                                 157   5e-40    
ref|WP_025188835.1|  NADPH:quinone reductase                            157   5e-40    
emb|CCP16608.1|  alcohol dehydrogenase zinc-binding domain protein      158   6e-40    
ref|WP_011481078.1|  NADPH:quinone oxidoreductase                       157   6e-40    
ref|WP_029330062.1|  NADPH:quinone reductase                            157   6e-40    
ref|WP_002384472.1|  NADPH:quinone reductase                            156   6e-40    
ref|WP_029242582.1|  NADPH:quinone oxidoreductase                       157   6e-40    
gb|EJV35196.1|  GroES-like protein                                      156   6e-40    
gb|EFT91383.1|  GroES-like protein                                      156   6e-40    
ref|WP_019896636.1|  alcohol dehydrogenase                              157   6e-40    
ref|WP_015024964.1|  alcohol dehydrogenase and quinone reductase-...    157   6e-40    
ref|WP_005790228.1|  NADPH:quinone oxidoreductase                       157   6e-40    
gb|EPH77910.1|  GroES-like protein                                      156   6e-40    
gb|EFU00192.1|  GroES-like protein                                      156   6e-40    
ref|WP_002377312.1|  NADPH:quinone reductase                            156   6e-40    
ref|WP_030625656.1|  NADPH:quinone oxidoreductase                       157   7e-40    
ref|WP_019413139.1|  NADPH:quinone reductase                            156   7e-40    
ref|WP_002363488.1|  NADPH:quinone reductase                            157   7e-40    
ref|WP_036099983.1|  NADPH:quinone reductase                            156   7e-40    
ref|WP_031092467.1|  NADPH:quinone oxidoreductase                       156   7e-40    
ref|WP_036440905.1|  NADPH:quinone oxidoreductase                       157   8e-40    
ref|WP_011701427.1|  NADPH:quinone reductase                            156   8e-40    
ref|WP_002404298.1|  NADPH:quinone reductase                            156   8e-40    
ref|WP_014862089.1|  NADPH:quinone reductase                            156   8e-40    
ref|WP_019689717.1|  NADPH:quinone oxidoreductase                       156   8e-40    
ref|WP_020183826.1|  alcohol dehydrogenase                              156   8e-40    
ref|WP_018390223.1|  NADPH:quinone oxidoreductase                       156   9e-40    
ref|WP_002398318.1|  NADPH:quinone reductase                            156   9e-40    
ref|WP_026961617.1|  NADPH:quinone reductase                            155   9e-40    
gb|EFU12947.1|  GroES-like protein                                      156   9e-40    
ref|WP_002403945.1|  NADPH:quinone reductase                            156   9e-40    
ref|WP_026331591.1|  NADPH:quinone oxidoreductase                       156   9e-40    
ref|WP_020099806.1|  hypothetical protein                               156   9e-40    
ref|WP_030943153.1|  NADPH:quinone oxidoreductase                       156   9e-40    



>ref|XP_009762215.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Nicotiana 
sylvestris]
Length=330

 Score =   455 bits (1170),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 237/326 (73%), Positives = 272/326 (83%), Gaps = 2/326 (1%)
 Frame = +3

Query  207   MKIFSTEPNGL-QDMQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFK  383
             MK    E N + + +QK W YEE+GPKEVLKL DF IP PQHDQLLVQV+AAALNPIDFK
Sbjct  1     MKFLIGEQNHVKRQLQKVWMYEEYGPKEVLKLEDFPIPCPQHDQLLVQVKAAALNPIDFK  60

Query  384   LRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAE  563
              RQ  +VP++FPV+PGCDMAGIVV KG  V++FDIGDEVYGNI NF  + ++K++GTLAE
Sbjct  61    FRQRPVVPLDFPVVPGCDMAGIVVGKGDSVSRFDIGDEVYGNIQNFTTD-KIKQLGTLAE  119

Query  564   FTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslav  743
             F VVEE LVA KPKN++F+ AASLP+A QTA +GF+TAGF++GQSVFIVGGAGGVGSL +
Sbjct  120   FIVVEEELVARKPKNVSFEEAASLPVAFQTAIEGFKTAGFKKGQSVFIVGGAGGVGSLVI  179

Query  744   qlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINS  923
             QLAK  YGAS V ATTS  KVEFVK LGADKVVDYT T YE I E YDLVYDTIGDS NS
Sbjct  180   QLAKQFYGASFVTATTSTTKVEFVKSLGADKVVDYTKTRYEDIKEKYDLVYDTIGDSKNS  239

Query  924   FVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCN  1103
             +VVAKE A IIDITWPPSNPRA+HS LTV GE+ EK++P+LE+GK+KA IDPA PFHF  
Sbjct  240   YVVAKEEAPIIDITWPPSNPRAMHSNLTVCGEVFEKIEPYLENGKIKATIDPASPFHFYE  299

Query  1104  VVEAFGYIETGRARGKVVISPFPSWH  1181
             V+EAF Y+ETGRARGKVVISPFPS H
Sbjct  300   VIEAFSYLETGRARGKVVISPFPSTH  325



>ref|XP_010661585.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Vitis vinifera]
Length=333

 Score =   453 bits (1165),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 228/315 (72%), Positives = 272/315 (86%), Gaps = 0/315 (0%)
 Frame = +3

Query  243   DMQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPV  422
             + QKAW+YEE+GPKEVLKLGDF +P P H+Q+LVQV+AAALNPIDFK RQ ++ P +FPV
Sbjct  6     NTQKAWFYEEYGPKEVLKLGDFPLPTPAHNQILVQVRAAALNPIDFKRRQRAIFPSDFPV  65

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PGCDMAG+VVA+G G TKF IGDEVYGNI +FN EG+LK++GTLA+F VVEE+LVA+KP
Sbjct  66    VPGCDMAGVVVARGDGATKFGIGDEVYGNIQDFNAEGKLKQLGTLAQFIVVEESLVALKP  125

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN++F+ AASLPLAIQTA +GF TAGF+ GQ+VFIVGGAGGVG+L +QLAKH+YGAS V 
Sbjct  126   KNISFEEAASLPLAIQTAIEGFVTAGFKGGQTVFIVGGAGGVGTLVIQLAKHLYGASEVV  185

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S PKVEFVK LGADKVVDYT T YE+I E +D +YDTIGD+ NS VVAK +A I+DI
Sbjct  186   ATASTPKVEFVKSLGADKVVDYTKTNYEEITEKFDFLYDTIGDTKNSHVVAKADAPIVDI  245

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             TWPPS+PRAV+S LTV GE LEKL+P+LESGK+KA+IDP GP+ F  VVEAFGY+ETGRA
Sbjct  246   TWPPSHPRAVYSSLTVCGESLEKLRPYLESGKLKAIIDPTGPYKFTAVVEAFGYLETGRA  305

Query  1143  RGKVVISPFPSWHYP  1187
             RGKVV+SPFPS   P
Sbjct  306   RGKVVVSPFPSLQPP  320



>emb|CBI38793.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   452 bits (1163),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 228/315 (72%), Positives = 272/315 (86%), Gaps = 0/315 (0%)
 Frame = +3

Query  243   DMQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPV  422
             + QKAW+YEE+GPKEVLKLGDF +P P H+Q+LVQV+AAALNPIDFK RQ ++ P +FPV
Sbjct  14    NTQKAWFYEEYGPKEVLKLGDFPLPTPAHNQILVQVRAAALNPIDFKRRQRAIFPSDFPV  73

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PGCDMAG+VVA+G G TKF IGDEVYGNI +FN EG+LK++GTLA+F VVEE+LVA+KP
Sbjct  74    VPGCDMAGVVVARGDGATKFGIGDEVYGNIQDFNAEGKLKQLGTLAQFIVVEESLVALKP  133

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN++F+ AASLPLAIQTA +GF TAGF+ GQ+VFIVGGAGGVG+L +QLAKH+YGAS V 
Sbjct  134   KNISFEEAASLPLAIQTAIEGFVTAGFKGGQTVFIVGGAGGVGTLVIQLAKHLYGASEVV  193

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S PKVEFVK LGADKVVDYT T YE+I E +D +YDTIGD+ NS VVAK +A I+DI
Sbjct  194   ATASTPKVEFVKSLGADKVVDYTKTNYEEITEKFDFLYDTIGDTKNSHVVAKADAPIVDI  253

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             TWPPS+PRAV+S LTV GE LEKL+P+LESGK+KA+IDP GP+ F  VVEAFGY+ETGRA
Sbjct  254   TWPPSHPRAVYSSLTVCGESLEKLRPYLESGKLKAIIDPTGPYKFTAVVEAFGYLETGRA  313

Query  1143  RGKVVISPFPSWHYP  1187
             RGKVV+SPFPS   P
Sbjct  314   RGKVVVSPFPSLQPP  328



>ref|XP_006445221.1| hypothetical protein CICLE_v10024569mg [Citrus clementina]
 ref|XP_006490951.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Citrus sinensis]
 gb|ESR58461.1| hypothetical protein CICLE_v10024569mg [Citrus clementina]
 gb|KDO85877.1| hypothetical protein CISIN_1g020320mg [Citrus sinensis]
Length=327

 Score =   451 bits (1160),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 227/309 (73%), Positives = 267/309 (86%), Gaps = 0/309 (0%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQ AWYYEE+GPKEVLKLGDF +P PQHDQLLVQV+AAALNPID K RQ  L P +FP +
Sbjct  1     MQNAWYYEEYGPKEVLKLGDFPLPTPQHDQLLVQVRAAALNPIDSKRRQRPLFPSDFPAV  60

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCDMAGIVVAKG+ VTKF+ GDEVYGNI +FN EG+LK++G LAEF VVEE+L+A KPK
Sbjct  61    PGCDMAGIVVAKGTSVTKFNTGDEVYGNIQDFNAEGKLKQLGALAEFIVVEESLIAKKPK  120

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             N++F+ AASLPLA+QTA +GF+TAGF+ GQ++FIVGGAGGVG+L +QLAKH YGAS V A
Sbjct  121   NISFEEAASLPLAVQTAIEGFKTAGFKTGQTIFIVGGAGGVGTLVIQLAKHFYGASHVVA  180

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             TTS PKVEFVK LGADKV+DY  T YE I E +D++YDTIGD  NSFVVAK+NA I+DIT
Sbjct  181   TTSTPKVEFVKELGADKVIDYRKTKYEDIEEKFDVLYDTIGDCKNSFVVAKDNAPIVDIT  240

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
             WPPS+PRA++S LTVSGEILEKL+PF+ESGK+KA IDP GP+ F +V+EAF Y+ETGRAR
Sbjct  241   WPPSHPRAIYSSLTVSGEILEKLRPFIESGKLKAQIDPTGPYKFKDVIEAFRYLETGRAR  300

Query  1146  GKVVISPFP  1172
             GKVVIS FP
Sbjct  301   GKVVISAFP  309



>ref|XP_010056274.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Eucalyptus 
grandis]
 gb|KCW72922.1| hypothetical protein EUGRSUZ_E01364 [Eucalyptus grandis]
 gb|KCW72923.1| hypothetical protein EUGRSUZ_E01364 [Eucalyptus grandis]
Length=337

 Score =   443 bits (1140),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 226/314 (72%), Positives = 271/314 (86%), Gaps = 0/314 (0%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW+YEE+G KEVLKLGDF  P PQH+Q++VQV+AAALNPIDFK RQ  + P +FPV+
Sbjct  1     MQKAWFYEEYGSKEVLKLGDFPFPTPQHNQIIVQVRAAALNPIDFKRRQRPIFPSDFPVV  60

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCDMAG+VVAKG+GVTKFD+GD VYGNI +FN  G+LK++GTLAEF  VEETLVAMKP+
Sbjct  61    PGCDMAGVVVAKGTGVTKFDLGDAVYGNIQDFNAPGKLKQLGTLAEFIAVEETLVAMKPQ  120

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             NL+F+ AASLPLA+QTA +GF TA F+EGQ+VFIVGGAGGVG+LAVQLAK+ Y AS V A
Sbjct  121   NLSFEEAASLPLAVQTAMEGFVTADFKEGQTVFIVGGAGGVGTLAVQLAKNFYNASYVVA  180

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             T S+ KVEFVK LGADKV+DYTNT YE+I E +D +YDTIGD  NSFVVAK+ A IIDIT
Sbjct  181   TCSSAKVEFVKKLGADKVIDYTNTKYEEIKEKFDFLYDTIGDCKNSFVVAKDEAPIIDIT  240

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
             WPPS+PRAV+S LTVSGE LE ++P+LE+GK+KA+IDP GP+ F +V+EAF Y+ETGRAR
Sbjct  241   WPPSHPRAVYSSLTVSGENLEMIRPYLENGKLKAIIDPTGPYAFTDVIEAFRYLETGRAR  300

Query  1146  GKVVISPFPSWHYP  1187
             GKVVISPFP+ + P
Sbjct  301   GKVVISPFPTENAP  314



>gb|AIX10953.1| putative quinone oxidoreductase-like protein [Gardenia jasminoides]
Length=334

 Score =   442 bits (1136),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 225/315 (71%), Positives = 265/315 (84%), Gaps = 0/315 (0%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPM  410
             N  + MQKAW+YEEHGP EVL+LG   IP P+ +Q+LV V+AAALNPIDFKLRQ S V  
Sbjct  20    NNHRKMQKAWFYEEHGPPEVLQLGYLPIPSPKENQILVHVRAAALNPIDFKLRQKSCVAT  79

Query  411   NFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLV  590
              FPV+PGCDMAG+VVAKG  +TKF IGD VYGNI NFN EG +K++G LAEF +VE  LV
Sbjct  80    TFPVVPGCDMAGVVVAKGDAITKFCIGDGVYGNIQNFNAEGNIKQLGVLAEFILVEGDLV  139

Query  591   AMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGA  770
             A KP+NL+F+ AASLP+A+QTA +GF+ AGF +GQ+VFIVGGAGGVG+LAVQLAK  YGA
Sbjct  140   ARKPENLSFEEAASLPVALQTAVEGFKVAGFNKGQTVFIVGGAGGVGTLAVQLAKRFYGA  199

Query  771   SSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENAT  950
             S V ATTS PKVEFVK LGADKV+DY  T YE++ E YDLVYDTIGDS  S+VVAK++  
Sbjct  200   SLVTATTSTPKVEFVKGLGADKVIDYRKTKYEEVEERYDLVYDTIGDSKYSYVVAKDDMP  259

Query  951   IIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
             IIDITWPPSNPRA+HSGLTVSG++LEKL+P+LESGK+KAVIDP  PFHFC+V+ AF Y+E
Sbjct  260   IIDITWPPSNPRAIHSGLTVSGDVLEKLRPYLESGKLKAVIDPRSPFHFCDVINAFRYLE  319

Query  1131  TGRARGKVVISPFPS  1175
             TGRARGKVV+SPFPS
Sbjct  320   TGRARGKVVVSPFPS  334



>ref|XP_002511744.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF50413.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=338

 Score =   438 bits (1127),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 224/314 (71%), Positives = 266/314 (85%), Gaps = 0/314 (0%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW+Y EHGPKEVL+LGDF +P P H+++LVQV+AAALNPID K RQ  + P  FPV+
Sbjct  1     MQKAWFYREHGPKEVLQLGDFPLPAPHHNEILVQVRAAALNPIDIKRRQKPVFPSEFPVV  60

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCDM+G+VVAKGSG+TK+ IGDEVYGNI +FN +G+LK++GTLAEF VVEE  VA KPK
Sbjct  61    PGCDMSGVVVAKGSGMTKYCIGDEVYGNIQDFNADGQLKQLGTLAEFIVVEERFVAKKPK  120

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             NL+F+ AASLPLA+QTA +GF  A F++GQ++ +VGGAGGVGSL VQLAKH YGAS V A
Sbjct  121   NLSFEEAASLPLAVQTAMEGFMNADFKKGQNICVVGGAGGVGSLVVQLAKHFYGASYVVA  180

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             TTS  K+EFV+ LGADKVVDYTNT Y+ I E YD VYDTIGDS NSFVVAK+NA IIDIT
Sbjct  181   TTSTSKMEFVQSLGADKVVDYTNTGYKDIKEKYDFVYDTIGDSKNSFVVAKDNAPIIDIT  240

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
             WPPSNP AV+S LTVSGE LEKL+P+LE+GK+KAVIDP GP+ F +V+EAF ++ETGRAR
Sbjct  241   WPPSNPVAVYSALTVSGENLEKLRPYLETGKLKAVIDPTGPYKFMDVIEAFRHLETGRAR  300

Query  1146  GKVVISPFPSWHYP  1187
             GKVVIS +PS H P
Sbjct  301   GKVVISSYPSQHLP  314



>ref|XP_009600433.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Nicotiana 
tomentosiformis]
Length=331

 Score =   436 bits (1121),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 227/315 (72%), Positives = 265/315 (84%), Gaps = 2/315 (1%)
 Frame = +3

Query  240   QDMQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFP  419
             + +QK W Y+E+GPKEVLKL DF IP PQHDQLLVQV+AAALNPIDFK RQ  +VP++FP
Sbjct  13    RQLQKVWMYKEYGPKEVLKLEDFPIPCPQHDQLLVQVKAAALNPIDFKFRQRPIVPLDFP  72

Query  420   -VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
              V  GCDMAG+VV KG  V++F+IGDEVYGNI NF  + ++K+ GTL EF VVEE LVA 
Sbjct  73    DVCAGCDMAGVVVGKGDSVSRFEIGDEVYGNIQNFT-KDKIKQPGTLTEFIVVEEELVAR  131

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KPK ++F+ AASLP+A+QTA +GF+TAGF++GQSVFIVGGAGGVGSL +QLAK +YGAS 
Sbjct  132   KPKKVSFEEAASLPVALQTAIEGFKTAGFKKGQSVFIVGGAGGVGSLVIQLAKQLYGASF  191

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             V ATTS  KVEFVK LGADKVVDYT T YE I E YDLVYDTIGDS NS+VVAKE A II
Sbjct  192   VTATTSTTKVEFVKSLGADKVVDYTQTRYEDIKEKYDLVYDTIGDSKNSYVVAKEEAPII  251

Query  957   DITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
             DITWPPSNP A+HS LT+SGE+LEK++P+LE+GK+KA IDPA PFHF  V+EAF Y+ETG
Sbjct  252   DITWPPSNPNAMHSSLTISGEVLEKIEPYLENGKLKATIDPASPFHFYEVIEAFSYLETG  311

Query  1137  RARGKVVISPFPSWH  1181
             RARGKVVISPFPS H
Sbjct  312   RARGKVVISPFPSIH  326



>gb|EYU32018.1| hypothetical protein MIMGU_mgv1a009985mg [Erythranthe guttata]
Length=325

 Score =   428 bits (1100),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 227/312 (73%), Positives = 260/312 (83%), Gaps = 1/312 (0%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW+YEEHGPKEVLKLG+  IP P+ +QLL+ V AAALNPIDFKLRQ  L  ++FPV+
Sbjct  1     MQKAWFYEEHGPKEVLKLGELPIPTPRANQLLIHVYAAALNPIDFKLRQNRLSSLDFPVV  60

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCD+AG+V+AKG    KF  GDEVYGNI  F   G+LK++GTLAEFTVVEE LVA KP 
Sbjct  61    PGCDVAGVVIAKGEETWKFQAGDEVYGNIQKFG-SGKLKQIGTLAEFTVVEENLVAEKPG  119

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             NL+F+ AASLP+A QTA +GFRTA F++GQSVFIVGGAGGVGSLAVQLAK+ YGAS V A
Sbjct  120   NLSFEEAASLPVAAQTAVEGFRTADFKKGQSVFIVGGAGGVGSLAVQLAKYFYGASFVTA  179

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             TTS  KVE VK LGADKVVDYT T Y +I E YDLVYDT+GDS NS VVAKE+  +IDIT
Sbjct  180   TTSTGKVEMVKKLGADKVVDYTKTAYGEIEEKYDLVYDTVGDSRNSCVVAKEDGLVIDIT  239

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
             WPPSNP+A+HS LTVSGEILE L+P L+SGK+KAV+DPAGPF F NVV+AFGY+ETGRAR
Sbjct  240   WPPSNPKALHSSLTVSGEILENLRPCLDSGKLKAVVDPAGPFDFNNVVQAFGYLETGRAR  299

Query  1146  GKVVISPFPSWH  1181
             GKVVIS F S H
Sbjct  300   GKVVISSFSSLH  311



>gb|KDP28730.1| hypothetical protein JCGZ_14501 [Jatropha curcas]
Length=336

 Score =   427 bits (1097),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 230/314 (73%), Positives = 269/314 (86%), Gaps = 1/314 (0%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW+YEE+GPKEVLKLGDF +P PQH+QLLV+V+AAALNPIDFK R+ +L P  FPV+
Sbjct  1     MQKAWFYEEYGPKEVLKLGDFPLPAPQHNQLLVEVRAAALNPIDFKRRERALFPSEFPVV  60

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCDMAG+VV  GSGVTKF IGDEVYGNI  F+  G LK++GTLAEF VVEE LVA KPK
Sbjct  61    PGCDMAGVVVGTGSGVTKFRIGDEVYGNIQQFDA-GHLKQLGTLAEFIVVEEGLVADKPK  119

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             NL+F+ AASLPLA+QTA +GF+TA F+EG+++F+VGGAGGVGSL VQLAKH+YGAS + A
Sbjct  120   NLSFEEAASLPLAVQTAMEGFKTADFKEGENIFVVGGAGGVGSLVVQLAKHLYGASYIVA  179

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             TTS PKVEFVK LGADKV DYT   Y++I E YD VYDTIGDS NSFVVAK+NA IIDIT
Sbjct  180   TTSTPKVEFVKSLGADKVTDYTKIKYKEIEEKYDFVYDTIGDSGNSFVVAKDNAPIIDIT  239

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
             WPP++PRAV+S LTVSGE LEKL+P+LE+GK+KAVIDP GP+ F +V+EAF Y+ETGRAR
Sbjct  240   WPPAHPRAVYSSLTVSGENLEKLRPYLETGKLKAVIDPTGPYKFTDVIEAFKYLETGRAR  299

Query  1146  GKVVISPFPSWHYP  1187
             GKVVIS F S H P
Sbjct  300   GKVVISSFSSQHLP  313



>ref|XP_011094581.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Sesamum indicum]
Length=319

 Score =   425 bits (1093),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 215/302 (71%), Positives = 257/302 (85%), Gaps = 0/302 (0%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW+YEEHGPKEVL+ GD  IP PQ DQLLVQV AAALNPIDFKLRQ  L P++ PV+
Sbjct  1     MQKAWFYEEHGPKEVLQQGDVPIPYPQADQLLVQVHAAALNPIDFKLRQNPLGPVDLPVV  60

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCDMAG+VVAKG G  +FD+GDEVYGNI NF  EG+LK++G+LAEF V+EE LVA+KPK
Sbjct  61    PGCDMAGVVVAKGDGALRFDVGDEVYGNIQNFKAEGKLKQLGSLAEFVVLEEELVAVKPK  120

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             N++F+ AASLP+A+QTA +GF+TAGF+EGQSVFIVGGAGGVG+ A+QLAK  Y AS V A
Sbjct  121   NVSFEEAASLPVAVQTAVEGFKTAGFKEGQSVFIVGGAGGVGTSALQLAKQFYKASVVTA  180

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             TTS  KV+F+K LGADKVVDYT T Y ++ E YD V+DTIGDS  S+VVAKE+A +IDIT
Sbjct  181   TTSTGKVDFLKGLGADKVVDYTKTRYMEVEEKYDFVFDTIGDSRKSYVVAKEDAPVIDIT  240

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
             WPPSNPRA H+ LTVSG+ILE+L+P+LESG++KAVIDP  PF F NV+EAF ++ETGRAR
Sbjct  241   WPPSNPRAQHTSLTVSGKILEELRPYLESGRLKAVIDPTSPFPFSNVIEAFKHLETGRAR  300

Query  1146  GK  1151
             GK
Sbjct  301   GK  302



>ref|XP_008803292.1| PREDICTED: 2-methylene-furan-3-one reductase-like isoform X1 
[Phoenix dactylifera]
Length=314

 Score =   419 bits (1078),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 211/310 (68%), Positives = 258/310 (83%), Gaps = 0/310 (0%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW+YEE+GPKEVLK+GDF +P+ Q +QLLVQV+AAALNPIDFK RQ ++     PV+
Sbjct  1     MQKAWFYEEYGPKEVLKMGDFPLPILQQNQLLVQVRAAALNPIDFKRRQLAIFASGLPVV  60

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCDMAGIV     GV+KF +G+EVYGNI +FN+  +LK++GTLAE+  VEE LVA+KP 
Sbjct  61    PGCDMAGIVADMAPGVSKFKVGEEVYGNIQDFNVPEKLKQLGTLAEYVAVEENLVALKPD  120

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             NL+F+ A SLPLA+QTA +GF TA FQ G+SVFIVGGAGGVG+L VQLAKH +GAS V A
Sbjct  121   NLSFEEAGSLPLALQTALEGFETANFQAGRSVFIVGGAGGVGTLVVQLAKHYFGASRVVA  180

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             T S+ KVEFVK LGAD V+DYT T YE+I E +D VYDTIG+S NSFVVAKE+A ++DIT
Sbjct  181   TCSSSKVEFVKSLGADMVIDYTATKYEEITEKFDFVYDTIGESKNSFVVAKEDAPVVDIT  240

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
             WPP+NP+A  S LTV G+ILE+L+P+LESGK+KAVIDP GP+HF +V+EAF Y+ETGRAR
Sbjct  241   WPPTNPKAKFSSLTVRGDILERLRPYLESGKIKAVIDPTGPYHFNDVIEAFRYLETGRAR  300

Query  1146  GKVVISPFPS  1175
             GKVV+S FPS
Sbjct  301   GKVVVSSFPS  310



>ref|XP_010272640.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Nelumbo nucifera]
Length=339

 Score =   417 bits (1073),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 223/310 (72%), Positives = 265/310 (85%), Gaps = 0/310 (0%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW++EE+GPKEVLKLGDF +P+ Q +QLLVQV+AAALNPIDFK RQ  + P +FPV+
Sbjct  1     MQKAWFFEEYGPKEVLKLGDFPLPILQPNQLLVQVRAAALNPIDFKRRQRPIFPSDFPVV  60

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCDMAG+VV KG GV KF IGDEVYGNI +FN EG+LK++GTLAE+  VEETLVA+KP 
Sbjct  61    PGCDMAGVVVGKGEGVMKFSIGDEVYGNIQDFNAEGKLKQLGTLAEYVAVEETLVALKPS  120

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             NL+F+ AASLPLA+QTA +GF TAGF+EGQS+FIVGGAGGVG+LAVQLAKHVYGAS V A
Sbjct  121   NLSFEEAASLPLAVQTAIEGFITAGFKEGQSIFIVGGAGGVGTLAVQLAKHVYGASRVVA  180

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             + SAPKVEFVK LGAD V+DYT T YE+I E YD +YDTIGD+ NSFVVAK+ A I+DIT
Sbjct  181   SCSAPKVEFVKSLGADLVIDYTKTKYEEIQEKYDFLYDTIGDTKNSFVVAKDGAPIVDIT  240

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
             WPPS+PRAV+S LTV G+ LE L P+LESGK+KAV+DP GP+ F +V+EAF Y+ETGRAR
Sbjct  241   WPPSHPRAVYSSLTVCGKNLESLWPYLESGKLKAVLDPTGPYRFTDVIEAFRYLETGRAR  300

Query  1146  GKVVISPFPS  1175
             GKV+I   PS
Sbjct  301   GKVIIIISPS  310



>ref|XP_008803293.1| PREDICTED: 2-methylene-furan-3-one reductase-like isoform X2 
[Phoenix dactylifera]
Length=310

 Score =   412 bits (1060),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 210/310 (68%), Positives = 257/310 (83%), Gaps = 4/310 (1%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW+YEE+GPKEVLK+GDF +P+ Q +QLLVQV+AAALNPIDFK RQ ++    F  +
Sbjct  1     MQKAWFYEEYGPKEVLKMGDFPLPILQQNQLLVQVRAAALNPIDFKRRQLAI----FASV  56

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCDMAGIV     GV+KF +G+EVYGNI +FN+  +LK++GTLAE+  VEE LVA+KP 
Sbjct  57    PGCDMAGIVADMAPGVSKFKVGEEVYGNIQDFNVPEKLKQLGTLAEYVAVEENLVALKPD  116

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             NL+F+ A SLPLA+QTA +GF TA FQ G+SVFIVGGAGGVG+L VQLAKH +GAS V A
Sbjct  117   NLSFEEAGSLPLALQTALEGFETANFQAGRSVFIVGGAGGVGTLVVQLAKHYFGASRVVA  176

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             T S+ KVEFVK LGAD V+DYT T YE+I E +D VYDTIG+S NSFVVAKE+A ++DIT
Sbjct  177   TCSSSKVEFVKSLGADMVIDYTATKYEEITEKFDFVYDTIGESKNSFVVAKEDAPVVDIT  236

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
             WPP+NP+A  S LTV G+ILE+L+P+LESGK+KAVIDP GP+HF +V+EAF Y+ETGRAR
Sbjct  237   WPPTNPKAKFSSLTVRGDILERLRPYLESGKIKAVIDPTGPYHFNDVIEAFRYLETGRAR  296

Query  1146  GKVVISPFPS  1175
             GKVV+S FPS
Sbjct  297   GKVVVSSFPS  306



>ref|XP_004510932.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Cicer arietinum]
Length=340

 Score =   398 bits (1023),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 205/310 (66%), Positives = 255/310 (82%), Gaps = 1/310 (0%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW+YEE+GPKEVLKLGD  IP P H+QLLVQV AAALNPID K R   + P  FPV+
Sbjct  3     MQKAWFYEEYGPKEVLKLGDLPIPSPLHNQLLVQVYAAALNPIDSKRRFRPIFPAEFPVV  62

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGEL-KRMGTLAEFTVVEETLVAMKP  602
             PGCDMAG+V+ KG+ V KF+IGDEVYGNI +FN   E  K++GTLA+F VVEE+LVA KP
Sbjct  63    PGCDMAGVVIGKGANVKKFNIGDEVYGNIQDFNNSMEKPKQLGTLAQFIVVEESLVARKP  122

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             K L+F+ AASLPLA+QTA +GF+T  F++GQ++F+VGGAGGVG+L +QLAK ++GAS V 
Sbjct  123   KCLSFEEAASLPLAVQTAIEGFKTGEFKKGQTIFVVGGAGGVGTLVLQLAKLLFGASYVV  182

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             ++ S PKV+FVK  GAD+VVDYT T YE I + +D +YDT+GD   SFV+AK++A I+DI
Sbjct  183   SSCSTPKVKFVKQFGADEVVDYTKTKYEDIQDKFDFLYDTVGDCKKSFVLAKKDAAIVDI  242

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             TWPPS+PRAV+S LTVSGEILEKL+P+LE G++K VIDP G +HF NV++AFGYIETGRA
Sbjct  243   TWPPSHPRAVYSSLTVSGEILEKLRPYLERGEIKPVIDPKGQYHFDNVIDAFGYIETGRA  302

Query  1143  RGKVVISPFP  1172
              GKVV+S FP
Sbjct  303   WGKVVVSHFP  312



>ref|XP_010934157.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Elaeis guineensis]
Length=357

 Score =   398 bits (1023),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 212/336 (63%), Positives = 252/336 (75%), Gaps = 26/336 (8%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW YEE+GPKEVLK+GDF +PV QHDQLLVQV+AAALNPIDFK RQ  + P   P++
Sbjct  1     MQKAWLYEEYGPKEVLKMGDFPLPVLQHDQLLVQVRAAALNPIDFKWRQQVIFPSGLPIV  60

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCDMAGIV     GV+KF +GDEVYGNI +FN   + K++GTLAE+  VEE LVA+KP 
Sbjct  61    PGCDMAGIVADIAPGVSKFKVGDEVYGNIQDFNAPEKWKQLGTLAEYVAVEENLVALKPD  120

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             NL+F+ A SLPLA+QTA +GF TA F+ GQS+FIVGGAGGVG+L VQLAKH +GAS V A
Sbjct  121   NLSFEEAGSLPLALQTALEGFETANFEAGQSMFIVGGAGGVGTLVVQLAKHYFGASRVVA  180

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTI--------------------  905
             T S+ KVEFVK LGAD V+DYT T YE+I E +D VYDTI                    
Sbjct  181   TCSSSKVEFVKSLGADVVIDYTTTKYEEIAEKFDFVYDTIGKTANHFMSICILLSGCLVE  240

Query  906   ------GDSINSFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKA  1067
                   GDS NS VVAKE A ++DITWPP+NP+A  S LTV G ILE+L+P LESGK+KA
Sbjct  241   SLCLLPGDSKNSSVVAKEEAPVVDITWPPTNPKAKFSSLTVRGAILERLRPHLESGKIKA  300

Query  1068  VIDPAGPFHFCNVVEAFGYIETGRARGKVVISPFPS  1175
             VIDP GP+HF +V+EAF ++ETGRARGKVV+S FPS
Sbjct  301   VIDPTGPYHFNDVMEAFRHLETGRARGKVVVSSFPS  336



>ref|XP_003627658.1| Quinone oxidoreductase-like protein [Medicago truncatula]
 gb|ACJ85946.1| unknown [Medicago truncatula]
 gb|AET02134.1| zinc-binding dehydrogenase family oxidoreductase [Medicago truncatula]
 gb|AFK41863.1| unknown [Medicago truncatula]
 gb|AFK47870.1| unknown [Medicago truncatula]
Length=342

 Score =   391 bits (1005),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 200/309 (65%), Positives = 249/309 (81%), Gaps = 0/309 (0%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW+YEE+GPKEVLKLGDF IP P  +QLLVQV AAALNPID K R   + P +FP +
Sbjct  3     MQKAWFYEEYGPKEVLKLGDFPIPSPLENQLLVQVYAAALNPIDSKRRMRPIFPSDFPAV  62

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCDMAG+V+ KG  V KFDIGDEVYGNI +FN   + K++GTLA+F VVEE LVA KPK
Sbjct  63    PGCDMAGVVIGKGVNVKKFDIGDEVYGNIQDFNSMEKPKQLGTLAQFIVVEENLVARKPK  122

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
              L+F+ AASLPLA+QTA +GF+T  F++G+++F+VGGAGGVG+L +QLAK ++GAS V +
Sbjct  123   RLSFEEAASLPLAVQTAIEGFKTGDFKKGETMFVVGGAGGVGTLVLQLAKLMFGASYVVS  182

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             + S PK++FVK  GADKVVDYT T YE I E +D +YDT+GD   SFVVAK++  I+DIT
Sbjct  183   SCSTPKLKFVKQFGADKVVDYTKTKYEDIEEKFDFIYDTVGDCKKSFVVAKKDGAIVDIT  242

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
             WP S+ RAV+S LTV GEILEKL+P+LE G++KAVIDP G + F NV++AFGYIETGRA 
Sbjct  243   WPASHERAVYSSLTVCGEILEKLRPYLERGELKAVIDPKGEYDFENVIDAFGYIETGRAW  302

Query  1146  GKVVISPFP  1172
             GKVV++ FP
Sbjct  303   GKVVVTCFP  311



>ref|XP_003627678.1| Quinone oxidoreductase-like protein [Medicago truncatula]
 ref|XP_003636303.1| Quinone oxidoreductase-like protein [Medicago truncatula]
 ref|XP_003636839.1| Quinone oxidoreductase-like protein [Medicago truncatula]
 gb|AET02154.1| zinc-binding dehydrogenase family oxidoreductase [Medicago truncatula]
Length=339

 Score =   386 bits (991),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 248/312 (79%), Gaps = 1/312 (0%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW+YEE+GPKEVLKLGDF IP P  +QLLVQV AAALNPID K R   + P  FP +
Sbjct  3     MQKAWFYEEYGPKEVLKLGDFPIPSPLENQLLVQVHAAALNPIDSKRRMRPIFPSEFPAV  62

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCDMAG+V+ KG  V KFDIGDEVYGNI +FN   + K++GTLA+F VVEE LVA KPK
Sbjct  63    PGCDMAGVVIGKGVNVKKFDIGDEVYGNIQDFNSMEKPKQLGTLAQFIVVEEKLVARKPK  122

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
              L+F+ AASLPLA+QTA +GF+T  F++G+++F+VGGAGGVG+L +QLAK ++GAS V +
Sbjct  123   CLSFEEAASLPLAVQTAIEGFKTGDFKKGETMFVVGGAGGVGTLVLQLAKLMFGASYVVS  182

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             + S PK++FVK  GADKVVDYT T YE I E +D +YDT+GD   SFVVAK++  I+DIT
Sbjct  183   SCSTPKLKFVKQFGADKVVDYTKTKYEDIEEKFDFLYDTVGDCKKSFVVAKKDGAIVDIT  242

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
             WP S+ RAV+S LTV GEILEKL+P+LE G++KAVIDP G + F NV++AFGYIETGRA 
Sbjct  243   WPASHERAVYSSLTVCGEILEKLRPYLERGELKAVIDPKGEYDFENVIDAFGYIETGRAW  302

Query  1146  GKVVISPFPSWH  1181
             GKVV++  P  H
Sbjct  303   GKVVVT-IPHHH  313



>ref|XP_006857996.1| hypothetical protein AMTR_s00069p00186560 [Amborella trichopoda]
 gb|ERN19463.1| hypothetical protein AMTR_s00069p00186560 [Amborella trichopoda]
Length=311

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 249/313 (80%), Gaps = 2/313 (1%)
 Frame = +3

Query  237   LQDMQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNF  416
             ++  QK W+Y+E+GPKEVL+ GDF +P P+ DQ+LVQV+A+ALNPIDFK+RQ  +VP   
Sbjct  1     MKCTQKTWFYKEYGPKEVLQFGDFPMPSPKSDQVLVQVKASALNPIDFKMRQRPIVPTPL  60

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             PV+PGCDMAG+VV  G GV+KF IGDEVYGNI +F+  GELK++GTLA++ VVEE+LVAM
Sbjct  61    PVVPGCDMAGVVVGSGDGVSKFRIGDEVYGNIQDFH--GELKQLGTLAQYIVVEESLVAM  118

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KP NLTF+ AASLPLA+QTA +GF+TA F+ GQ+VF+VGGAGGVGSLAVQLA +V+GAS 
Sbjct  119   KPPNLTFEEAASLPLALQTAVEGFKTAKFKAGQTVFVVGGAGGVGSLAVQLANNVFGASK  178

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             VAAT S  KVEFVK LGA+ VVDYT   Y QI E +D ++DTIGD+  S+VVAKE   ++
Sbjct  179   VAATCSTKKVEFVKSLGAEVVVDYTQQGYHQILEKFDFIFDTIGDTNKSYVVAKEEGAVV  238

Query  957   DITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
             DITWPPSNPRAV S L VSG+ L +L P++ SGK+K +ID   P+ F  V EAF Y+ETG
Sbjct  239   DITWPPSNPRAVISSLVVSGDGLARLHPYILSGKLKPIIDLTSPYDFDRVPEAFAYLETG  298

Query  1137  RARGKVVISPFPS  1175
             RA GKVVIS   S
Sbjct  299   RAWGKVVISSISS  311



>emb|CDP17797.1| unnamed protein product [Coffea canephora]
Length=276

 Score =   343 bits (879),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 180/264 (68%), Positives = 216/264 (82%), Gaps = 2/264 (1%)
 Frame = +3

Query  216   FSTEP--NGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLR  389
             F+T P  N  + MQKAW+ EEHGP EVL+LG   +P P+ +QLLV V+AAALNPIDFKLR
Sbjct  13    FTTLPGENNQKRMQKAWFNEEHGPPEVLQLGYLPVPSPKENQLLVSVRAAALNPIDFKLR  72

Query  390   QTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFT  569
             Q  LV   FPV+PGCDMAG+VVAKG G+++F +GDEVYGNI +FN EG LK++G LAEF 
Sbjct  73    QKPLVSTTFPVVPGCDMAGVVVAKGDGISRFCVGDEVYGNIQDFNAEGNLKQLGVLAEFI  132

Query  570   VVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql  749
             +VEE LVA KP+NL+F+ AASLP+A+QTA +GF+ AGF++GQ+VFI GGAGGVG+LAVQL
Sbjct  133   LVEENLVARKPENLSFEEAASLPVALQTAVEGFKVAGFKKGQTVFIFGGAGGVGTLAVQL  192

Query  750   aKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV  929
             AKH YGAS V ATTS PKVEFVK LGADKVVDY  T YE++ E YDLVYDTIGDS  S V
Sbjct  193   AKHFYGASLVTATTSTPKVEFVKGLGADKVVDYRKTKYEKVEEKYDLVYDTIGDSKYSSV  252

Query  930   VAKENATIIDITWPPSNPRAVHSG  1001
             V+K++  +IDITWPPSNP A+HSG
Sbjct  253   VSKDDMLLIDITWPPSNPGAIHSG  276



>gb|ABK22154.1| unknown [Picea sitchensis]
Length=313

 Score =   332 bits (851),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 180/309 (58%), Positives = 232/309 (75%), Gaps = 3/309 (1%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL--VPMNFP  419
             MQKAW+Y E+GP+ VL+ GDF +P     Q+LV+V+AAALNP+DFKLR        + FP
Sbjct  4     MQKAWFYNEYGPRAVLQYGDFPVPQLGDTQVLVRVRAAALNPVDFKLRNGVFKDTGLEFP  63

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
             V+PGCD+AG++V +G  V+ F  GDEVYGNI +FN  G  K+ GTL ++T VEE+L+A+K
Sbjct  64    VVPGCDVAGVIVDEGDNVSMFSKGDEVYGNIQSFNTVGP-KQYGTLTQYTAVEESLIALK  122

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P+N++F+ AAS PLA+QTA +GF  A FQ GQ+VFIVGG GGVGSLA+QLAK+VYGAS +
Sbjct  123   PENMSFEEAASFPLALQTAQEGFDRAKFQRGQTVFIVGGEGGVGSLAIQLAKYVYGASKI  182

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             A TTS  KV+FVK LG D V+DYT  +Y+QI E +D V+DTIGDS  S+VVAKE   IID
Sbjct  183   ATTTSPGKVDFVKKLGPDMVIDYTKKSYDQILEKFDFVFDTIGDSHRSYVVAKEEGKIID  242

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I     +PRA    +T SG  LE+L+ ++E  K+K VIDP GP+ F NV+EAF ++E+GR
Sbjct  243   IANSSPHPRAEFYIVTPSGSNLERLRSYIECEKLKPVIDPTGPYAFSNVMEAFKHLESGR  302

Query  1140  ARGKVVISP  1166
             ARGKVVISP
Sbjct  303   ARGKVVISP  311



>ref|XP_003636240.1| Quinone oxidoreductase-like protein, partial [Medicago truncatula]
Length=304

 Score =   332 bits (850),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 174/279 (62%), Positives = 219/279 (78%), Gaps = 1/279 (0%)
 Frame = +3

Query  345   QVQAAALNPIDFKLRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFN  524
             QV AAALNPID K R   + P  FP +PGCDMAG+V+ KG  V KFDIGDEVYGNI +FN
Sbjct  1     QVHAAALNPIDSKRRMRPIFPSEFPAVPGCDMAGVVIGKGVNVKKFDIGDEVYGNIQDFN  60

Query  525   LEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVF  704
                + K++GTLA+F VVEE LVA KPK L+F+ AASLPLA+QTA +GF+T  F++G+++F
Sbjct  61    SMEKPKQLGTLAQFIVVEEKLVARKPKCLSFEEAASLPLAVQTAIEGFKTGDFKKGETMF  120

Query  705   IvggaggvgslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETY  884
             +VGGAGGVG+L +QLAK ++GAS V ++ S PK++FVK  GADKVVDYT T YE I E +
Sbjct  121   VVGGAGGVGTLVLQLAKLMFGASYVVSSCSTPKLKFVKQFGADKVVDYTKTKYEDIEEKF  180

Query  885   DLVYDTIGDSINSFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVK  1064
             D +YDT+GD   SFVVAK++  I+DITWP S+ RAV+S LTV GEILEKL+P+LE G++K
Sbjct  181   DFLYDTVGDCKKSFVVAKKDGAIVDITWPASHERAVYSSLTVCGEILEKLRPYLERGELK  240

Query  1065  AVIDPAGPFHFCNVVEAFGYIETGRARGKVVISPFPSWH  1181
             AVIDP G + F NV++AFGYIETGRA GKVV++  P  H
Sbjct  241   AVIDPKGEYDFENVIDAFGYIETGRAWGKVVVT-IPHHH  278



>gb|KCW72924.1| hypothetical protein EUGRSUZ_E01364 [Eucalyptus grandis]
Length=243

 Score =   308 bits (789),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 196/227 (86%), Gaps = 1/227 (0%)
 Frame = +3

Query  246  MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
            MQKAW+YEE+G KEVLKLGDF  P PQH+Q++VQV+AAALNPIDFK RQ  + P +FPV+
Sbjct  1    MQKAWFYEEYGSKEVLKLGDFPFPTPQHNQIIVQVRAAALNPIDFKRRQRPIFPSDFPVV  60

Query  426  PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
            PGCDMAG+VVAKG+GVTKFD+GD VYGNI +FN  G+LK++GTLAEF  VEETLVAMKP+
Sbjct  61   PGCDMAGVVVAKGTGVTKFDLGDAVYGNIQDFNAPGKLKQLGTLAEFIAVEETLVAMKPQ  120

Query  606  NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
            NL+F+ AASLPLA+QTA +GF TA F+EGQ+VFIVGGAGGVG+LAVQLAK+ Y AS V A
Sbjct  121  NLSFEEAASLPLAVQTAMEGFVTADFKEGQTVFIVGGAGGVGTLAVQLAKNFYNASYVVA  180

Query  786  TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSF  926
            T S+ KVEFVK LGADKV+DYTNT YE+I E +D +YDTI D+I++F
Sbjct  181  TCSSAKVEFVKKLGADKVIDYTNTKYEEIKEKFDFLYDTI-DAISTF  226



>gb|ABK21418.1| unknown [Picea sitchensis]
 gb|ACN39940.1| unknown [Picea sitchensis]
Length=310

 Score =   300 bits (769),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 230/309 (74%), Gaps = 3/309 (1%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL--VPMNFP  419
             MQKAW+Y E+G  +VL+ G+F +P P   ++L++++AAALNP+D+K R+        +FP
Sbjct  1     MQKAWFYNEYGSIDVLQFGEFPVPKPGPGEILLKIRAAALNPVDYKKREGLFRSADCDFP  60

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PGCD AG+VV  G GV+K  IGDEVY +I +F   G  K++GTLA++TVVEE LVA K
Sbjct  61    AVPGCDAAGVVVEVGDGVSKLKIGDEVYSDIQHFTA-GRPKQLGTLAQYTVVEEHLVAPK  119

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P NL+F+ AASLPLA+ TA + F  A F++GQSVFIVGGAGGVGSLA+QLAKHVYGAS +
Sbjct  120   PTNLSFEEAASLPLAVLTAQEAFDIAKFEKGQSVFIVGGAGGVGSLAIQLAKHVYGASRI  179

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
              +T S  K++FVK LGAD V+DYT  +Y+QI E +D V+DTIG+S  S VVAKE A ++D
Sbjct  180   VSTASTGKLDFVKSLGADLVIDYTKQSYDQISEKFDFVFDTIGESAKSHVVAKEEAKVLD  239

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I     +PRA    ++ SG  LEKL+P++ES K+K VIDP  P+ F +V+EAF + E+GR
Sbjct  240   IASFQPHPRAEFFLVSPSGHNLEKLQPYIESEKLKPVIDPKSPYSFSDVIEAFKHQESGR  299

Query  1140  ARGKVVISP  1166
             ARGK+VISP
Sbjct  300   ARGKIVISP  308



>gb|ABK25870.1| unknown [Picea sitchensis]
Length=313

 Score =   300 bits (768),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 175/312 (56%), Positives = 230/312 (74%), Gaps = 3/312 (1%)
 Frame = +3

Query  237   LQDMQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLR--QTSLVPM  410
             +  +QKAW+Y E+G  +VL+ G+  +P P   QLLV+++AAALNP+DFK R  +  +   
Sbjct  1     MSKLQKAWFYNEYGSIDVLQFGEVPVPTPGPGQLLVKIRAAALNPVDFKRRDGRIRIADS  60

Query  411   NFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLV  590
             +FP +PGCD AG+VV  G GV+KF  GDEVY +I NF + G+ K+ GTLA++TVVEE LV
Sbjct  61    DFPTVPGCDAAGVVVEVGDGVSKFKNGDEVYSDIQNFVV-GKRKQWGTLAQYTVVEEYLV  119

Query  591   AMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGA  770
             A KP NL+F+ AASLPLA+ TA Q F  A F++G+SVFIVGGAGGVGSLA+QLA+HVY A
Sbjct  120   APKPTNLSFEEAASLPLALLTAQQAFDIAKFEKGKSVFIVGGAGGVGSLAIQLARHVYEA  179

Query  771   SSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENAT  950
             S + +T S  K++FVK LGAD V+DYT  +Y+QI E +D V+DTIGDS  S VVAKE A 
Sbjct  180   SKIVSTASTGKLDFVKNLGADLVIDYTKQSYDQISEKFDFVFDTIGDSSKSHVVAKEEAK  239

Query  951   IIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
             I+DI     + R     L+  G+ LEKL+P++ESGK+K VIDP  P+ F +V+EAF + E
Sbjct  240   ILDIASFQPHSRIEFFRLSPHGQNLEKLQPYIESGKLKPVIDPKSPYSFSDVIEAFKHQE  299

Query  1131  TGRARGKVVISP  1166
             +GRARGK+VISP
Sbjct  300   SGRARGKIVISP  311



>gb|ABK26019.1| unknown [Picea sitchensis]
 gb|ACN40536.1| unknown [Picea sitchensis]
Length=310

 Score =   298 bits (762),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 230/309 (74%), Gaps = 3/309 (1%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL--VPMNFP  419
             MQKAW+Y E+G  +VL+ G+F +P P   ++L++++AAALNP+D+K R+        +FP
Sbjct  1     MQKAWFYNEYGSIDVLQFGEFPVPKPGPGEILLKIRAAALNPVDYKKREGLFRSADCDFP  60

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PGCD AG+VV  G GV+KF IGDEVY +I +F   G  K++GTLA++TVVEE LVA K
Sbjct  61    AVPGCDAAGVVVEVGDGVSKFKIGDEVYSDIQHFTA-GRPKQLGTLAQYTVVEEHLVAPK  119

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P NL+F+ AASLPLA+ TA + F  A F++GQSVFIVGGAGGVGSLA+QLAKHVYGAS +
Sbjct  120   PTNLSFEEAASLPLAVLTAQEAFDIAKFEKGQSVFIVGGAGGVGSLAIQLAKHVYGASRI  179

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
              +T S  K++FVK LGAD V+DYT  +Y+QI E +D V+DTIG++  S VVAKE A ++D
Sbjct  180   VSTASTGKLDFVKSLGADLVIDYTKQSYDQISEKFDFVFDTIGEAAKSHVVAKEEAKVLD  239

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I     +PRA    ++ S   LEKL+P++ES K+K VIDP  P+ F +V+EAF + E+GR
Sbjct  240   IASFQPHPRAEFFLVSPSAHNLEKLQPYIESEKLKPVIDPKSPYSFSDVIEAFKHQESGR  299

Query  1140  ARGKVVISP  1166
             A+GK+VISP
Sbjct  300   AKGKIVISP  308



>gb|ABR16979.1| unknown [Picea sitchensis]
Length=318

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 173/318 (54%), Positives = 234/318 (74%), Gaps = 13/318 (4%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL--VPMNFP  419
             MQKAW+Y E+G  +VL+ G+F +P P   ++L++++AAALNP+D+K R+        +FP
Sbjct  1     MQKAWFYNEYGSIDVLQFGEFPVPKPGPGEILLKIRAAALNPVDYKKREGLFRSADCDFP  60

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PGCD AG+VV  G GV+KF IGDEVY +I NF   G  K++GTLA++T+VEE LVA K
Sbjct  61    AVPGCDAAGVVVEVGDGVSKFKIGDEVYSDIQNFTA-GRPKQLGTLAQYTLVEEHLVAPK  119

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P NL+F+ AASLPLA+ TA + F  A F++GQSVFIVGGAGGVGSLA+QLAKHVYGAS +
Sbjct  120   PTNLSFEEAASLPLAVLTAQEAFDIAKFEKGQSVFIVGGAGGVGSLAIQLAKHVYGASRI  179

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
              +T S  K++FVK LGAD V+DYT  +Y+QI E +D V+DTIG++  S VVAKE A ++D
Sbjct  180   VSTASTGKLDFVKSLGADLVIDYTKQSYDQISEKFDFVFDTIGEAAKSHVVAKEEAKVLD  239

Query  960   I---------TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
             I         ++ P +PRA    ++ S   LEKL+P++ES K+K VIDP  P+ F +V+E
Sbjct  240   IGVAKEDDMASFQP-HPRAEFFLVSSSAHNLEKLQPYIESEKLKPVIDPKSPYSFSDVIE  298

Query  1113  AFGYIETGRARGKVVISP  1166
             AF ++E+GRARGK+VISP
Sbjct  299   AFKHLESGRARGKIVISP  316



>gb|ABK23140.1| unknown [Picea sitchensis]
 gb|ACN40004.1| unknown [Picea sitchensis]
 gb|ACN40440.1| unknown [Picea sitchensis]
Length=313

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 225/312 (72%), Gaps = 3/312 (1%)
 Frame = +3

Query  237   LQDMQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLV--PM  410
             +  +QKAW+Y E+G  +VL+ G+  +P P   QLLV+++AAALNP+DFK R         
Sbjct  1     MSKLQKAWFYNEYGSIDVLQFGEVPVPTPGPGQLLVKIRAAALNPVDFKRRDGLFRNKDS  60

Query  411   NFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLV  590
             +FP +PGCD AG+VV  G GV+KF  GDEVY +I +F   G  K+ GTLA++TVVEE LV
Sbjct  61    DFPAVPGCDAAGVVVEVGDGVSKFKNGDEVYSDIQDFGA-GRPKQWGTLAQYTVVEEYLV  119

Query  591   AMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGA  770
             A KP NL+F+ AASLPLA+ TA Q F  A F++G+SVFIVGGAGGVGSLA+QLA+HVYGA
Sbjct  120   APKPTNLSFEEAASLPLALLTAQQAFDIAKFEKGKSVFIVGGAGGVGSLAIQLARHVYGA  179

Query  771   SSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENAT  950
             S + +T S  K++FVK LGAD V+DYT  +Y+QI E +D V+DTIGDS  S VVAKE A 
Sbjct  180   SRIVSTASTGKLDFVKSLGADLVIDYTKQSYDQISEKFDFVFDTIGDSAKSHVVAKEEAK  239

Query  951   IIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
             I+DI       R    G++   + LEKL+P++ES K+K VIDP  P+ F +V+EAF + E
Sbjct  240   ILDIASFQPTSRVEFFGVSPHAKNLEKLQPYIESEKLKPVIDPKSPYSFSDVIEAFKHQE  299

Query  1131  TGRARGKVVISP  1166
             +GRARGK+VISP
Sbjct  300   SGRARGKIVISP  311



>gb|ABK27011.1| unknown [Picea sitchensis]
Length=313

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 230/313 (73%), Gaps = 5/313 (2%)
 Frame = +3

Query  237   LQDMQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLV--PM  410
             +  +QKAW+Y E+G  +VL+ G+  +P P   QLLV+++AAALNP+DFK R         
Sbjct  1     MSKLQKAWFYNEYGSIDVLQFGEVPVPTPGPGQLLVKIRAAALNPVDFKRRNGLFRNKDS  60

Query  411   NFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLV  590
             +FP +PGCD AG+VV  G GV+KF  GDEVY +I NF + G  K+ GTLA++TVVEE LV
Sbjct  61    DFPAVPGCDAAGVVVEVGDGVSKFKNGDEVYSDIQNF-VTGRPKQWGTLAQYTVVEEYLV  119

Query  591   AMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGA  770
             A KP NL+F+ AASLPLA+ TA Q F  A F++G+SVFIVGGAGGVGSLA+QLA+HVYGA
Sbjct  120   APKPTNLSFEEAASLPLALLTAQQAFDIAKFEKGKSVFIVGGAGGVGSLAIQLARHVYGA  179

Query  771   SSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENAT  950
             S + +T S  K++FVK LGAD V+DYT  +Y+QI E +D V+DTIGDS  S VVAKE A 
Sbjct  180   SKIVSTASTGKLDFVKSLGADLVIDYTKQSYDQISEKFDFVFDTIGDSAKSHVVAKEEAK  239

Query  951   IIDI-TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYI  1127
             I+DI T+ P++ R     ++   + L+KL+P++ES K+K VIDP  P+ F +V+EAF + 
Sbjct  240   IVDIATFQPTS-RVERILVSPHAKNLQKLQPYIESEKLKPVIDPKSPYSFSDVIEAFKHQ  298

Query  1128  ETGRARGKVVISP  1166
             E+GRARGK+VISP
Sbjct  299   ESGRARGKIVISP  311



>gb|KDP26584.1| hypothetical protein JCGZ_17742 [Jatropha curcas]
Length=387

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 162/310 (52%), Positives = 210/310 (68%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLK  D + +P  + DQ+L++V AAALNP+DFK RQ      +   P 
Sbjct  80    KAWVYGEYGGVDVLKFDDKVSVPEVKDDQVLIKVAAAALNPVDFKRRQGKFKATDSLLPT  139

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V     GDEVYG+IH   LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  140   VPGYDVAGVVVKVGSQVKGLKEGDEVYGDIHEKALEGP-KQFGSLAEYTAVEEKLLALKP  198

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AASLPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAKHV+GAS +A
Sbjct  199   KNLDFAQAASLPLAIETAYEGLEKTGFSAGKSILVLNGSGGVGSLVIQLAKHVFGASRIA  258

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S   +E +K LGAD  +DYT   +E +PE +D+VYD IG    +    KE  +++ +
Sbjct  259   ATSSTRNLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVKAIKEGGSVVAL  318

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +GE+L+KL PFLESGK+K VIDP GPF F  V EAF YIETGRA
Sbjct  319   TGAVTPP-GFRFVVTSNGEVLKKLNPFLESGKIKPVIDPKGPFAFSQVAEAFSYIETGRA  377

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  378   TGKVVIHPIP  387



>ref|XP_009762380.1| PREDICTED: 2-methylene-furan-3-one reductase [Nicotiana sylvestris]
Length=388

 Score =   286 bits (731),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 217/312 (70%), Gaps = 9/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y ++G  +VLK   +  +P  + DQ+L++V AAALNP+DFK R       +   P 
Sbjct  81    KAWTYTDYGSADVLKFESNVSVPEIREDQVLIKVVAAALNPVDFKRRLGKFKATDSPLPT  140

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V    +GDEVYG+IH   L+G  K+ G+LAEFT VEE LVA+KP
Sbjct  141   VPGYDVAGVVVKVGSEVKGVKVGDEVYGDIHEKALDGP-KQFGSLAEFTAVEEKLVALKP  199

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL+F  AASLPLAI+TA +G   AGF  G+S+ ++GGAGGVGSL +Q+AKHV+GAS VA
Sbjct  200   KNLSFAEAASLPLAIETAYEGLEKAGFSAGKSILVLGGAGGVGSLVIQIAKHVFGASKVA  259

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+E +K LGAD  +DYT   +E +PE +D+VYDT+G    +    KE  +++ +
Sbjct  260   ATSSTGKLELLKSLGADLAIDYTKDNFEDLPEKFDVVYDTVGQGEKAVKAVKEGGSVVVL  319

Query  963   TWPPSNP--RAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
             T   + P  R V   +T +GE+L+KL P+LESGKVK VIDP GPF F  VVEAF Y+ETG
Sbjct  320   TGAVTPPGFRFV---VTSNGEMLKKLNPYLESGKVKPVIDPKGPFPFDKVVEAFSYLETG  376

Query  1137  RARGKVVISPFP  1172
             RA GKVVI P P
Sbjct  377   RAAGKVVIHPIP  388



>ref|XP_008230611.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Prunus mume]
Length=322

 Score =   282 bits (722),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 160/321 (50%), Positives = 221/321 (69%), Gaps = 12/321 (4%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGPK-EVLKLGDFLIPVP--QHDQLLVQVQAAALNPIDFKLR----  389
             + +  + KAW Y E+G   +VLKL D  +PVP  + DQ+L++V AAALNP+D+K      
Sbjct  7     DSIPSVNKAWVYSEYGKSADVLKL-DPNVPVPDIKEDQVLIKVVAAALNPVDYKRMFGYF  65

Query  390   QTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFT  569
             + +  P+  P +PG D+AG+VV  GS VTKF +GDEVYG+++      + K+ G+LAE+T
Sbjct  66    KATDSPL--PTVPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNE--KAAQPKKFGSLAEYT  121

Query  570   VVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql  749
               EE ++A+KPKNL+F  AASLPLAI+TA +G     F  G+S+ ++GGAGGVG+  +QL
Sbjct  122   AAEERVLALKPKNLSFVEAASLPLAIETAYEGLERTEFSAGKSILVLGGAGGVGTHVIQL  181

Query  750   aKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV  929
             AKHV+GAS+VAAT S  K+E ++ LGAD  VDYT   +E++PE +D+VYDT+G+S  +  
Sbjct  182   AKHVFGASNVAATASTRKLELLRSLGADLAVDYTKEKFEELPEKFDVVYDTVGESDRAVK  241

Query  930   VAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVV  1109
               KE   ++ I   P+ P  VH  LT +G +LEKLKP+LESGKVK V+DP  P+ F   V
Sbjct  242   AVKEGGKVLTIVSGPAAPPVVHFALTSTGTVLEKLKPYLESGKVKPVLDPTSPYPFSKTV  301

Query  1110  EAFGYIETGRARGKVVISPFP  1172
             EAF Y+ET RA GKVV+ P P
Sbjct  302   EAFAYLETSRATGKVVVHPIP  322



>gb|EAZ06824.1| hypothetical protein OsI_29063 [Oryza sativa Indica Group]
Length=309

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 209/312 (67%), Gaps = 9/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y+++G   VLKL D   +P    DQ+LV+V AAALNP+D K R       +   P 
Sbjct  2     KAWAYDDYGDGSVLKLNDAAAVPDIADDQVLVRVAAAALNPVDAKRRAGKFKATDSPLPT  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  G  V     GDEVYGNI    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  62    VPGYDVAGVVVKAGRKVKGLKEGDEVYGNISEKALEGP-KQSGSLAEYTAVEEKLLALKP  120

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             K+L F  AA LPLA++TA +G   AGF  G+S+ I+GGAGGVGSLA+QLAKHVYGAS VA
Sbjct  121   KSLGFAQAAGLPLAVETAHEGLERAGFSAGKSILILGGAGGVGSLAIQLAKHVYGASKVA  180

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S PK+E +K LGAD  +DYT   +E +P+ YD+V D +G    +  V KE  +++ +
Sbjct  181   ATASTPKLELLKSLGADVAIDYTKENFEDLPDKYDVVLDAVGQGEKAVKVVKEGGSVVVL  240

Query  963   TWP--PSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
             T    P   R V   +T  G +LEKL P+LESGKVK ++DP GPF F  VVEAF Y+ETG
Sbjct  241   TGAVVPPGFRFV---VTSDGSVLEKLNPYLESGKVKPLVDPKGPFAFSQVVEAFSYLETG  297

Query  1137  RARGKVVISPFP  1172
             RA GKVVISP P
Sbjct  298   RATGKVVISPIP  309



>ref|XP_004297634.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=394

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 165/318 (52%), Positives = 216/318 (68%), Gaps = 7/318 (2%)
 Frame = +3

Query  219   STEPNGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQ  392
             + E + +    KAW YEE+G  +VLK  D  + VP+   DQ+L++V AAALNP+DFK RQ
Sbjct  76    TAEASTVPSEMKAWVYEEYGGVDVLKF-DTKVAVPELLDDQVLIKVMAAALNPVDFKRRQ  134

Query  393   TSLVPMN--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEF  566
                   +   P +PG D+AG+VV  GS V  F +GDEVYG+IH   L+G  K+ G+LAE+
Sbjct  135   GKFQSTDSPLPTVPGYDVAGVVVKVGSQVKDFKVGDEVYGDIHEKALDGP-KQSGSLAEY  193

Query  567   TVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavq  746
             T VEE L+A+KPKNL F  AASLPLAI+TA +G    GF  G+S+ ++ GAGGVGSL +Q
Sbjct  194   TAVEERLIALKPKNLDFAQAASLPLAIETAYEGLERTGFSAGKSLLVLNGAGGVGSLVIQ  253

Query  747   laKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSF  926
             LAKHV+GAS VAAT+S  K+E +K LGAD  +DYT    E++PE +D+VYD IG    + 
Sbjct  254   LAKHVFGASKVAATSSTKKLELLKSLGADLAIDYTKENIEELPEKFDVVYDAIGQCDKAV  313

Query  927   VVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNV  1106
              V KE  +++ +T   + P      +T +G +L+KL P+LESGKVK VIDP GPF F  V
Sbjct  314   KVVKEGGSVVALTGAVTPP-GFRFVVTSNGAVLKKLNPYLESGKVKPVIDPKGPFPFSKV  372

Query  1107  VEAFGYIETGRARGKVVI  1160
             VEAF Y+ET RA GKVVI
Sbjct  373   VEAFSYLETNRATGKVVI  390



>ref|XP_007215684.1| hypothetical protein PRUPE_ppa008680mg [Prunus persica]
 gb|EMJ16883.1| hypothetical protein PRUPE_ppa008680mg [Prunus persica]
Length=322

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/315 (51%), Positives = 216/315 (69%), Gaps = 10/315 (3%)
 Frame = +3

Query  246   MQKAWYYEEHGPK-EVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN-  413
             + KAW Y E+G   +VLKL D  +PVP+   DQ+L++V AAALNPID+K R    +    
Sbjct  12    VNKAWVYSEYGKSADVLKL-DPNVPVPEIKEDQVLIKVVAAALNPIDYK-RMFGYIKATD  69

Query  414   --FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETL  587
                P +PG D+AG+VV  GS VTKF +GDEVYG+++      + K+ G+LAE+T  EE +
Sbjct  70    SPLPTVPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNE--KAAQPKKFGSLAEYTAAEERV  127

Query  588   VAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYG  767
             +A+KPKNL+F  AASLPLAI+TA +G     F  G+S+ ++GGAGGVG+  +QLAKHV+G
Sbjct  128   LALKPKNLSFVEAASLPLAIETAYEGLERTEFSAGKSILVLGGAGGVGTHVIQLAKHVFG  187

Query  768   ASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENA  947
             AS VAAT S  K+E ++ LGAD  VDYT   +E++PE +D+VYDT+G+S  +    KE  
Sbjct  188   ASKVAATASTRKLELLRSLGADLAVDYTKEKFEELPEKFDVVYDTVGESDRAVKAVKEGG  247

Query  948   TIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYI  1127
              ++ I   P+ P AVH  LT +G +LEKLKP+LE GKVK V+DP  P+ F   VEAF Y+
Sbjct  248   KVVTIVSGPAAPPAVHFVLTSTGTVLEKLKPYLEGGKVKPVLDPTSPYPFSKTVEAFAYL  307

Query  1128  ETGRARGKVVISPFP  1172
             ET RA GKVV+ P P
Sbjct  308   ETSRATGKVVVHPIP  322



>ref|XP_006659368.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Oryza brachyantha]
Length=379

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 211/312 (68%), Gaps = 9/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y+E+G   VLK  D   +P    +Q+LV+V AAALNP+D K R       +   P 
Sbjct  72    KAWAYDEYGDGGVLKFNDAAAVPAVGEEQVLVRVAAAALNPVDAKRRAGKFKATDSPLPT  131

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V     GDEVYGNI    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  132   VPGYDVAGVVVKTGSQVKGLKEGDEVYGNISEKALEGP-KQSGSLAEYTAVEEKLLALKP  190

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             K L F  AA LPLA++TA +G   AGF  G+S+ I+GGAGGVGSLA+QLAKHVYGAS VA
Sbjct  191   KGLDFAQAAGLPLAVETAHEGLERAGFSAGKSILILGGAGGVGSLAIQLAKHVYGASKVA  250

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S PK+E +K LGAD  +DYT   +E++P+ YD+V+D +G    +  V KE  +++ +
Sbjct  251   ATASTPKLELLKTLGADVAIDYTKENFEELPDKYDIVFDAVGQGEKAVKVVKEGGSVVVL  310

Query  963   TWPPSNP--RAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
             T   + P  R V   +T  G +LEKL P+LESGKVK ++DP GPF F  VVEAF Y+ETG
Sbjct  311   TGAVAPPGFRFV---VTSDGSVLEKLNPYLESGKVKPLVDPKGPFAFSQVVEAFSYLETG  367

Query  1137  RARGKVVISPFP  1172
             RA GKVVISP P
Sbjct  368   RATGKVVISPIP  379



>gb|EMT05900.1| Quinone oxidoreductase-like protein [Aegilops tauschii]
Length=309

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 164/310 (53%), Positives = 208/310 (67%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW YEE+G   VLKL + + +P    DQ+LV+V AAALNP+D K R       +   P 
Sbjct  2     KAWAYEEYGDASVLKLDEAVSVPAVGEDQVLVRVAAAALNPVDSKRRMGKFKATDSPLPT  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG DMAG+VV  GS V     GDEVYG+I    LEG  K+ G+LAE+T VEE LVA+KP
Sbjct  62    VPGYDMAGVVVKVGSQVKNLKEGDEVYGHISEKVLEGP-KQFGSLAEYTAVEEKLVALKP  120

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             K++ F  AA LPLAI+TA +G   AGF  G+S+ ++GGAGGVG+L +QLAK VYGAS VA
Sbjct  121   KSIDFAQAAGLPLAIETAHEGLERAGFSAGKSILVLGGAGGVGTLVIQLAKQVYGASKVA  180

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S PK+E +K LGAD  +DYT   +E +PE YD+V+D +G    +  V KE  +++ +
Sbjct  181   ATASTPKLELLKSLGADVAIDYTKENFEDMPEKYDVVFDAVGQGEKAVKVVKEGGSVVVL  240

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T  G +L KL P+LESGKVK V+DP GPF F  VVEAF Y+ETGRA
Sbjct  241   TGAVAPP-GFRFVVTSDGSVLAKLNPYLESGKVKPVVDPKGPFPFSQVVEAFSYLETGRA  299

Query  1143  RGKVVISPFP  1172
              GKVVISP P
Sbjct  300   TGKVVISPVP  309



>ref|XP_011071085.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Sesamum indicum]
Length=309

 Score =   280 bits (716),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 219/311 (70%), Gaps = 7/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN---FP  419
             KAW Y E+G  EVLKL  +  +P  + DQ+L++V AAALNP+DFK R+  L+       P
Sbjct  2     KAWIYSEYGGVEVLKLESNVAVPEVKDDQVLIKVAAAALNPVDFK-RRLGLIKATDSPLP  60

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
             ++PG D+AGIVV  GS V +   GDEVYG+I+   LE + K++G+LAE+TV EE L+A+K
Sbjct  61    IVPGHDVAGIVVKVGSQVKELKEGDEVYGDINEKALE-KPKQLGSLAEYTVAEEKLLAVK  119

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P+NL F  AA+LPLAI+TA +G   AG  EG+S+ ++GGAGGVGSL +QLAK V+GAS +
Sbjct  120   PRNLDFVQAAALPLAIETAYEGLEKAGLSEGKSILVLGGAGGVGSLVIQLAKQVFGASRI  179

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K+EF+K LGAD V+DYT   +E +PE +D+VYD +G S  +    KE   ++ 
Sbjct  180   AATSSTQKLEFLKSLGADLVIDYTKENFEDLPEKFDVVYDAVGQSDRAVKAVKEGGGVVT  239

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I + P  P A+   +T +GE L+KL P+LESGKVKAV+DP GPF F  V EAF Y+ET R
Sbjct  240   I-FGPVTPPAIGFVVTSNGEFLKKLNPYLESGKVKAVLDPNGPFPFDKVNEAFSYLETNR  298

Query  1140  ARGKVVISPFP  1172
             A GKVVI P P
Sbjct  299   ATGKVVIFPIP  309



>ref|NP_001061691.1| Os08g0379400 [Oryza sativa Japonica Group]
 dbj|BAD05410.1| putative oxidoreductase, zinc-binding [Oryza sativa Japonica 
Group]
 dbj|BAD05630.1| putative oxidoreductase, zinc-binding [Oryza sativa Japonica 
Group]
 dbj|BAF23605.1| Os08g0379400 [Oryza sativa Japonica Group]
 gb|EAZ42571.1| hypothetical protein OsJ_27134 [Oryza sativa Japonica Group]
 dbj|BAG91516.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96595.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98745.1| unnamed protein product [Oryza sativa Japonica Group]
Length=390

 Score =   281 bits (720),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 167/312 (54%), Positives = 209/312 (67%), Gaps = 9/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y+++G   VLKL D   +P    DQ+LV+V AAALNP+D K R       +   P 
Sbjct  83    KAWAYDDYGDGSVLKLNDAAAVPDIADDQVLVRVAAAALNPVDAKRRAGKFKATDSPLPT  142

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  G  V     GDEVYGNI    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  143   VPGYDVAGVVVKAGRKVKGLKEGDEVYGNISEKALEGP-KQSGSLAEYTAVEEKLLALKP  201

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             K+L F  AA LPLAI+TA +G   AGF  G+S+ I+GGAGGVGSLA+QLAKHVYGAS VA
Sbjct  202   KSLGFAQAAGLPLAIETAHEGLERAGFSAGKSILILGGAGGVGSLAIQLAKHVYGASKVA  261

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S PK+E +K LGAD  +DYT   +E +P+ YD+V D +G    +  V KE  +++ +
Sbjct  262   ATASTPKLELLKSLGADVAIDYTKENFEDLPDKYDVVLDAVGQGEKAVKVVKEGGSVVVL  321

Query  963   TWP--PSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
             T    P   R V   +T  G +LEKL P+LESGKVK ++DP GPF F  VVEAF Y+ETG
Sbjct  322   TGAVVPPGFRFV---VTSDGSVLEKLNPYLESGKVKPLVDPKGPFAFSQVVEAFSYLETG  378

Query  1137  RARGKVVISPFP  1172
             RA GKVVISP P
Sbjct  379   RATGKVVISPIP  390



>ref|XP_004238663.1| PREDICTED: 2-methylene-furan-3-one reductase [Solanum lycopersicum]
 sp|K4BW79.1|ENOX_SOLLC RecName: Full=2-methylene-furan-3-one reductase; AltName: Full=Enone 
oxidoreductase; Short=SlEO; Flags: Precursor [Solanum 
lycopersicum]
Length=388

 Score =   280 bits (717),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 218/312 (70%), Gaps = 9/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y ++G  +VLKL  +  +P  + DQ+L+++ AAALNP+DFK R       +   P 
Sbjct  81    KAWSYTDYGSVDVLKLESNVAVPDIKEDQVLIKIVAAALNPVDFKRRLGKFKATDSPLPT  140

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V     GDEVYG+IH   L+G  K+ G+LAE+T VEE LVA+KP
Sbjct  141   VPGYDVAGVVVKVGSQVKGLKEGDEVYGDIHEKALDGP-KQFGSLAEYTAVEEKLVALKP  199

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL+F  AA+LPLAI+TA +G   AGF  G+S+ ++GGAGGVGSL +QLAKHV+GAS VA
Sbjct  200   KNLSFAEAAALPLAIETAYEGLEKAGFSSGKSILVLGGAGGVGSLVIQLAKHVFGASKVA  259

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+E +K LGAD  +DYT   +E +P+ +D+VYD++G    +  V KE  +++ +
Sbjct  260   ATSSTGKLELLKSLGADLAIDYTKENFEDLPDKFDVVYDSVGQGEKAVKVVKEGGSVVVL  319

Query  963   TWPPSNP--RAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
             T   + P  R V   +T +GE+L+KL P+LESGKVK VIDP GPF F  VV+AF Y+ETG
Sbjct  320   TGAVTPPGFRFV---VTSNGEMLKKLNPYLESGKVKPVIDPKGPFSFDKVVDAFSYLETG  376

Query  1137  RARGKVVISPFP  1172
             RA GKVVI P P
Sbjct  377   RATGKVVIHPIP  388



>ref|XP_008221813.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Prunus mume]
Length=393

 Score =   280 bits (716),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 165/317 (52%), Positives = 215/317 (68%), Gaps = 7/317 (2%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLV  404
             + L    KAW Y E+G  +VLK  D  + VP+   DQ+LV+V AAALNP+DFK RQ    
Sbjct  79    SALPSEMKAWVYGEYGGVDVLKF-DTKVAVPELLEDQVLVKVVAAALNPVDFKRRQGKFQ  137

Query  405   PMN--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVE  578
               +   P +PG D+AG+VV  GS V  F  GDEVYG+I+   LEG  K+ G+LAE+T VE
Sbjct  138   NTDSPLPTVPGYDVAGVVVKIGSKVKDFKEGDEVYGDINEKALEGP-KQSGSLAEYTAVE  196

Query  579   ETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKH  758
             E L+A+KPKNL F  AA+LPLAI+TA +G    GF  G+S+ ++ GAGGVGSL +QLAKH
Sbjct  197   ERLLALKPKNLDFVQAAALPLAIETAYEGLERTGFSTGKSLLVLNGAGGVGSLVIQLAKH  256

Query  759   VYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAK  938
             V+GAS VAAT+S  K+E +K LGAD  +DYT   +E++PE +D+VYD IG    +  V K
Sbjct  257   VFGASRVAATSSTGKLELLKSLGADLAIDYTKENFEELPEKFDVVYDAIGQCDKAVKVVK  316

Query  939   ENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAF  1118
             E  +++ +T   + P      +T +G +L+KL P+LESGKVKAVIDP GPF F  +VEAF
Sbjct  317   EGGSVVALTGAVTPP-GFRFVVTSNGAVLKKLNPYLESGKVKAVIDPKGPFPFSKLVEAF  375

Query  1119  GYIETGRARGKVVISPF  1169
              Y+ET RA GKVVI P 
Sbjct  376   SYLETNRATGKVVIHPI  392



>ref|XP_003574429.1| PREDICTED: 2-methylene-furan-3-one reductase [Brachypodium distachyon]
Length=384

 Score =   280 bits (715),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 164/310 (53%), Positives = 208/310 (67%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y+E+G   VLKL + + +P    DQ+LV+V AAALNP+D K R       +   P 
Sbjct  77    KAWAYDEYGDTGVLKLDEAVSVPAVGDDQVLVRVAAAALNPVDSKRRMGKFKATDSPLPT  136

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG DMAG+VV  GS V     GDEVYG+I    LEG  K+ G+LAE+T VEE LVA+KP
Sbjct  137   VPGYDMAGVVVKVGSQVKSLKEGDEVYGHISEKVLEGP-KQFGSLAEYTAVEEKLVALKP  195

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G   AGF  G+S+ ++GGAGGVGSL +QLAK V+GAS VA
Sbjct  196   KNIDFAQAAGLPLAIETAHEGLERAGFSAGKSILVLGGAGGVGSLIIQLAKQVFGASKVA  255

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S+PK+E +K LGAD  +DYT   +E +PE YD+V+D +G    +  V KE  +++ +
Sbjct  256   ATASSPKLELLKSLGADVAIDYTKENFEDMPEKYDVVFDAVGQGDKAVKVVKEGGSVVVL  315

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T     P      +T  G +L KL P+LESGKVK V+DP GPF F  VVEAF Y+ETGRA
Sbjct  316   TG-AVTPPGFRFVVTSDGSVLAKLNPYLESGKVKPVVDPKGPFSFPQVVEAFSYLETGRA  374

Query  1143  RGKVVISPFP  1172
              GKVVISP P
Sbjct  375   TGKVVISPIP  384



>gb|ABK24155.1| unknown [Picea sitchensis]
Length=298

 Score =   276 bits (707),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 168/307 (55%), Positives = 220/307 (72%), Gaps = 10/307 (3%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             MQKAW+Y E+G   VL+ G+  +P P  DQ+LV+++ AALN +DFK   +     +FPV+
Sbjct  1     MQKAWFYNEYGSINVLQSGEVPVPKPGPDQILVKIRTAALNTVDFKSADS-----DFPVV  55

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PGCD AG+VV  G GV+KF+ GDE+Y +I NF   G  K+ GTLA++TVV E LVA KP 
Sbjct  56    PGCDAAGVVVEVGDGVSKFNNGDEIYCHIPNFT-AGRPKQWGTLAQYTVVGEYLVAPKPT  114

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             NL+F+ AASLPL++  A Q F  A F++GQSVFIVGGAGGVGSLA+QLAKHVYGAS + +
Sbjct  115   NLSFEEAASLPLSVLIAQQAFDIAKFEKGQSVFIVGGAGGVGSLAIQLAKHVYGASRIVS  174

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             + S   ++FVK LGAD V+DYT  +Y+Q+ E +D V+DTIGDS  S VVAK+    +DI 
Sbjct  175   SASTGTLDFVKSLGADLVIDYTKQSYDQVSEKFDFVFDTIGDSTKSHVVAKD----LDIA  230

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
                S+PR     L  S   LEKL+P++ES K+K VIDP  P+ F +V+EAF + E+GRAR
Sbjct  231   SFQSHPRDQFFELIPSAHNLEKLQPYIESEKLKPVIDPKSPYSFSDVIEAFIHQESGRAR  290

Query  1146  GKVVISP  1166
             GK+VISP
Sbjct  291   GKIVISP  297



>ref|XP_008340026.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Malus domestica]
 ref|XP_008353014.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Malus domestica]
Length=410

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 163/309 (53%), Positives = 211/309 (68%), Gaps = 7/309 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             KAW Y E+G  +VLK  D  + VP+   DQ+LV+V AAALNP+DFK RQ      +   P
Sbjct  103   KAWVYGEYGGVDVLKF-DSKVAVPELLEDQVLVKVVAAALNPVDFKRRQGKFKNTDSPLP  161

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+V   GS V  F  GDEVYG+IH   LEG  K+ G+LAE+T VEE L+A+K
Sbjct  162   TVPGYDVAGVVAKVGSKVKDFKEGDEVYGDIHEKALEGP-KQSGSLAEYTAVEERLLALK  220

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL F  AASLPLAI+TA +G    GF  G+S+ ++ GAGGVGSL +QLAKHV+GAS +
Sbjct  221   PKNLDFAQAASLPLAIETAYEGLEKTGFSAGKSLLVLNGAGGVGSLVIQLAKHVFGASRI  280

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K+E +K LGAD  +DYT   +E++PE +D+VYD IG    +  V KE  +++ 
Sbjct  281   AATSSTGKLELLKSLGADLAIDYTKENFEELPEKFDVVYDAIGQCDKAVKVVKEGGSVVA  340

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             +T   + P      +T +G +L+KL P+LESGKVK VIDP GPF F  +VEAF Y+ET R
Sbjct  341   LTGAVTPP-GFRFVVTSNGAVLKKLNPYLESGKVKPVIDPKGPFPFSKLVEAFSYLETNR  399

Query  1140  ARGKVVISP  1166
             A GKVVI P
Sbjct  400   ATGKVVIHP  408



>ref|XP_007216016.1| hypothetical protein PRUPE_ppa014808mg [Prunus persica]
 gb|EMJ17215.1| hypothetical protein PRUPE_ppa014808mg [Prunus persica]
Length=323

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 210/316 (66%), Gaps = 12/316 (4%)
 Frame = +3

Query  246   MQKAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK-----LRQTSLV  404
             + KAW Y EHG    VLK   +  +P  + DQ+L++V AAALNPID K     LR T   
Sbjct  13    VNKAWIYREHGETAHVLKFETNVAVPQIKEDQVLIKVVAAALNPIDAKRILGVLRATDTA  72

Query  405   PMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEET  584
             P   P++PG D+AG+VV  GS  +KF+IGDEVYG+I N      LK+ GTLAE+T  EE 
Sbjct  73    P---PIVPGYDVAGVVVKLGSKASKFNIGDEVYGDI-NEESSLNLKKFGTLAEYTAAEER  128

Query  585   LVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVY  764
             L+A+KPKNL+F  AASLP AI+TA +G +  G   GQS+ ++GGAGG G+  +QLAKHV+
Sbjct  129   LLALKPKNLSFVEAASLPAAIETAYEGLKRVGLSAGQSILVLGGAGGCGTHVIQLAKHVF  188

Query  765   GASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKEN  944
             GAS VAAT S  K++ ++ LGAD  +DYT    E +PE +D+VYD +G S  +    KE 
Sbjct  189   GASRVAATASTKKLDLLRSLGADLAIDYTKENVEDLPEKFDVVYDAVGQSDKAVKAVKEG  248

Query  945   ATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGY  1124
               ++ +  P + P ++   LT +G ILEKLKP+LES KVKAVIDP GP+ F   ++AF Y
Sbjct  249   GRVVTLIGPITPPASMFV-LTSTGSILEKLKPYLESRKVKAVIDPTGPYQFSKTIDAFAY  307

Query  1125  IETGRARGKVVISPFP  1172
             ++T RA GKVV+ P P
Sbjct  308   LQTSRATGKVVVYPIP  323



>ref|XP_009626671.1| PREDICTED: 2-methylene-furan-3-one reductase [Nicotiana tomentosiformis]
Length=388

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 214/312 (69%), Gaps = 9/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLK   +  +P  + DQ+L++V AAALNP+DFK R       +   P 
Sbjct  81    KAWTYTEYGSADVLKFESNVSVPEIKEDQVLIKVVAAALNPVDFKRRLGKFKATDSPLPT  140

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V     GDEVYG+IH   L+G  K+ G+LAE+T VEE LVA+KP
Sbjct  141   VPGYDVAGVVVKVGSEVKGLKEGDEVYGDIHEKALDGP-KQFGSLAEYTAVEEKLVALKP  199

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL+F  AASLPLAI+TA +G   AGF  G+S+ ++GGAGGVGSL +Q+AKHV+GAS VA
Sbjct  200   KNLSFAEAASLPLAIETAYEGLEKAGFSAGKSILVLGGAGGVGSLVIQVAKHVFGASKVA  259

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+E +K LG D  +DYT   +E +PE +D+VYDT+G    +    KE  +++ +
Sbjct  260   ATSSTGKLELLKSLGVDLAIDYTKENFEHLPEKFDVVYDTVGQGEKAVKAVKEGGSVVVL  319

Query  963   TWPPSNP--RAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
             T   + P  R V   +T +GE+L+KL P+LE+GKVK VID  GPF F  VVEAF Y+ETG
Sbjct  320   TGAVTPPGFRFV---VTSNGEMLKKLNPYLENGKVKPVIDSKGPFPFDKVVEAFSYLETG  376

Query  1137  RARGKVVISPFP  1172
             RA GKVVI P P
Sbjct  377   RATGKVVIHPIP  388



>ref|XP_008348028.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Malus domestica]
Length=326

 Score =   275 bits (702),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 155/324 (48%), Positives = 217/324 (67%), Gaps = 6/324 (2%)
 Frame = +3

Query  213   IFSTEPNGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK-  383
             + S++   +  + KAW Y E+G    +   D  +PVP+   DQ+L++V AA+LNPIDFK 
Sbjct  5     VASSDSVSIPSVNKAWVYSEYGKSAXVLKFDPNVPVPEIKEDQVLIKVVAASLNPIDFKR  64

Query  384   -LRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLA  560
              L        + P +PG D+AG+VV  GS VTKF +GDEVYG+++   ++   K++G+LA
Sbjct  65    TLGYFKDYDSSPPTVPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNEKAIDNP-KKIGSLA  123

Query  561   EFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgsla  740
             E+T  EE ++A+KPKNL+F  AASLPLAI+TA +G     F  G+S+ ++GGAGGVG+  
Sbjct  124   EYTAAEERVLALKPKNLSFXEAASLPLAIETAYEGLERVEFSAGKSILVLGGAGGVGTHV  183

Query  741   vqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN  920
             +QLA+HV+GAS VAAT S  K++ ++ LGAD  +DYT   +E +PE +D+VYD +G S  
Sbjct  184   IQLARHVFGASKVAATASTKKLDLLRSLGADLAIDYTMKNFEDLPEKFDVVYDAVGQSDR  243

Query  921   SFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFC  1100
             +    KE   ++ I   P  P A+  GLT +G +LEKLKP+LESGKVK V+DP GP+ F 
Sbjct  244   ALKAVKEGGKVVTIVG-PXTPPAIIFGLTXTGTVLEKLKPYLESGKVKPVLDPTGPYPFS  302

Query  1101  NVVEAFGYIETGRARGKVVISPFP  1172
               VEAF Y+ET RA GKVV+ P P
Sbjct  303   KTVEAFAYLETSRATGKVVVYPIP  326



>ref|XP_010925514.1| PREDICTED: 2-methylene-furan-3-one reductase [Elaeis guineensis]
Length=392

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 162/310 (52%), Positives = 210/310 (68%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y+E+G   VL+  + + +P  + DQ+LV+V AAALNP+DFK RQ      +   P 
Sbjct  85    KAWVYDEYGAASVLRFDEGVSVPEVKEDQVLVKVVAAALNPVDFKRRQGKFKATDSPLPT  144

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AGIVV  GS V     GDEVYG+I+   LE   K+ G+LAE+T VEE L+A+KP
Sbjct  145   VPGYDVAGIVVKVGSQVQNLKEGDEVYGDINEKALENP-KQFGSLAEYTAVEEKLLAIKP  203

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AA LPLAI+TA +G   AGF  G+S+ ++GGAGGVGSL +QLAK VYGAS VA
Sbjct  204   KNLDFIQAAGLPLAIETAYEGLEKAGFSAGKSILVLGGAGGVGSLVIQLAKQVYGASKVA  263

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+EF+K LGAD  +DYT   +E++PE +D+VYD +G    +  V KE  +++ +
Sbjct  264   ATSSTGKLEFLKSLGADLPIDYTKENFEELPEKFDVVYDAVGQCEKAVKVVKEGGSVVVL  323

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T P S P      +T  G  L KL PFLESGKVK ++DP  PF F  V+EAF Y+ETGRA
Sbjct  324   TGPVSPP-GFRFVVTSDGAALTKLNPFLESGKVKPIVDPKAPFPFSQVIEAFSYLETGRA  382

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  383   TGKVVVHPIP  392



>ref|XP_010100462.1| Quinone oxidoreductase-like protein [Morus notabilis]
 gb|EXB82596.1| Quinone oxidoreductase-like protein [Morus notabilis]
Length=385

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 161/310 (52%), Positives = 208/310 (67%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +P  + DQ+L++V AAALNP+DFK RQ      +   P 
Sbjct  78    KAWMYGEYGGVDVLKLESNVSVPDVKEDQVLIKVFAAALNPVDFKRRQGKFKNTDSPLPT  137

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V     GDEVYG+IH   L+G  K+ G+LAE+T VEE L+A+KP
Sbjct  138   VPGYDVAGVVVKVGSQVKNIKEGDEVYGDIHEKALDGP-KQFGSLAEYTAVEEKLLALKP  196

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AA+LPLAI+TA +G    GF  G+S+ ++ GAGGVGSL +QLAK V+GAS VA
Sbjct  197   KNLDFAQAAALPLAIETAYEGLEKTGFSAGKSILVLNGAGGVGSLVIQLAKQVFGASKVA  256

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+EF+K LGAD  +DYT   +E +PE +D+VYD IG    +    KE  +++ +
Sbjct  257   ATASTGKLEFLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVKAVKEGGSVVAL  316

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T     P      +T +GE+L KL P+LESGKVK VIDP GPF F  +VEAF Y+ET RA
Sbjct  317   TG-AVTPPGFRFVVTSNGEVLTKLNPYLESGKVKPVIDPKGPFPFSQLVEAFSYLETNRA  375

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  376   VGKVVIHPIP  385



>ref|XP_008230609.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Prunus mume]
Length=321

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 211/318 (66%), Gaps = 16/318 (5%)
 Frame = +3

Query  246   MQKAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK-----LRQTSLV  404
             + KAW Y EHG    VLK   +  +P  + DQ+L++V AAALNPID K      R T   
Sbjct  11    VNKAWIYREHGETAHVLKFETNVAVPQIKEDQVLIKVVAAALNPIDAKRVLGVFRATDTA  70

Query  405   PMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGE--LKRMGTLAEFTVVE  578
             P   P++PG D+AG+VV  GS  +KF+IGDEVYG+I   N EG   LK+ GTLAE+T  E
Sbjct  71    P---PIVPGYDVAGVVVKLGSKASKFNIGDEVYGDI---NEEGSINLKKFGTLAEYTAAE  124

Query  579   ETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKH  758
             E L+A+KPKNL+F  AASLP AI+TA +G +  G   GQS+ ++GGAGG G+  +QLAKH
Sbjct  125   ERLLALKPKNLSFVEAASLPAAIETAYEGLKRVGLSAGQSILVLGGAGGCGTHVIQLAKH  184

Query  759   VYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAK  938
             V+GAS VAAT S  K++ ++ LGAD  +DYT    E +PE +D+VYD +G S  +    K
Sbjct  185   VFGASRVAATASTKKLDLLRSLGADLAIDYTRENVEDLPEKFDVVYDAVGQSDKAVKAVK  244

Query  939   ENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAF  1118
             E   ++ +  P + P ++   LT +G ILEKLKP+LESGKVK VIDP GP+ F   ++AF
Sbjct  245   EGGRVVTLIGPITPPASMFV-LTSTGSILEKLKPYLESGKVKPVIDPTGPYPFSKTIDAF  303

Query  1119  GYIETGRARGKVVISPFP  1172
              Y++T RA GKVV+ P P
Sbjct  304   TYLQTSRATGKVVVYPIP  321



>ref|NP_001151204.1| quinone oxidoreductase-like protein At1g23740 [Zea mays]
 gb|ACG41966.1| quinone oxidoreductase-like protein At1g23740 [Zea mays]
 tpg|DAA49152.1| TPA: quinone oxidoreductase-like protein At1g23740 [Zea mays]
Length=386

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 211/314 (67%), Gaps = 9/314 (3%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--F  416
             + KAW Y+ +G   VLKL +   +P    DQ+LV+V AAALNP+D K R       +   
Sbjct  77    VMKAWVYDAYGDAGVLKLDEAAAVPAVGEDQVLVKVVAAALNPVDAKRRAGKFQATDSPL  136

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P +PG D++G+VV  GS V K   GDEVYG +    L+G  K+ G+LAE+T VEE L+A+
Sbjct  137   PTVPGYDLSGVVVKVGSQVKKLKEGDEVYGMVSENPLQGP-KQSGSLAEYTAVEEKLLAL  195

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KPK L F  AASLPLA++TA +G   AG   G+SV I+GGAGGVGSLA+QLAKHVYGAS 
Sbjct  196   KPKGLDFAQAASLPLAVETANEGLERAGISAGKSVLILGGAGGVGSLAIQLAKHVYGASK  255

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             VAAT S  K+E +K LGAD  +DYT    E++P+ YD+V+D +G    +  V KE  +++
Sbjct  256   VAATASTKKIELLKSLGADVAIDYTKENLEELPDKYDIVFDGVGQGDKAVKVVKEGGSVV  315

Query  957   DITWPPSNP--RAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
              +T   S P  R V   +T +G +LEKL P+LESGK+K +IDP GPF F  VVEAF Y+E
Sbjct  316   VLTGAVSPPGFRFV---VTSNGSVLEKLNPYLESGKLKPLIDPEGPFSFSQVVEAFSYLE  372

Query  1131  TGRARGKVVISPFP  1172
             TGRA GKVVISP P
Sbjct  373   TGRATGKVVISPIP  386



>ref|XP_008801828.1| PREDICTED: 2-methylene-furan-3-one reductase [Phoenix dactylifera]
Length=385

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 211/310 (68%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y+E+G   VL+  + + +P  + DQ+LV+V AAALNP+DFK R       +   P 
Sbjct  78    KAWVYDEYGAASVLRFDEGVSVPAVKEDQVLVKVVAAALNPVDFKRRLGKFKATDSPLPT  137

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AGIVV  GS V  F  GDEVYG+++   LE   K+ G+LAE+T VEE L+A+KP
Sbjct  138   VPGYDVAGIVVKVGSQVQNFKEGDEVYGDVNEKALENP-KQFGSLAEYTAVEEKLLAIKP  196

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AA+LPLAI+TA +G   AGF  G+S+ ++GGAGGVGSL +QLAK VYGAS VA
Sbjct  197   KNLDFIQAAALPLAIETAYEGLEKAGFSAGKSILVLGGAGGVGSLVIQLAKQVYGASKVA  256

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+EF+K LGAD  +DYT    +++PE +D++YD +G    +    KE  +++ +
Sbjct  257   ATSSTGKLEFLKSLGADLPIDYTKENIDELPEKFDVIYDAVGQCEKAVKAVKEGGSVVVL  316

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T P S P      +T  G +L KL PFLESGKVK ++DP GPF F  V+EAF Y+ETGRA
Sbjct  317   TGPVSPP-GFRFVVTSDGAVLTKLNPFLESGKVKPIVDPKGPFPFSQVIEAFSYLETGRA  375

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  376   TGKVVVHPIP  385



>gb|EYU31261.1| hypothetical protein MIMGU_mgv1a008015mg [Erythranthe guttata]
Length=387

 Score =   275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 163/310 (53%), Positives = 212/310 (68%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  EVLKL  +  +P  Q DQ+L++V AAALNP+DFK R       +   P 
Sbjct  80    KAWTYSEYGGVEVLKLESNVAVPPLQADQVLIKVAAAALNPVDFKRRFGKFKATDSPLPT  139

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F  GDEVYG+I    L+G  K+ G+LAE+T VEE L+A+KP
Sbjct  140   VPGYDVAGVVVKVGSEVKGFKEGDEVYGDISEKALDGP-KQFGSLAEYTAVEEKLLALKP  198

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
              NL F  AA LPLAI+TA +G   +GF EG+S+ ++GGAGGVGSL +QLAK V+GAS VA
Sbjct  199   SNLDFAQAAGLPLAIETAYEGLEKSGFSEGKSILVLGGAGGVGSLVIQLAKQVFGASKVA  258

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+EF+K LGAD  +DYT   +E +PE +D+VYDT+G    +  V KE  +++ +
Sbjct  259   ATSSTSKLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDTVGQCDRAVKVVKEGGSVVVL  318

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +GE L+KL P+LESGKVKAV+DP GPF F  V EAF Y+ET RA
Sbjct  319   TGAVTPP-GFRFVVTSNGETLKKLNPYLESGKVKAVVDPKGPFGFDKVEEAFSYLETNRA  377

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  378   VGKVVVYPIP  387



>ref|XP_010108766.1| Quinone oxidoreductase-like protein [Morus notabilis]
 gb|EXC20281.1| Quinone oxidoreductase-like protein [Morus notabilis]
Length=319

 Score =   273 bits (697),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 216/317 (68%), Gaps = 12/317 (4%)
 Frame = +3

Query  246   MQKAWYYEEHGPK-EVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFK-----LRQTSLV  404
             + K W Y E+G   EVLK  + + +P  + DQ+L++V AAALNP+DFK      + T   
Sbjct  7     VNKGWVYSEYGKSGEVLKFEENVGVPDLKEDQVLIKVAAAALNPVDFKRMLGWFKSTDTS  66

Query  405   PMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEET  584
             P   PV+PG D+AG+V   GS VTKF +GDEVYG+I+  +++ + K++GTLAE+T  EE 
Sbjct  67    P---PVVPGYDVAGVVKKVGSQVTKFKVGDEVYGDINVKSVQ-KPKKIGTLAEYTAAEEK  122

Query  585   LVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVY  764
             ++A+KPKNL+F  AASLPLA++TA  G   A F  G+S+ ++GGAGGVG+L +QL KHV+
Sbjct  123   VLALKPKNLSFVEAASLPLALETAYGGLELARFSAGKSILVLGGAGGVGTLVIQLTKHVF  182

Query  765   GASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKEN  944
             G S VAAT S  K+E ++ LGAD  +DYT   +E++PE +D+VYDT+G S  +    KE 
Sbjct  183   GVSKVAATASTGKLELLRSLGADLAIDYTKENFEELPEKFDVVYDTVGQSERAVKAVKEG  242

Query  945   ATIIDITWPPS-NPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFG  1121
               ++ I    S  P+A    +  SG +LEKLKP LESGKVKAVIDP GPF F   VEAF 
Sbjct  243   GEVVTIAPVASVAPQAKLYSVVSSGSVLEKLKPDLESGKVKAVIDPKGPFPFSKTVEAFS  302

Query  1122  YIETGRARGKVVISPFP  1172
             Y+ETGRA GKVV+ P P
Sbjct  303   YLETGRATGKVVVYPIP  319



>gb|EPS62233.1| hypothetical protein M569_12557, partial [Genlisea aurea]
Length=329

 Score =   273 bits (697),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 211/310 (68%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  D ++P    DQ+L++V AAALNP+DFK RQ      +   P 
Sbjct  22    KAWTYTEYGGIDVLKLESDVVVPEIGEDQVLIRVAAAALNPVDFKRRQGKFKATDSPLPT  81

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V +F  GDEVYG+I    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  82    VPGYDVAGVVVRVGSQVKQFKEGDEVYGDISEKALEGP-KQFGSLAEYTAVEEKLLALKP  140

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
              NL F  AASLPLAI+TA +G + A F +G+S+ ++GGAGGVGSL +QLAK V+GAS VA
Sbjct  141   NNLDFAQAASLPLAIETAYEGLQRAAFSDGKSILVLGGAGGVGSLVIQLAKQVFGASRVA  200

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+ F++ LGAD+ +DYT  ++E+ PE +D+VYD +G    +    KE    + +
Sbjct  201   ATSSTGKLSFIQSLGADEAIDYTERSFEETPEKFDVVYDAVGQGERAVKALKEGGVAVFL  260

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   ++P      +T +GE L+KL P+LE GK+K VIDP GPF F  V EAF Y+ET RA
Sbjct  261   TGAVASP-GFRFVVTSNGETLKKLNPYLEKGKIKPVIDPKGPFPFDRVNEAFSYLETNRA  319

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  320   TGKVVIFPIP  329



>ref|XP_006483850.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Citrus sinensis]
Length=392

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/311 (52%), Positives = 209/311 (67%), Gaps = 7/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             KAW Y E+G  +VLK  D  + VPQ   DQ+L++V AAALNP+D K RQ      +   P
Sbjct  85    KAWLYGEYGGVDVLKF-DEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLP  143

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV  G+ V +F  GDEVYG+I+   LEG  K+ G+LAE+T VEE L+A K
Sbjct  144   TVPGYDVAGVVVKVGTQVKEFKEGDEVYGDINEKALEGP-KQFGSLAEYTAVEERLLAPK  202

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL F  AA LPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAK V+GAS V
Sbjct  203   PKNLDFVQAAGLPLAIETAYEGLERTGFSAGKSILVLNGSGGVGSLVIQLAKQVFGASRV  262

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S   +EF+K LGAD  +DYT   +E +PE +DLVYD IG    +    KE  T++ 
Sbjct  263   AATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDLVYDAIGQCDRAVKAIKEGGTVVA  322

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             +T   + P      +T +GE+L+KL P+LESGKVK +IDP GPF F  VVEAF YIET +
Sbjct  323   LTGAVTPP-GFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNK  381

Query  1140  ARGKVVISPFP  1172
             A GKVVI P P
Sbjct  382   ATGKVVIHPIP  392



>ref|XP_008230614.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Prunus mume]
Length=323

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 215/322 (67%), Gaps = 13/322 (4%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHG-PKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK-----L  386
             + +  + KAW Y E+G   +VLKL D  +PVP+   DQ+L++V AAALNP+D+K      
Sbjct  7     DSIPSVNKAWVYSEYGKAADVLKL-DPNVPVPEIKEDQVLIKVVAAALNPVDYKRMFGYF  65

Query  387   RQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEF  566
             + T     + P +PG D+AG+VV  GS VTKF +GDEVYG+++   LE    R G+LAE+
Sbjct  66    KATD---SSLPTVPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNEKALENP-TRFGSLAEY  121

Query  567   TVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavq  746
             T   E ++A+KP+NL+F  AASLPLAI+TA +G     F  G+S+ ++GGAGGVG+  +Q
Sbjct  122   TAATERVLALKPQNLSFVEAASLPLAIETAYEGLERTEFSAGKSILVLGGAGGVGTHVIQ  181

Query  747   laKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSF  926
             LAKHV+GAS VAAT S  K+E ++ LGAD  VDYT   +E++PE +D+VYDT+G+S  + 
Sbjct  182   LAKHVFGASKVAATASTRKLELLRSLGADLAVDYTKEKFEELPEKFDVVYDTVGESDRAV  241

Query  927   VVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNV  1106
                KE   ++ I   P    A    LT +G ILEKLKP+LESGKVK V+DP  P+ F   
Sbjct  242   KAVKEGGKVVTIVPGPVAAAAFIFILTSTGTILEKLKPYLESGKVKPVLDPTSPYPFSKT  301

Query  1107  VEAFGYIETGRARGKVVISPFP  1172
             VEAF Y+ET RA GKVV+ P P
Sbjct  302   VEAFAYLETSRATGKVVVHPIP  323



>ref|XP_007215682.1| hypothetical protein PRUPE_ppa008661mg [Prunus persica]
 gb|EMJ16881.1| hypothetical protein PRUPE_ppa008661mg [Prunus persica]
Length=323

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 216/321 (67%), Gaps = 11/321 (3%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHG-PKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLR----  389
             + +  + KAW Y E+G   +VLKL D  +PVP+   DQ+L++V AAALNP+D+K      
Sbjct  7     DSIPSVNKAWVYSEYGKAADVLKL-DPNVPVPEIKEDQVLIKVVAAALNPVDYKRMFGYF  65

Query  390   QTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFT  569
             + +  P+  P +PG D+AG+VV  GS VTKF +GDEVYG+++   LE    R G+LAE+T
Sbjct  66    KATDSPL--PTVPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNEKALENP-TRFGSLAEYT  122

Query  570   VVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql  749
                E ++A+KP+NL+F  AASLPLAI+TA +G     F  G+S+ ++GGAGGVG+  VQL
Sbjct  123   AAAERVLALKPQNLSFIEAASLPLAIETAYEGLERTEFSAGKSILVLGGAGGVGTHVVQL  182

Query  750   aKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV  929
             AKHV+GAS VAAT S  K+E ++ LGAD  VDYT   YE++PE +D+VYDT+G+S  +  
Sbjct  183   AKHVFGASKVAATASTRKLELLRSLGADLAVDYTKEKYEELPEKFDVVYDTVGESDRAVK  242

Query  930   VAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVV  1109
               KE   ++ I   P    A    LT +G ILEKLKP+LESGKVK V+DP  P+ F   V
Sbjct  243   AVKEGGKVVTIVPGPVAAGAFIFILTSTGTILEKLKPYLESGKVKPVLDPTSPYPFSKTV  302

Query  1110  EAFGYIETGRARGKVVISPFP  1172
             EAF Y+ET RA GKVV+ P P
Sbjct  303   EAFAYLETSRATGKVVVHPIP  323



>ref|XP_001784490.1| predicted protein [Physcomitrella patens]
 gb|EDQ50703.1| predicted protein [Physcomitrella patens]
Length=349

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 158/313 (50%), Positives = 207/313 (66%), Gaps = 4/313 (1%)
 Frame = +3

Query  237   LQDMQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL--VPM  410
             L   QK W Y E+G K+VLK  D  +P  + D++LV+VQAAALNP+D K           
Sbjct  38    LPTTQKGWTYSEYGSKDVLKFEDIPMPEVKPDEVLVKVQAAALNPVDSKRMSGKFKNTDS  97

Query  411   NFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLV  590
               P +PG D+AG+VV  GS VTKF  GDEVY ++    L    +++G+LA+FT VEE L+
Sbjct  98    ELPHVPGYDVAGVVVKVGSDVTKFKEGDEVYADVSEAPLNNP-RQVGSLAQFTAVEEKLL  156

Query  591   AMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGA  770
              +KP NL+F  AASLPLA+ TA +    AG  EGQ++FI GGAGGVGSLA+QLAK+VYGA
Sbjct  157   VIKPANLSFAEAASLPLAVLTAQEALDRAGLTEGQTIFINGGAGGVGSLAIQLAKNVYGA  216

Query  771   SSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENAT  950
             S V  T S  K+EFVK LGADKV+DY N  +E++ E YD+V D +G+      + KE   
Sbjct  217   SQVTTTASTGKLEFVKSLGADKVIDYKNEKFEEVSEKYDVVLDCVGECAKCVKIVKEGGA  276

Query  951   IIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
             +I +T     P  V   +T +GE L +L P+LESGKVK +IDP GPF F  +VEAF Y++
Sbjct  277   VIALTG-ALEPPGVRFVVTSNGESLARLTPYLESGKVKPIIDPKGPFKFSELVEAFEYLD  335

Query  1131  TGRARGKVVISPF  1169
             TGRA GK+V++P 
Sbjct  336   TGRATGKIVVAPI  348



>ref|XP_010108763.1| Quinone oxidoreductase-like protein [Morus notabilis]
 gb|EXC20278.1| Quinone oxidoreductase-like protein [Morus notabilis]
Length=324

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 161/319 (50%), Positives = 211/319 (66%), Gaps = 7/319 (2%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGPK-EVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSL  401
             N +  + KAW Y E+G   EVLK  D  +PVPQ   DQ+L++V AA+LNP+DFK     +
Sbjct  8     NQIPSVNKAWTYSEYGKSVEVLKF-DTSVPVPQIKEDQVLIKVIAASLNPVDFKRINGFI  66

Query  402   VPMN--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVV  575
                +  FP +PG D+AG+VV  G  V K  +GDEVYG+I+   LE   K+ GTLAE+T  
Sbjct  67    KAADSPFPTVPGYDVAGVVVKVGRQVKKLKVGDEVYGDINENGLENP-KQFGTLAEYTAA  125

Query  576   EETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaK  755
             EE ++A+KPKNL+F  AASLP+A+ TA +G   A   +G+S+ ++GGAGGVG+  +QLAK
Sbjct  126   EERVLALKPKNLSFVEAASLPMAVGTAYEGLERAQLSDGKSLLVLGGAGGVGTQVIQLAK  185

Query  756   HVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVA  935
             HV+GAS VAAT+S  K+EF++ LGAD  +DYT    E I E +D+VYD +G S  +   A
Sbjct  186   HVFGASKVAATSSMGKLEFLRSLGADLAIDYTKENVEDIEEKFDVVYDAVGQSERAVKAA  245

Query  936   KENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEA  1115
             K+   I+ I   P  P A    L  +G ILEKLKP+LESGKVK VID  G F F  +VEA
Sbjct  246   KDGGKIVTIVVGPVTPPAFTFVLNSTGSILEKLKPYLESGKVKPVIDSKGQFPFAKIVEA  305

Query  1116  FGYIETGRARGKVVISPFP  1172
             F Y+ET RA GKVV+ P P
Sbjct  306   FSYLETSRASGKVVVYPIP  324



>ref|XP_010108765.1| Quinone oxidoreductase-like protein [Morus notabilis]
 gb|EXC20280.1| Quinone oxidoreductase-like protein [Morus notabilis]
Length=318

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 164/317 (52%), Positives = 214/317 (68%), Gaps = 13/317 (4%)
 Frame = +3

Query  246   MQKAWYYEEHGPK-EVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFK-----LRQTSLV  404
             + K W Y E+G   EVLK  + + +P  + DQ+L++V AAALNPIDFK      + T   
Sbjct  7     VNKGWVYSEYGKSGEVLKFEENVGVPDLKEDQVLIKVAAAALNPIDFKWMLGLFKSTDTS  66

Query  405   PMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEET  584
             P   PV+PG D+AG+V   GS VTKF +GDEVYG+I+   LE +  ++GTLAE+T  EE 
Sbjct  67    P---PVVPGYDVAGVVEKVGSKVTKFKVGDEVYGDINEKPLEPQ--KIGTLAEYTAAEEK  121

Query  585   LVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVY  764
             ++ +KPKNL+F  AASLPLA++TA  G   A F  G+S+ ++GGAGGVG+L +QLAKHV+
Sbjct  122   VLGLKPKNLSFVEAASLPLALETAYGGLELAQFSPGKSILVLGGAGGVGTLVIQLAKHVF  181

Query  765   GASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKEN  944
             GAS VAAT S  K+E ++ LGAD  +DYT   +E++ E +D+VYDT+G S  +    KE 
Sbjct  182   GASKVAATASTGKLELLRSLGADLSIDYTKENFEELSEKFDVVYDTVGQSERASKAVKEG  241

Query  945   ATIIDITWPPSNPRAVHSGLTV-SGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFG  1121
               ++ I    S P  V   + V SG +LEKLKP LESGKVKAVIDP GPF F   VEAF 
Sbjct  242   GEVVTIARGSSLPPQVKFYIVVSSGSVLEKLKPDLESGKVKAVIDPKGPFPFSKTVEAFS  301

Query  1122  YIETGRARGKVVISPFP  1172
             Y+ETGRA GKVV+ P P
Sbjct  302   YLETGRATGKVVVYPIP  318



>ref|XP_011086568.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Sesamum indicum]
Length=384

 Score =   273 bits (697),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 162/310 (52%), Positives = 210/310 (68%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  EVLKL     +P  + DQ+L++V AAALNP+DFK R       +   P 
Sbjct  77    KAWTYTEYGGVEVLKLESSVAVPEVKVDQVLIKVVAAALNPVDFKRRLGKFKATDSPLPT  136

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             IPG D+AG+VV  GS V     GDEVYG+I    L+G  K+ G+LAE+T VEE L+A+KP
Sbjct  137   IPGYDVAGVVVKVGSQVKDLKEGDEVYGDISEKALDGP-KQFGSLAEYTAVEEKLLALKP  195

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AA+LPLAI+TA +G   AGF EG+S+ ++GGAGGVGSL +QLAK V+GAS VA
Sbjct  196   KNLDFVQAAALPLAIETAYEGLERAGFSEGKSILVLGGAGGVGSLVIQLAKQVFGASKVA  255

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+EF+K LGAD  +DYT   +E +PE +D+VYD +G    +  V KE  +++ +
Sbjct  256   ATSSTGKLEFIKSLGADLAIDYTKENFEDLPEKFDVVYDAVGQCDKAVKVVKEGGSVVAL  315

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T     P      +T +GE L+KL P+LESGKVKA++DP GPF F  V EAF Y+ET RA
Sbjct  316   TG-AVTPPGFRFVVTSTGETLKKLNPYLESGKVKALVDPKGPFPFDKVSEAFSYLETNRA  374

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  375   TGKVVVYPIP  384



>ref|XP_002525379.1| alcohol dehydrogenase, putative [Ricinus communis]
 gb|EEF37017.1| alcohol dehydrogenase, putative [Ricinus communis]
Length=389

 Score =   273 bits (697),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 159/321 (50%), Positives = 212/321 (66%), Gaps = 5/321 (2%)
 Frame = +3

Query  219   STEPNGLQDMQKAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQT  395
             +T+ + L    KAW Y E+G  +VLK  + + +P  + DQ+L++V AAALNP+D K RQ 
Sbjct  71    ATKISSLPSEMKAWVYGEYGGVDVLKFDEKVSVPEVKEDQVLIKVVAAALNPVDAKRRQG  130

Query  396   SLVPMN--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFT  569
                  +   P +PG D+AGIVV  GS V +   GDEVYG+I+   LEG  K+ G+LAE+T
Sbjct  131   KFKATDSPLPTVPGYDVAGIVVKVGSKVKELKEGDEVYGDINEKALEGP-KQFGSLAEYT  189

Query  570   VVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql  749
              VEE L+A+KPKNL F  AASLPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QL
Sbjct  190   AVEEKLLALKPKNLDFVQAASLPLAIETAYEGLERTGFSAGKSILVLNGSGGVGSLVIQL  249

Query  750   aKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV  929
             AKHV+GAS VAAT+    +E +K LGAD  +DYT   +E +PE +D+VYD IG    +  
Sbjct  250   AKHVFGASKVAATSGTRNLEILKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVK  309

Query  930   VAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVV  1109
               KE  +++ +T     P      +T +G++L+KL P+LESGKVK VIDP GPF F  V 
Sbjct  310   AVKEGGSVVALTG-AVTPPGFRFVVTSNGDVLKKLNPYLESGKVKPVIDPKGPFPFSQVA  368

Query  1110  EAFGYIETGRARGKVVISPFP  1172
             EAF YIET RA GK+VI P P
Sbjct  369   EAFSYIETNRATGKIVIHPIP  389



>ref|XP_002971209.1| hypothetical protein SELMODRAFT_95183 [Selaginella moellendorffii]
 gb|EFJ27807.1| hypothetical protein SELMODRAFT_95183 [Selaginella moellendorffii]
Length=319

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 216/309 (70%), Gaps = 6/309 (2%)
 Frame = +3

Query  246   MQKAWYYEEHGP-KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLR--QTSLVPMNF  416
             + KAW Y+E+G  K+VLKL +  +P    DQ+LV+V AAALNP+DFK R  +      + 
Sbjct  11    LHKAWVYKEYGAAKDVLKLEELPVPPLAPDQVLVKVHAAALNPVDFKRRLGKFKATDSDL  70

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P +PG D+AG+V   GS V+    GDEVYG+I  F L+ + K+ G++A++T VEE L+A+
Sbjct  71    PTVPGYDVAGVVAKVGSEVSSLKQGDEVYGDISEFALD-KPKQWGSIAQYTAVEEKLLAI  129

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KP+NL+F  AASLPLAIQTA +GF  A  + GQSV ++GGAGGVGSLA+QLAK VYGAS 
Sbjct  130   KPRNLSFIQAASLPLAIQTAQEGFDKAKLRAGQSVLVLGGAGGVGSLAIQLAKFVYGASL  189

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             VAATTS PK+E VK LGAD V+DY    +E +PE YD+V+D +G+   + VV KE  T +
Sbjct  190   VAATTSTPKLELVKSLGADIVIDYKEKNFEDMPERYDVVFDAVGEPKGTNVV-KEGGTAV  248

Query  957   DITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
              +T  P NP      +T +G  L +LK FLESG VK VIDP GPF F +VV+AF Y+E G
Sbjct  249   VLTG-PVNPPGFRFVVTSNGSNLVRLKDFLESGTVKPVIDPKGPFDFGSVVDAFCYLEGG  307

Query  1137  RARGKVVIS  1163
             RA GKVVIS
Sbjct  308   RASGKVVIS  316



>gb|KDO82427.1| hypothetical protein CISIN_1g016265mg [Citrus sinensis]
 gb|KDO82428.1| hypothetical protein CISIN_1g016265mg [Citrus sinensis]
Length=392

 Score =   272 bits (696),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 161/311 (52%), Positives = 209/311 (67%), Gaps = 7/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             KAW Y E+G  +VLK  D  + VPQ   DQ+L++V AAALNP+D K RQ      +   P
Sbjct  85    KAWLYGEYGGVDVLKF-DEKVTVPQVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLP  143

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV  G+ V +F  GDEVYG+I+   LEG  K+ G+LAE+T VEE L+A K
Sbjct  144   TVPGYDVAGVVVKVGTQVKEFKEGDEVYGDINEKALEGP-KQFGSLAEYTAVEERLLAPK  202

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL F  AA LPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAK V+GAS V
Sbjct  203   PKNLDFVQAAGLPLAIETAYEGLERTGFSAGKSILVLNGSGGVGSLVIQLAKQVFGASRV  262

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S   +EF+K LGAD  +DYT   +E +PE +D+VYD IG    +    KE  T++ 
Sbjct  263   AATSSTRNLEFLKSLGADLAIDYTKDNFEDLPEKFDVVYDAIGQCDRAVKAIKEGGTVVA  322

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             +T   + P      +T +GE+L+KL P+LESGKVK +IDP GPF F  VVEAF YIET +
Sbjct  323   LTGAVTPP-GFRFVVTSNGEVLKKLNPYLESGKVKPIIDPKGPFPFSQVVEAFSYIETNK  381

Query  1140  ARGKVVISPFP  1172
             A GKVVI P P
Sbjct  382   ATGKVVIHPIP  392



>ref|XP_011029885.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Populus euphratica]
Length=322

 Score =   270 bits (689),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 158/320 (49%), Positives = 217/320 (68%), Gaps = 10/320 (3%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGP-KEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSL  401
             + +    KAW Y E+G    VLKL D  + VPQ   DQ+L++V AA++NP+D K R   +
Sbjct  7     DSIPSKMKAWVYGEYGNVSNVLKL-DSNVTVPQVKEDQVLIKVVAASINPVDAK-RMLGM  64

Query  402   VPMN---FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTV  572
               ++    P +PG D+AG+VV  GS V +  +GDEVYG+I+   L+   K+ G+LAE+T 
Sbjct  65    FKVSDPPLPTVPGYDVAGVVVEVGSQVKRLKVGDEVYGDINEKALD-HPKQFGSLAEYTA  123

Query  573   VEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqla  752
             VEE L+A+KPKNL+F  AASLPL I+TA +G    GF  G+S+ ++GGAGGVG+  +QLA
Sbjct  124   VEENLLALKPKNLSFAEAASLPLVIETAYEGLERTGFSAGKSILVLGGAGGVGTQIIQLA  183

Query  753   KHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVV  932
             KHV+GAS+VAAT+S  K+E +K LGAD  +DYTN  +E +PE +D+VYD +G    +   
Sbjct  184   KHVFGASTVAATSSTSKLELLKSLGADLAIDYTNENFEDLPEKFDVVYDAVGQCDRAVKA  243

Query  933   AKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
              KE+ +++ I  P + P  +   LT +G +L+KLKP+LESGKVK V+DP GPF F   VE
Sbjct  244   VKEDGSVVTIVGPVTPPALIFV-LTSNGSVLDKLKPYLESGKVKPVLDPKGPFPFSQTVE  302

Query  1113  AFGYIETGRARGKVVISPFP  1172
             AF Y+ET RA GKVVI P P
Sbjct  303   AFSYLETCRAVGKVVIYPIP  322



>ref|XP_004509819.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Cicer arietinum]
Length=388

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 159/311 (51%), Positives = 208/311 (67%), Gaps = 7/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVP--QHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             KAW Y E+G  +VLK  D  I VP  + DQ+LV+V AAALNP+D K RQ      +   P
Sbjct  81    KAWVYGEYGGVDVLKF-DSSIAVPDVKEDQVLVRVFAAALNPVDGKRRQGKFKATDSPLP  139

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV  GS V  F +GDEVYG+++   LEG  K+ G+LAE+T VEE L+A+K
Sbjct  140   TVPGYDVAGVVVKVGSEVKDFKVGDEVYGDVNEKALEGP-KQFGSLAEYTAVEEKLLALK  198

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL F  AASLPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAK V+GAS V
Sbjct  199   PKNLDFAQAASLPLAIETAYEGLERTGFSAGKSILVLNGSGGVGSLVIQLAKQVFGASRV  258

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT S   +E +K LGAD  +DYT   +E +PE +D+VYD IG    +    KE  +++ 
Sbjct  259   AATASTRNLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVKAIKEGGSVVA  318

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             +T   + P      +T +G +L+KL P+LESGKVK ++DP GPF F  VVEAF Y+ET R
Sbjct  319   LTGAVTPP-GFRFVVTSNGAVLKKLNPYLESGKVKPIVDPKGPFPFDQVVEAFSYVETNR  377

Query  1140  ARGKVVISPFP  1172
             A GKVVI P P
Sbjct  378   ATGKVVIYPIP  388



>gb|KHN26872.1| Quinone oxidoreductase-like protein, chloroplastic [Glycine soja]
Length=394

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 207/310 (67%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  87    KAWVYGEYGGVDVLKLDSNVAVPDVKEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  146

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F +GDEVYG+++   LEG  K+ G+LAE+T VEE L+A KP
Sbjct  147   VPGYDVAGVVVKVGSQVKDFKVGDEVYGDVNEKALEGP-KQFGSLAEYTAVEEKLLAPKP  205

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AASLPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAK VYGAS VA
Sbjct  206   KNLDFAQAASLPLAIETAYEGLERTGFSPGKSILVLNGSGGVGSLVIQLAKQVYGASRVA  265

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S   ++ +K LGAD  +DYT   +E +PE +D+VYD IG    +    KE+ +++ +
Sbjct  266   ATSSTRNLDLLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVKAVKEDGSVVAL  325

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T     P      +T +GE+L KL P+LESGKVK ++DP GPF F  + EAF Y+ET RA
Sbjct  326   TG-AVTPPGFRFVVTSNGEVLRKLNPYLESGKVKPIVDPKGPFPFDKLAEAFSYLETNRA  384

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  385   TGKVVIHPIP  394



>ref|XP_008230612.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Prunus mume]
Length=323

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 215/322 (67%), Gaps = 13/322 (4%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHG-PKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK-----L  386
             + +  + KAW Y E+G   +VLKL D  +PVP+   DQ+L++V AAALNP+D+K      
Sbjct  7     DSIPSVNKAWVYSEYGKAADVLKL-DPNVPVPEIKEDQVLIKVVAAALNPVDYKRMFGYF  65

Query  387   RQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEF  566
             + T   P   P +PG D+AG+VV  GS VTKF +GDEVYG++++  LE      G+LAE+
Sbjct  66    KATDSPP---PTVPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNDKGLENP-TSFGSLAEY  121

Query  567   TVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavq  746
             T   E ++A+KP+NL+F  AASLPLAI+TA +G     F  G+S+ ++GGAGGVG+  +Q
Sbjct  122   TAAAERVLALKPQNLSFVEAASLPLAIETAYEGLERTEFSAGKSILVLGGAGGVGTHVIQ  181

Query  747   laKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSF  926
             LAKHV+GAS VAAT S  K+E ++ LGAD  VDYT   +E++PE +D+VYDT+G+S  + 
Sbjct  182   LAKHVFGASKVAATASTRKLELLRSLGADLAVDYTKEKFEELPEKFDVVYDTVGESDRAV  241

Query  927   VVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNV  1106
                KE   ++ I   P    A    LT +G ILEKLKP+LESGKVK V+DP  P+ F   
Sbjct  242   KAVKEGGKVVTIVPGPVAAAAFIFILTSTGTILEKLKPYLESGKVKPVLDPTSPYPFSKT  301

Query  1107  VEAFGYIETGRARGKVVISPFP  1172
             VEAF Y+ET RA GKVV+ P P
Sbjct  302   VEAFAYLETSRAIGKVVVHPIP  323



>ref|XP_006365236.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Solanum tuberosum]
Length=388

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 158/310 (51%), Positives = 213/310 (69%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y ++G  +VLKL  +  +P  + DQ+L++V AAALNPIDFK R       +   P 
Sbjct  81    KAWSYTDYGSVDVLKLESNVAVPDIKEDQVLIKVVAAALNPIDFKRRLGKFKATDSPLPT  140

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V +   GDEVYG+I+   ++G   + G+LAE+T VEE LVA+KP
Sbjct  141   VPGYDVAGVVVKVGSQVKELKEGDEVYGDINEKAIDGP-NQFGSLAEYTAVEEKLVALKP  199

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL+F  AA+LPL I+TA +G   AGF  GQS+ ++GGAGGVGSL +QLAKHV+GAS VA
Sbjct  200   KNLSFAEAAALPLVIETAYEGLEKAGFSAGQSILVLGGAGGVGSLVIQLAKHVFGASKVA  259

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+E +K LGAD  +DYT   +E +P+ +D+VYD++G    +    KE  +++ +
Sbjct  260   ATSSTGKLELLKSLGADLAIDYTKDNFEDLPDKFDVVYDSVGQGEKAVKAVKEGGSVVVL  319

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T     P      +T +GE+L+KL P+LESGKVK VIDP GPF F  VV+AF ++ETGRA
Sbjct  320   TG-AVTPPGFRFVVTSNGEMLKKLNPYLESGKVKPVIDPKGPFPFDKVVDAFSHLETGRA  378

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  379   TGKVVIYPIP  388



>ref|XP_003532009.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Glycine max]
Length=397

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 207/310 (67%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  90    KAWVYGEYGGVDVLKLDSNVAVPDVKEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  149

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F +GDEVYG+++   LEG  K+ G+LAE+T VEE L+A KP
Sbjct  150   VPGYDVAGVVVKVGSQVKDFKVGDEVYGDVNEKALEGP-KQFGSLAEYTAVEEKLLAPKP  208

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AASLPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAK VYGAS VA
Sbjct  209   KNLDFAQAASLPLAIETAYEGLERTGFSPGKSILVLNGSGGVGSLVIQLAKQVYGASRVA  268

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S   ++ +K LGAD  +DYT   +E +PE +D+VYD IG    +    KE+ +++ +
Sbjct  269   ATSSTRNLDLLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVKAVKEDGSVVAL  328

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T     P      +T +GE+L KL P+LESGKVK ++DP GPF F  + EAF Y+ET RA
Sbjct  329   TG-AVTPPGFRFVVTSNGEVLRKLNPYLESGKVKPIVDPKGPFPFDKLAEAFSYLETNRA  387

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  388   TGKVVIHPIP  397



>gb|ABK92721.1| unknown [Populus trichocarpa]
Length=322

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 156/313 (50%), Positives = 213/313 (68%), Gaps = 10/313 (3%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN---  413
             KAW Y E+G    VLKL D  + VPQ   DQ+L++V AA++NP+D K R   +  ++   
Sbjct  14    KAWVYGEYGNVSNVLKL-DSNVTVPQVKEDQVLIKVVAASINPVDAK-RMLGMFKVSDSP  71

Query  414   FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVA  593
              P +PG D+AG+VV  GS V +  +GDEVYG+I+   L+   KR G+LAE+T VEE L++
Sbjct  72    VPTVPGYDVAGVVVKVGSQVKRLKVGDEVYGDINEKALD-HPKRFGSLAEYTAVEENLLS  130

Query  594   MKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGAS  773
             +KPKNL+F  AASLPL I+TA +G    GF  G+S+ ++GGAGGVG+  +QLAKHV+GAS
Sbjct  131   LKPKNLSFAEAASLPLVIETAHEGLERTGFSAGKSILVLGGAGGVGTQIIQLAKHVFGAS  190

Query  774   SVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATI  953
             +VAAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD +G    +    KE+ ++
Sbjct  191   TVAATSSTSKLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAVGQCDRAVKAVKEDGSV  250

Query  954   IDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIET  1133
             + I  P + P  +   LT +G +L+KLKP+LESGKVK V+DP GPF F    EAF Y+ET
Sbjct  251   VTIVGPITPPALIFV-LTSNGSVLDKLKPYLESGKVKPVLDPKGPFPFSQTAEAFSYLET  309

Query  1134  GRARGKVVISPFP  1172
              RA GKVVI P P
Sbjct  310   SRAVGKVVIYPIP  322



>gb|KHN27018.1| Quinone oxidoreductase-like protein, chloroplastic [Glycine soja]
Length=309

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 206/310 (66%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             +AW Y E+G  +VLKL  +  +P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  2     RAWVYGEYGGVDVLKLDSNVTVPDVKEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F +GDEVYG+++   LEG  K+ G+LAE+T VEE L+A KP
Sbjct  62    VPGYDVAGVVVKVGSQVKDFKVGDEVYGDVNEKALEGP-KQFGSLAEYTAVEEKLLASKP  120

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AA+LPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAK V+GAS VA
Sbjct  121   KNLDFAQAAALPLAIETAYEGLERTGFSPGKSILVLNGSGGVGSLVIQLAKQVFGASRVA  180

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S   ++ +K LGAD  +DYT   +E +PE +D+VYD IG    +    KE  +++ +
Sbjct  181   ATSSTRNLDLLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVKAVKEGGSVVAL  240

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G +L KL P+LESGKVK ++DP GPF F  + EAF Y+ET RA
Sbjct  241   TGAVTPP-GFRFVVTSNGAVLRKLNPYLESGKVKPIVDPKGPFSFDKLAEAFSYLETNRA  299

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  300   TGKVVIHPIP  309



>ref|XP_007151048.1| hypothetical protein PHAVU_004G014100g [Phaseolus vulgaris]
 gb|ESW23042.1| hypothetical protein PHAVU_004G014100g [Phaseolus vulgaris]
Length=325

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 156/312 (50%), Positives = 210/312 (67%), Gaps = 8/312 (3%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN--F  416
             KAWYY EHG P +VLK  D   P+PQ   DQ+L++V A +LNP+D+K         +   
Sbjct  17    KAWYYSEHGSPADVLKF-DLNWPLPQLKDDQVLIKVIAVSLNPVDYKRIHGVFKDTDPYL  75

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P++PG D+AGIVV  G  V KF++GDEVYG+I+   L   LK +GTL+E+TV EE L+A 
Sbjct  76    PIVPGFDVAGIVVRVGGEVRKFNVGDEVYGDINEQGL-SNLKILGTLSEYTVAEERLLAH  134

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KP NL+F  AAS+PLA++TA +GF  A F   +S+ ++GGAGGVGS A+QLAKHVY AS 
Sbjct  135   KPSNLSFIEAASIPLALETAFEGFEHAQFSAAKSILVLGGAGGVGSYAIQLAKHVYKASV  194

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             +AAT S  K+E ++ LG D  +DYT   +E++PE YDLVYDT+G +  +F   KE+  ++
Sbjct  195   IAATASTGKLELLRELGVDLAIDYTKHNFEELPEKYDLVYDTVGQADRAFKAIKEDGKVV  254

Query  957   DITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
              I  PP  P A+   LT  G IL+KL+P+ ESG+VK ++D   P  F  +VEA  Y+ET 
Sbjct  255   TIV-PPGYPPAITFVLTSKGSILDKLRPYFESGQVKPILDAKTPLPFSQLVEAISYLETS  313

Query  1137  RARGKVVISPFP  1172
             RA GKVV+ P P
Sbjct  314   RATGKVVVYPIP  325



>gb|AFK38435.1| unknown [Lotus japonicus]
Length=318

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 157/311 (50%), Positives = 206/311 (66%), Gaps = 5/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             KAW Y E+G    +   D  +P+P+   D +L++V AAALNPID K  +      +   P
Sbjct  9     KAWTYSEYGKSTDIHKFDPNVPLPELKEDHVLIKVVAAALNPIDCKRMEALFKDTDSPLP  68

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
               PG D+AG+VV  GS V KF +GDEVYG+I+   LE   K +G+LAE+T VEE L+A K
Sbjct  69    TAPGYDVAGVVVKVGSEVKKFKVGDEVYGDINENALEYP-KVVGSLAEYTAVEEKLLAHK  127

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL+F  AASLPLAI+TA +G   AGF  G+S+ ++GGAGGVG+  +QLAKHV+GAS V
Sbjct  128   PKNLSFVEAASLPLAIETAYEGLERAGFSAGKSILVLGGAGGVGTHVIQLAKHVFGASKV  187

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K+E ++ LGAD  +DYT    E +PE +D+V+D +GD+  +F   KE    + 
Sbjct  188   AATSSTGKLELLRKLGADMPIDYTKENAENLPEKFDVVFDAVGDADTTFKPLKEGGKFVT  247

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I  P   P A++  L   G +LEKLKP+LESGKVK ++DP  PF F   VEAF Y+ET R
Sbjct  248   IVPPGLPPPAIYYILKSDGAVLEKLKPYLESGKVKPILDPKSPFPFSQTVEAFSYLETNR  307

Query  1140  ARGKVVISPFP  1172
             A GKVVI P P
Sbjct  308   AVGKVVIHPIP  318



>ref|XP_010023565.1| PREDICTED: 2-methylene-furan-3-one reductase [Eucalyptus grandis]
 gb|KCW59868.1| hypothetical protein EUGRSUZ_H02605 [Eucalyptus grandis]
Length=397

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 161/319 (50%), Positives = 211/319 (66%), Gaps = 11/319 (3%)
 Frame = +3

Query  234   GLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVP  407
             G+    KAW Y E+G  +VLK  D  + VP+   DQ+L++V AAALNP+D K RQ     
Sbjct  84    GVPGEMKAWVYGEYGGVDVLKF-DPKVSVPEVKEDQVLIKVAAAALNPVDAKRRQGKFKA  142

Query  408   MN--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEE  581
              +   P +PG D+AG+VV  GS V +   GDEVYG+I+   LEG  K+ G+LAE+T VEE
Sbjct  143   TDSPLPTVPGYDIAGVVVKVGSQVKELKEGDEVYGDINEKALEGP-KQFGSLAEYTAVEE  201

Query  582   TLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHV  761
              L+A+KPKN+ F  AA LPLAI TA +G    GF  G+S+ ++GG+GGVGSL +QLAKHV
Sbjct  202   KLLALKPKNINFVQAAGLPLAISTAYEGLERTGFSAGKSILVLGGSGGVGSLVIQLAKHV  261

Query  762   YGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKE  941
             +GAS VAAT+S  K+EF+K LGAD  +DYT   +E +PE +D+VYD +G    +    KE
Sbjct  262   FGASRVAATSSTGKLEFLKSLGADLAIDYTKENFEDLPEKFDVVYDAVGQCDRAVKAIKE  321

Query  942   NATIIDITWP--PSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEA  1115
                ++ +T    P   R V   +T  GE+L+KL P++ESGKVK ++DP GPF F  V EA
Sbjct  322   GGIVVALTGAVVPPGFRFV---VTSKGEVLKKLNPYIESGKVKPIVDPKGPFPFSQVAEA  378

Query  1116  FGYIETGRARGKVVISPFP  1172
             F YIET RA GKVVI P P
Sbjct  379   FSYIETNRASGKVVIHPIP  397



>ref|XP_003552020.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Glycine max]
Length=395

 Score =   268 bits (685),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 206/310 (66%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  88    KAWVYGEYGGVDVLKLDSNVTVPDVKEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  147

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F +GDEVYG+++   LEG  K+ G+LAE+T VEE L+A KP
Sbjct  148   VPGYDVAGVVVKVGSQVKDFKVGDEVYGDVNEKALEGP-KQFGSLAEYTAVEEKLLASKP  206

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AA+LPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAK V+GAS VA
Sbjct  207   KNLDFAQAAALPLAIETAYEGLERTGFSPGKSILVLNGSGGVGSLVIQLAKQVFGASRVA  266

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S   ++ +K LGAD  +DYT   +E +PE +D+VYD IG    +    KE  +++ +
Sbjct  267   ATSSTRNLDLLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVKAVKEGGSVVAL  326

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G +L KL P+LESGKVK ++DP GPF F  + EAF Y+ET RA
Sbjct  327   TGAVTPP-GFRFVVTSNGAVLRKLNPYLESGKVKPIVDPKGPFSFDKLAEAFSYLETNRA  385

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  386   TGKVVIHPIP  395



>ref|XP_008379251.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Malus domestica]
Length=345

 Score =   266 bits (680),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 218/328 (66%), Gaps = 14/328 (4%)
 Frame = +3

Query  213   IFSTEPNGLQDMQKAWYYEEHGPK-EVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK  383
             + S++   +  + KAW Y E+G   +VLK  D  +PVP+   DQ+L++V AA+LNP+DFK
Sbjct  24    VASSDSVSIPSVNKAWVYSEYGKSADVLKF-DPNVPVPEIKEDQVLIKVVAASLNPVDFK  82

Query  384   -----LRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRM  548
                   + +   P   P +PG D+AG+VV  GS VTKF +GDEVYG+++   ++ + K++
Sbjct  83    RMLGYFKDSDSSP---PTVPGYDVAGVVVKVGSRVTKFXVGDEVYGDLNEKAID-KPKKI  138

Query  549   GTLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggv  728
             G+LAE+T  EE ++A+KPKNL+F  AASLPLAI+TA +G     F  G+S+ ++GGAGGV
Sbjct  139   GSLAEYTAAEERVLALKPKNLSFVEAASLPLAIETAYEGLERVEFSAGKSILVLGGAGGV  198

Query  729   gslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG  908
             G+  +QLAKH +GAS VAAT S  K++ ++  GAD  +DYT   +E +PE +D+VYD +G
Sbjct  199   GTHVIQLAKHXFGASKVAATASTKKLDXLRSXGADLAIDYTKENFEDLPEKFDVVYDAVG  258

Query  909   DSINSFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGP  1088
              S  +    KE   ++ I   P  P A+   LT +G  LEKLKP+LESGKVK V+DP GP
Sbjct  259   QSDRALKAVKEGGKVVTIVG-PXTPPAIIFXLTSTGTXLEKLKPYLESGKVKPVLDPTGP  317

Query  1089  FHFCNVVEAFGYIETGRARGKVVISPFP  1172
             + F   VEAF Y+ET RA GKVV+ P P
Sbjct  318   YPFSKTVEAFAYLETSRAAGKVVVYPIP  345



>gb|ABK24706.1| unknown [Picea sitchensis]
Length=398

 Score =   267 bits (683),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 215/314 (68%), Gaps = 8/314 (3%)
 Frame = +3

Query  246   MQKAWYYEEHGP-KEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN-  413
             +QKAW Y+E+G  K+VL+L D  +PVP+   DQ+L++V AAALNP+DFK RQ      + 
Sbjct  88    VQKAWIYKEYGAAKDVLQLDDG-VPVPEVKEDQVLIKVCAAALNPVDFKRRQGKFKATDS  146

Query  414   -FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLV  590
               P +PG D+AGIV+  GS V  F  GDEVYG+I+   L+   K+ G+L E+T VEE LV
Sbjct  147   PLPTVPGYDVAGIVIKVGSKVEGFKEGDEVYGDINEKALDNP-KQYGSLGEYTAVEEKLV  205

Query  591   AMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGA  770
             A+KPKNL F  AASLPLAI TA +G   AGF  G+S+ ++GGAGGVGSL +QLA+ V+GA
Sbjct  206   ALKPKNLDFTQAASLPLAILTAYEGLERAGFGPGKSILVLGGAGGVGSLVIQLARKVFGA  265

Query  771   SSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENAT  950
             S++AAT+S  K+EF+K LG D  +DYT   +E++PE YD++YD +G    +    K   +
Sbjct  266   STIAATSSTGKLEFLKSLGTDISIDYTKQNFEELPEKYDVIYDAVGQCDKAVKAIKGGGS  325

Query  951   IIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
             ++ +T   + P      +T +G +L KL P+LESG++K +IDP G F F  +VEAF Y+E
Sbjct  326   VVALTGAVTPP-GFRFVVTSNGSVLSKLNPYLESGEIKPIIDPKGSFSFSQLVEAFSYLE  384

Query  1131  TGRARGKVVISPFP  1172
             T RA GKVVISP P
Sbjct  385   TCRATGKVVISPIP  398



>gb|KHG10556.1| hypothetical protein F383_11141 [Gossypium arboreum]
Length=385

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 205/310 (66%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL D + +P  + D++L++V AAALNP+D K RQ      +   P 
Sbjct  78    KAWVYGEYGGVDVLKLDDKVSVPEVKEDEVLIKVAAAALNPVDAKRRQGKFKATDSPLPT  137

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V +   GDEVYGNI+   LEG  ++ G+LA++T VEE L+A+KP
Sbjct  138   VPGYDVAGVVVKVGSQVKELKEGDEVYGNINEKALEGP-RQFGSLAQYTAVEEKLLALKP  196

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AA LPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAK V+GAS VA
Sbjct  197   KNLDFSQAAGLPLAIETAYEGLERTGFSSGKSILVLNGSGGVGSLVIQLAKQVFGASKVA  256

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+E +K LGAD  +DYT    E +PE +D+V+D IG    +    KE  +++ +
Sbjct  257   ATSSTGKLELLKSLGADLAIDYTKENLEDLPEKFDVVFDAIGQCDRAVKAVKEGGSVVAL  316

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T     P      +T  GE+L+KL  +LESGKVK V+DP GPF F  V EAF YIET RA
Sbjct  317   TG-AVTPPGFRFVVTSKGEVLKKLNSYLESGKVKPVVDPRGPFPFTQVDEAFSYIETNRA  375

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  376   TGKVVIHPIP  385



>gb|AFJ53076.1| enone oxidoreductase [Mangifera indica]
Length=380

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 160/322 (50%), Positives = 209/322 (65%), Gaps = 7/322 (2%)
 Frame = +3

Query  219   STEPNGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQ  392
             +T+ + +    KAW Y E+G  +VLK  D  + VPQ   DQ+L++V AAALNP+D K RQ
Sbjct  62    ATKVSSVPSEMKAWVYGEYGGVDVLKF-DEKVSVPQVKEDQVLIKVVAAALNPVDAKRRQ  120

Query  393   TSLVPMN--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEF  566
                   +   P +PG D+AG+VV  GS V +F  GDEVYG+I+   LEG  K+ G+LAE+
Sbjct  121   GKFKATDSPLPTVPGYDVAGVVVKVGSQVKEFKEGDEVYGDINEKALEGP-KQFGSLAEY  179

Query  567   TVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavq  746
             T VEE L+A+KPKNL F  AA LPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +Q
Sbjct  180   TAVEEKLLALKPKNLDFVQAAGLPLAIETAYEGLERTGFSAGKSILVLNGSGGVGSLVIQ  239

Query  747   laKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSF  926
             LAK V+GAS VAAT+    +E +K LG D  +DYT    E +PE +D+VYD IG    + 
Sbjct  240   LAKQVFGASKVAATSGTRNLELLKSLGTDLAIDYTKENIEDLPEKFDVVYDAIGQCDRAV  299

Query  927   VVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNV  1106
              V KE   ++ +T   + P      +T +G +L+KL  FLESGKVK VIDP GPF F  V
Sbjct  300   KVVKEGGAVVALTGAVTPP-GFRFVVTSNGAVLKKLNAFLESGKVKPVIDPKGPFPFSQV  358

Query  1107  VEAFGYIETGRARGKVVISPFP  1172
             +EAF YIET RA GKVVI P P
Sbjct  359   IEAFSYIETNRATGKVVIYPIP  380



>ref|XP_011002607.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Populus euphratica]
Length=413

 Score =   267 bits (682),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 156/321 (49%), Positives = 210/321 (65%), Gaps = 5/321 (2%)
 Frame = +3

Query  219   STEPNGLQDMQKAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQT  395
             +T+ + +    KA  Y E+G  EVLK  D + +P  + DQ+L++V AAALNP+D K RQ 
Sbjct  95    ATKVSSIPSEMKACVYGEYGGVEVLKFDDKVSVPEVKEDQVLIKVAAAALNPVDAKRRQG  154

Query  396   SLVPMN--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFT  569
                  +   P +PG D+AG+VV  G+ V +   GD VYGNI+   LEG  K+ G+LAE+T
Sbjct  155   KFKATDSPLPTVPGYDVAGVVVKVGNQVKELKEGDAVYGNINEKALEGP-KQFGSLAEYT  213

Query  570   VVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql  749
              VEE L+A+KPKNL F  AA LPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QL
Sbjct  214   AVEEKLLALKPKNLDFIQAAGLPLAIETAYEGLERTGFSAGKSILVLNGSGGVGSLVIQL  273

Query  750   aKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV  929
             AKHV+GAS +AAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD IG    +  
Sbjct  274   AKHVFGASRIAATSSTGKLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDKAVK  333

Query  930   VAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVV  1109
             V KE  +++ +T   + P      +T +G  L+ L P+LESGK+K V+DP GPF F  V 
Sbjct  334   VVKEGGSVVALTGAVTPP-GFRFVVTSNGNTLKTLNPYLESGKIKPVVDPKGPFTFSQVA  392

Query  1110  EAFGYIETGRARGKVVISPFP  1172
             EAF YIET RA GKVVI P P
Sbjct  393   EAFSYIETNRATGKVVIHPIP  413



>ref|XP_010251268.1| PREDICTED: 2-methylene-furan-3-one reductase-like isoform X1 
[Nelumbo nucifera]
Length=398

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 160/311 (51%), Positives = 206/311 (66%), Gaps = 7/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVP--QHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             KAW Y E+G  +VLK  D  + VP  + DQ+L++V AAALNP+D K RQ      +   P
Sbjct  91    KAWVYGEYGGVDVLKF-DPKVSVPDVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLP  149

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AGIVV  GS V     GDEVYGNI+   LE   K+ G+ AE+T VEE L+A K
Sbjct  150   TVPGYDVAGIVVKAGSQVQSLKEGDEVYGNINEKALENP-KQFGSFAEYTAVEEKLLAPK  208

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL F  AASLPLA++TA +G   +GF  G+S+ ++GGAGGVG+L +QLAK V+GAS V
Sbjct  209   PKNLDFAQAASLPLAVETAYEGLERSGFSAGKSILVLGGAGGVGTLVIQLAKQVFGASKV  268

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K+E +K LGAD  +DYT   +E +PE +D+V+D +G    S    KE  +++ 
Sbjct  269   AATSSTGKLELLKSLGADLAIDYTKENFEDLPEKFDVVFDAVGQGDKSVKAVKEGGSVVV  328

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             +T     P      +T +G +L+KL P+ ESGKVK VIDP GPF F  VVEAF YIETGR
Sbjct  329   LTG-AVTPPGFRFVVTSNGSVLKKLNPYFESGKVKPVIDPKGPFPFSQVVEAFSYIETGR  387

Query  1140  ARGKVVISPFP  1172
             A GKVVI P P
Sbjct  388   ATGKVVIHPIP  398



>emb|CBI28522.3| unnamed protein product [Vitis vinifera]
Length=309

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 209/311 (67%), Gaps = 7/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVP--QHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             KAW Y ++G  +VLK  D  + VP  + DQ+L++V AAALNP+D K RQ      +   P
Sbjct  2     KAWVYGDYGGVDVLKF-DTAVSVPPVKEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLP  60

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV  GS V +   GDEVYG+I+   L+G  K+ G+ AE+T VEE L+A+K
Sbjct  61    TVPGYDVAGVVVKVGSQVKELKEGDEVYGDINEKALDGP-KQFGSFAEYTAVEEKLLALK  119

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL F  AA LPLAI+TA +G    GF  G+S+ ++GGAGGVGSL +QLAK V+GAS V
Sbjct  120   PKNLDFVQAAGLPLAIETAYEGLERTGFSAGKSILVLGGAGGVGSLVIQLAKQVFGASRV  179

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K+E +K LGAD  +DYT   +E + E +D+VYD +G    +  V KE  +++ 
Sbjct  180   AATSSTAKLELLKSLGADLTIDYTKENFEDLAEKFDVVYDAVGQCDKAVKVVKEGGSVVA  239

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             +T   + P      +T +GE+L+KL P+LESGKVK V+DP GPF F  VVEAF Y+ET R
Sbjct  240   LTGAVTPP-GFRFVVTSNGEVLKKLNPYLESGKVKPVVDPKGPFPFSQVVEAFSYVETSR  298

Query  1140  ARGKVVISPFP  1172
             A GK+VI P P
Sbjct  299   ATGKIVIHPIP  309



>ref|XP_008348027.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Malus domestica]
Length=326

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 216/328 (66%), Gaps = 14/328 (4%)
 Frame = +3

Query  213   IFSTEPNGLQDMQKAWYYEEHGPK-EVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK  383
             + S++   +  + KAW Y E G   +VLK  D  +PVP+   DQ+L++V AA LNP+DFK
Sbjct  5     VASSDSVSIPSVNKAWVYSEXGKSADVLKF-DPNVPVPEIKEDQVLIKVVAAXLNPVDFK  63

Query  384   -----LRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRM  548
                   + +   P   P +PG D+AG VV  GS VTKF +GDEVYG+++   L+ + K++
Sbjct  64    RMLGYFKDSDSSP---PTVPGYDVAGXVVKVGSRVTKFKVGDEVYGDLNEKXLD-KPKKI  119

Query  549   GTLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggv  728
             G+LAE+T  EE ++A+KPKNL+F  AASLPLAI+TA +G     F  G+S+ ++GGAGGV
Sbjct  120   GSLAEYTAAEERVLALKPKNLSFVEAASLPLAIETAYEGLERVEFSAGKSILVLGGAGGV  179

Query  729   gslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG  908
             G+  +QLAKHV+ AS VAAT S  K++ ++ LGAD  +DYT   +E +PE +D+VY+ +G
Sbjct  180   GTHVIQLAKHVFSASKVAATASTKKLDLLRSLGADLAIDYTKENFEDLPEKFDVVYBAVG  239

Query  909   DSINSFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGP  1088
             +   +    KE   +  I   P  P A+   LT +G +LEKLKP+LESGKVK V+DP GP
Sbjct  240   ZXDRAXKAVKEGGKVXTIXX-PVTPPAIIFVLTSTGAVLEKLKPYLESGKVKPVLDPTGP  298

Query  1089  FHFCNVVEAFGYIETGRARGKVVISPFP  1172
             + F   VEAF Y+ET RA GKVV+ P P
Sbjct  299   YPFSKTVEAFAYLETSRATGKVVVYPIP  326



>ref|XP_004304618.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=322

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/318 (49%), Positives = 209/318 (66%), Gaps = 6/318 (2%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTS  398
               +  + KAW Y E+G   +VLK      +P  + DQ+L++V AA+LNP+DFK  L    
Sbjct  7     ESIPSVNKAWVYSEYGKTSDVLKFDPSVAVPEIKEDQVLIKVVAASLNPVDFKRALGYFK  66

Query  399   LVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVE  578
                   P IPG D+AG+VV  GS VTKF +GDEVYG+++   L     R G+LAE+T  +
Sbjct  67    DTDSPLPTIPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNETALVNP-TRFGSLAEYTAAD  125

Query  579   ETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKH  758
             E ++A KPKNL+F  AASLPLAI+TA +G   A    G+SV ++GGAGGVG+  +QLAKH
Sbjct  126   ERVLAHKPKNLSFIEAASLPLAIETAHEGLERAELSAGKSVLVLGGAGGVGTHIIQLAKH  185

Query  759   VYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAK  938
             VYGAS VAAT S  K++ ++ LGAD  +DYT   +E +PE +D+VYD +G++  +    K
Sbjct  186   VYGASKVAATASTKKLDLLRTLGADLAIDYTKENFEDLPEKFDVVYDAVGETDKAVKAVK  245

Query  939   ENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAF  1118
             E   ++ I   P+ P A+   LT  G +LEKLKP+LESGKVK V+DP  P+ F  VVEAF
Sbjct  246   EGGKVVTIVG-PATPPAILFVLTSKGSVLEKLKPYLESGKVKPVLDPTSPYPFTKVVEAF  304

Query  1119  GYIETGRARGKVVISPFP  1172
             GY+E+ RA GKVV+ P P
Sbjct  305   GYLESSRATGKVVVYPIP  322



>gb|ACN40074.1| unknown [Picea sitchensis]
Length=332

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 214/314 (68%), Gaps = 8/314 (3%)
 Frame = +3

Query  246   MQKAWYYEEHGP-KEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN-  413
             +QKAW Y+E+G  K+VL+L D  +PVP+   DQ+L++V AAALNP+DFK RQ      + 
Sbjct  22    VQKAWIYKEYGAAKDVLQLDDG-VPVPEVKEDQVLIKVCAAALNPVDFKRRQGKFKATDS  80

Query  414   -FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLV  590
               P +PG D+AGIV+  GS V  F  GDEVYG+I+   L+   K+ G+L E+T VEE LV
Sbjct  81    PLPTVPGYDVAGIVIKVGSKVEGFKEGDEVYGDINEKALDNP-KQYGSLGEYTAVEEKLV  139

Query  591   AMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGA  770
             A+KPKNL F  AASLPLAI TA +G   AGF  G+S+ ++GGAGGVGSL +QLA+ V+GA
Sbjct  140   ALKPKNLDFTQAASLPLAILTAYEGLERAGFGPGKSILVLGGAGGVGSLVIQLARKVFGA  199

Query  771   SSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENAT  950
             S++AAT+S  K+EF+K L  D  +DYT   +E++PE YD++YD +G    +    K   +
Sbjct  200   STIAATSSTGKLEFLKSLSTDISIDYTKQNFEELPEKYDVIYDAVGQCDKAVKAIKGGGS  259

Query  951   IIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
             ++ +T   + P      +T +G +L KL P+LESG++K +IDP G F F  +VEAF Y+E
Sbjct  260   VVALTGAVTPP-GFRFVVTSNGSVLSKLNPYLESGEIKPIIDPKGSFSFSQLVEAFSYLE  318

Query  1131  TGRARGKVVISPFP  1172
             T RA GKVVISP P
Sbjct  319   TCRATGKVVISPIP  332



>ref|XP_007223016.1| hypothetical protein PRUPE_ppa006845mg [Prunus persica]
 gb|EMJ24215.1| hypothetical protein PRUPE_ppa006845mg [Prunus persica]
Length=393

 Score =   266 bits (680),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 165/316 (52%), Positives = 215/316 (68%), Gaps = 7/316 (2%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLV  404
             + L    KAW Y E+G  +VLK  D  + VP+   DQ+LV+V AAALNP+DFK RQ    
Sbjct  79    SALPSEMKAWVYGEYGGVDVLKF-DTKVAVPELLEDQVLVKVVAAALNPVDFKRRQGKFQ  137

Query  405   PMN--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVE  578
               +   P +PG D+AG+VV  GS V  F  GDEVYG+I+   LEG  K+ G+LAE+T VE
Sbjct  138   NTDSPLPTVPGYDVAGVVVKVGSKVKDFKEGDEVYGDINEKALEGP-KKSGSLAEYTAVE  196

Query  579   ETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKH  758
             E L+A+KPKNL F  AA+LPLAI+TA +G    GF  G+S+ ++ GAGGVGSL +QLAKH
Sbjct  197   ERLLALKPKNLDFVQAAALPLAIETAYEGLERTGFSAGKSLLVLNGAGGVGSLVIQLAKH  256

Query  759   VYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAK  938
             V+GAS VAAT+S  K+E +K LGAD  +DYT   +E++PE +D+VYD IG    +  V K
Sbjct  257   VFGASRVAATSSTGKLELLKSLGADLAIDYTKENFEELPEKFDVVYDAIGQCDKAVKVVK  316

Query  939   ENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAF  1118
             E  +++ +T   + P      +T +G +L+KL P+LESGKVKAVIDP GPF F  +VEAF
Sbjct  317   EGGSVVALTGAVTPP-GFRFVVTSNGAVLKKLNPYLESGKVKAVIDPKGPFPFSKLVEAF  375

Query  1119  GYIETGRARGKVVISP  1166
              Y+ET RA GKVVI P
Sbjct  376   SYLETNRATGKVVIHP  391



>ref|XP_002323668.2| hypothetical protein POPTR_0016s14310g [Populus trichocarpa]
 gb|EEF05429.2| hypothetical protein POPTR_0016s14310g [Populus trichocarpa]
Length=383

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/321 (49%), Positives = 210/321 (65%), Gaps = 5/321 (2%)
 Frame = +3

Query  219   STEPNGLQDMQKAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQT  395
             +T+ + +    KA  Y E+G  EVLK  D + +P  + DQ+L++V AAALNP+D K RQ 
Sbjct  65    ATKVSSIPSEMKACVYGEYGGVEVLKFDDKVSVPEVKEDQVLIKVVAAALNPVDAKRRQG  124

Query  396   SLVPMN--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFT  569
                  +   P +PG D+AG+VV  G+ V +   GD VYGNI+   LEG  K+ G+LAE+T
Sbjct  125   KFKATDSPLPTVPGYDVAGVVVKVGNQVKELKEGDAVYGNINEKALEGP-KQFGSLAEYT  183

Query  570   VVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql  749
              VEE L+A+KPKNL F  AA LPLAI+TA +G    GF  G+S+ ++ GAGGVGSL +QL
Sbjct  184   AVEEKLLALKPKNLDFIQAAGLPLAIETAYEGLERTGFSAGKSILVLNGAGGVGSLVIQL  243

Query  750   aKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV  929
             AKHV+GAS +AAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD IG    +  
Sbjct  244   AKHVFGASRIAATSSTGKLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDKAVK  303

Query  930   VAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVV  1109
             V KE  +++ +T   + P      +T +G  L+ L P+LESGK+K V+DP GPF F  V 
Sbjct  304   VVKEGGSVVALTGAVTPP-GFRFVVTSNGNTLKTLNPYLESGKIKPVVDPKGPFTFSQVA  362

Query  1110  EAFGYIETGRARGKVVISPFP  1172
             EAF YIET RA GK+VI P P
Sbjct  363   EAFSYIETNRATGKIVIHPIP  383



>gb|ABK96279.1| unknown [Populus trichocarpa x Populus deltoides]
Length=383

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/321 (49%), Positives = 210/321 (65%), Gaps = 5/321 (2%)
 Frame = +3

Query  219   STEPNGLQDMQKAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQT  395
             +T+ + +    KA  Y E+G  EVLK  D + +P  + DQ+L++V AAALNP+D K RQ 
Sbjct  65    ATKVSSIPSEMKACVYGEYGGVEVLKFDDKVSVPEVKEDQVLIKVVAAALNPVDAKRRQG  124

Query  396   SLVPMN--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFT  569
                  +   P +PG D+AG+VV  G+ V +   GD VYGNI+   LEG  K+ G+LAE+T
Sbjct  125   KFKATDSPLPTVPGYDVAGVVVKVGNQVKELKEGDAVYGNINEKALEGP-KQFGSLAEYT  183

Query  570   VVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql  749
              VEE L+A+KPKNL F  AA LPLAI+TA +G    GF  G+S+ ++ GAGGVGSL +QL
Sbjct  184   AVEEKLLALKPKNLDFIQAAGLPLAIETAYEGLERTGFSAGKSILVLNGAGGVGSLVIQL  243

Query  750   aKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV  929
             AKHV+GAS +AAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD IG    +  
Sbjct  244   AKHVFGASRIAATSSTGKLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDKAVK  303

Query  930   VAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVV  1109
             V KE  +++ +T   + P      +T +G  L+ L P+LESGK+K V+DP GPF F  V 
Sbjct  304   VVKEGGSVVALTGAVT-PPGFRFVVTSNGNTLKTLNPYLESGKIKPVVDPKGPFTFSQVA  362

Query  1110  EAFGYIETGRARGKVVISPFP  1172
             EAF YIET RA GK+VI P P
Sbjct  363   EAFSYIETNRATGKIVIHPIP  383



>ref|XP_006470343.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Citrus sinensis]
Length=310

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 208/311 (67%), Gaps = 6/311 (2%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTSLVPMNFP  419
             KAW Y+E+G  + VLK   +  +P  + DQ+L++V AAALNPIDFK  L   S      P
Sbjct  2     KAWVYKEYGNSQSVLKFETNVEVPSLREDQVLIKVVAAALNPIDFKRMLGAFSATDSPLP  61

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              IPG D+AG+V   GS V KF +GDEVYG+I+   L+   KR G+LAE+T VEE L+A+K
Sbjct  62    TIPGYDVAGVVEKVGSQVKKFKVGDEVYGDINEKALD-HPKRNGSLAEYTAVEENLLALK  120

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL+F  AASLPLA +TA +G   + F  G+S+ ++GGAGGVG++ +QLAKHV+GAS V
Sbjct  121   PKNLSFVEAASLPLATETAYEGLERSAFSAGKSILVLGGAGGVGTMVIQLAKHVFGASKV  180

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K++ ++ LGAD  +DYT    E +PE +D+V+D +G    +    KE   ++ 
Sbjct  181   AATSSTAKLDLLRSLGADLAIDYTKENIEDLPEKFDVVFDAVGQCDKALKAVKEGGRVVS  240

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I    + P A    LT  G +LEKL P+LESGKVKA+IDP GPF F   +EAF ++E+ R
Sbjct  241   IIGSVTPP-ASSFVLTSDGSMLEKLNPYLESGKVKAIIDPKGPFPFSQTLEAFSHLESSR  299

Query  1140  ARGKVVISPFP  1172
             A GKVVI P P
Sbjct  300   ATGKVVIHPIP  310



>ref|XP_007215689.1| hypothetical protein PRUPE_ppa008712mg [Prunus persica]
 gb|EMJ16888.1| hypothetical protein PRUPE_ppa008712mg [Prunus persica]
Length=322

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/321 (48%), Positives = 213/321 (66%), Gaps = 12/321 (4%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGPK-EVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFK-----LR  389
             + +  + KAW Y E+G   +VLK   +  +P  + DQ+L++V AA+LNPIDFK      +
Sbjct  7     DSIPSVNKAWVYSEYGQSADVLKFDPNVAVPEIKEDQVLIKVVAASLNPIDFKRMLGYFK  66

Query  390   QTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFT  569
             +    P   P +PG D+AG+VV  GS VTKF +GDEVYG++ N N     K+ G+LAE+T
Sbjct  67    EIDSPP---PTVPGYDVAGVVVKVGSQVTKFKVGDEVYGDL-NENALVNPKKFGSLAEYT  122

Query  570   VVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql  749
               EE ++A+KP+NL+F  AASLPLA++TA +G     F  G+S+ ++GGAGGVG+  +QL
Sbjct  123   ASEERVLALKPQNLSFVEAASLPLALETAYEGLERTEFSAGKSILVLGGAGGVGTHVIQL  182

Query  750   aKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV  929
             AKHV+GAS VAAT S  K++ ++ LGAD  +DYT   +E +PE +D+VYD +G S  +  
Sbjct  183   AKHVFGASKVAATASTKKLDLLRSLGADLAIDYTKDNFEDLPEKFDVVYDAVGQSDRAVK  242

Query  930   VAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVV  1109
               KEN  ++ I +    P A+   LT +G ILEKLKP+LESGKVK V+DP  P+ F   +
Sbjct  243   AVKENGKVVTI-FGSVTPPALTFVLTSTGTILEKLKPYLESGKVKPVLDPTSPYPFSKTI  301

Query  1110  EAFGYIETGRARGKVVISPFP  1172
             EAF Y+ET RA GKVV+ P P
Sbjct  302   EAFAYLETSRATGKVVVHPIP  322



>sp|Q84V25.1|ENOXE_FRAAN RecName: Full=2-methylene-furan-3-one reductase; AltName: Full=Enone 
oxidoreductase; Short=FaEO; AltName: Full=Quinone oxidoreductase; 
Short=FaQR [Fragaria x ananassa]
 gb|AAO22131.1| quinone oxidoreductase [Fragaria x ananassa]
Length=322

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 209/318 (66%), Gaps = 6/318 (2%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTS  398
               +  + KAW Y E+G   +VLK      +P  + DQ+L++V AA+LNP+DFK  L    
Sbjct  7     ESIPSVNKAWVYSEYGKTSDVLKFDPSVAVPEVKEDQVLIKVVAASLNPVDFKRALGYFK  66

Query  399   LVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVE  578
                   P +PG D+AG+VV  GS VTKF +GDEVYG+++   L     R G+LAE+T  +
Sbjct  67    DTDSPLPTVPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNEAALVNP-TRFGSLAEYTAAD  125

Query  579   ETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKH  758
             E ++A KPK+L+F  AASLPLAI+TA +G   A    G+S+ ++GGAGGVG+  +QLAKH
Sbjct  126   ERVLAHKPKDLSFIEAASLPLAIETAYEGLERAELSAGKSILVLGGAGGVGTHIIQLAKH  185

Query  759   VYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAK  938
             V+GAS VAAT S  K++F++ LG D  +DYT    E +PE +D+VYD +G++  +    K
Sbjct  186   VFGASKVAATASTKKLDFLRTLGVDLAIDYTKENIEDLPEKFDVVYDAVGETDKAVKAVK  245

Query  939   ENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAF  1118
             E   ++ I   P+ P A+H  LT  G +LEKLKP+LESGKVK V+DP  P+ F  +VEAF
Sbjct  246   EGGKVVTIVG-PATPPAIHFVLTSKGSVLEKLKPYLESGKVKPVLDPTSPYPFTKLVEAF  304

Query  1119  GYIETGRARGKVVISPFP  1172
             GY+E+ RA GKVV+ P P
Sbjct  305   GYLESSRATGKVVVYPIP  322



>gb|ACZ74701.1| quinone oxidoreductase-like protein [Phaseolus vulgaris]
Length=326

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 211/315 (67%), Gaps = 13/315 (4%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK-----LRQTSLVP  407
             KAWYY EHG P +VLK  D   P+PQ   DQ+L++V A +LNP+D+K      + T   P
Sbjct  17    KAWYYSEHGSPADVLKF-DLNWPLPQLKDDQVLIKVIAVSLNPVDYKRIHGVFKDTD--P  73

Query  408   MNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETL  587
                 ++PG D+AGIVV  G  V KF++GDEVYG+I+   L   LK +GTL+E+TV EE L
Sbjct  74    YLPKIVPGFDVAGIVVRVGGEVRKFNVGDEVYGDINEQGLSN-LKILGTLSEYTVAEERL  132

Query  588   VAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYG  767
             +A KP NL+F  AAS+PLA++TA +GF  A F   +S+ ++GGAGGVGS A+QLAKHVY 
Sbjct  133   LAHKPSNLSFIEAASIPLALETAFEGFEHAQFSAAKSILVLGGAGGVGSYAIQLAKHVYK  192

Query  768   ASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENA  947
             AS +AAT S  K+E ++ LG D  +DYT   +E++PE YDLVYDT+G +  +F   KE+ 
Sbjct  193   ASVIAATASTGKLEVLRELGVDLAIDYTKHNFEELPEKYDLVYDTVGQADRAFKAIKEDG  252

Query  948   TIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYI  1127
              ++ I  PP  P A+   LT  G ILEKL+P+ ESG+VK ++D   P  F  +VEA  Y+
Sbjct  253   KVVTIV-PPGYPPAITFVLTSKGSILEKLRPYFESGQVKPILDAKTPLPFSQLVEAISYL  311

Query  1128  ETGRARGKVVISPFP  1172
             ET RA GKVV+ P P
Sbjct  312   ETSRATGKVVVYPIP  326



>gb|AFK38797.1| unknown [Medicago truncatula]
Length=328

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 214/312 (69%), Gaps = 8/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPM---NF  416
             KAW+Y EHG   ++LKL  ++ IP  + DQ+L++V AA+LNP+D+K R  +L      + 
Sbjct  20    KAWFYSEHGKASDILKLHPNWSIPQLKDDQVLIKVVAASLNPVDYK-RMHALFKETDPHL  78

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P++PG D+AGIV+  GS V KF +GDE+YG+I+   L   LK +GTL+E+T+ EE L+A 
Sbjct  79    PIVPGFDVAGIVIKVGSEVVKFKVGDEIYGDINEEGL-SNLKILGTLSEYTIAEERLLAH  137

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KPKNL+F  AAS+PLA++TA +G   A    G+S+ ++GGAGGVGS A+QLAKHVYGAS 
Sbjct  138   KPKNLSFIEAASIPLAMETAYEGLERAQLSAGKSILVLGGAGGVGSFAIQLAKHVYGASK  197

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             +AAT+S  K+EF++ LG D  +DYT   +E +PE +D+VYD +G+   +    KE   ++
Sbjct  198   IAATSSTGKIEFLRRLGVDLPIDYTKENFEDLPEKFDVVYDGVGEVDRAMKAIKEGGKVV  257

Query  957   DITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
              I  PP  P A+   LT  G ILEKL+P+ ESG++K ++D   P  F  V+EA+ Y+ET 
Sbjct  258   TIV-PPGFPPAIFFVLTSKGSILEKLRPYFESGQLKPILDSKTPVPFSEVIEAYSYLETS  316

Query  1137  RARGKVVISPFP  1172
             RA GKVVI P P
Sbjct  317   RATGKVVIYPIP  328



>ref|XP_003636314.1| Quinone oxidoreductase-like protein [Medicago truncatula]
Length=328

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 214/312 (69%), Gaps = 8/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPM---NF  416
             KAW+Y EHG   ++LKL  ++ IP  + DQ+L++V AA+LNP+D+K R  +L      + 
Sbjct  20    KAWFYSEHGKASDILKLHPNWSIPQLKDDQVLIKVVAASLNPVDYK-RMHALFKETDPHL  78

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P++PG D+AGIV+  GS V KF +GDE+YG+I+   L   LK +GTL+E+T+ EE L+A 
Sbjct  79    PIVPGFDVAGIVIKVGSEVVKFKVGDEIYGDINEEGL-SNLKILGTLSEYTIAEERLLAH  137

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KPKNL+F  AAS+PLA++TA +G   A    G+S+ ++GGAGGVGS A+QLAKHVYGAS 
Sbjct  138   KPKNLSFIEAASIPLAMETAYEGLERAQLSAGKSILVLGGAGGVGSFAIQLAKHVYGASK  197

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             +AAT+S  K+EF++ LG D  +DYT   +E +PE +D+VYD +G+   +    KE   ++
Sbjct  198   IAATSSTGKIEFLRKLGVDLPIDYTKENFEDLPEKFDVVYDGVGEVDRAMKAIKEGGKVV  257

Query  957   DITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
              I  PP  P A+   LT  G ILEKL+P+ ESG++K ++D   P  F  V+EA+ Y+ET 
Sbjct  258   TIV-PPGFPPAIFFVLTSKGSILEKLRPYFESGQLKPILDSKTPVPFSEVIEAYSYLETS  316

Query  1137  RARGKVVISPFP  1172
             RA GKVVI P P
Sbjct  317   RATGKVVIYPIP  328



>gb|KDO66209.1| hypothetical protein CISIN_1g021628mg [Citrus sinensis]
Length=310

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 155/311 (50%), Positives = 207/311 (67%), Gaps = 6/311 (2%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTSLVPMNFP  419
             KAW Y+E+G  + VLK   +  +P  + DQ+L++V AAALNPIDFK  L   S      P
Sbjct  2     KAWVYKEYGNSQSVLKFETNVEVPSLREDQVLIKVVAAALNPIDFKRMLGAFSATDSPLP  61

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              IPG D+AG+V   GS V KF +GDEVYG+I+   L+   KR G+LAE+T VEE L+A+K
Sbjct  62    TIPGYDVAGVVEKVGSQVKKFKVGDEVYGDINEKALD-HPKRNGSLAEYTAVEENLLALK  120

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL+F  AASLPLA +TA +G   + F  G+S+ ++GGAGGVG++ +QLAKHV+GAS V
Sbjct  121   PKNLSFVEAASLPLATETAYEGLERSAFSAGKSILVLGGAGGVGTMVIQLAKHVFGASKV  180

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K++ ++ LGAD  +DYT    E +PE +D+V+D +G    +    KE   ++ 
Sbjct  181   AATSSTAKLDLLRSLGADLAIDYTKENIEDLPEKFDVVFDAVGQCDKALKAVKEGGRVVS  240

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I    + P A    LT  G ILEKL P+ ESGKVKA+IDP GPF F   +EAF ++E+ R
Sbjct  241   IIGSVTPP-ASSFVLTSDGSILEKLNPYFESGKVKAIIDPKGPFPFSQTLEAFSHLESSR  299

Query  1140  ARGKVVISPFP  1172
             A GKVVI P P
Sbjct  300   ATGKVVIHPIP  310



>gb|KEH20011.1| zinc-binding dehydrogenase family oxidoreductase [Medicago truncatula]
Length=384

 Score =   265 bits (676),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 205/310 (66%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLK   +  +P  + DQ+LV+V AAALNP+D K RQ      +   P 
Sbjct  77    KAWVYGEYGGVDVLKFDSNVAVPDVKEDQVLVKVVAAALNPVDGKRRQGKFKATDSPLPT  136

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F +GDEVYG+++   LEG   + G+LAE+T VEE L+A+KP
Sbjct  137   VPGYDVAGVVVKVGSEVKDFKVGDEVYGDVNEKALEGP-NQFGSLAEYTAVEEKLLALKP  195

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
              NL F  AASLPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAK V+GAS VA
Sbjct  196   TNLDFAQAASLPLAIETAYEGLERTGFSSGKSILVLNGSGGVGSLVIQLAKQVFGASRVA  255

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S   +E +K LGAD  +DYT   +E +PE +D+VYD IG    +    KE  +++ +
Sbjct  256   ATSSTRHLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVKAIKEGGSVVAL  315

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G +L+KL P+LESGKVK +IDP GPF F  V EAF YIET +A
Sbjct  316   TGAVTPP-GFRFVVTSNGAVLKKLNPYLESGKVKPIIDPKGPFPFDQVAEAFSYIETNKA  374

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  375   TGKVVVFPIP  384



>gb|KCW56039.1| hypothetical protein EUGRSUZ_I01801 [Eucalyptus grandis]
Length=322

 Score =   262 bits (669),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 209/313 (67%), Gaps = 12/313 (4%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK-----LRQTSLVPM  410
             KAW Y E G P +VLKL  D  +P  + DQ+LV+  AAALNP+DFK      + T  +P 
Sbjct  14    KAWVYAERGNPVDVLKLVPDVGVPEIKEDQVLVKAVAAALNPVDFKRALGFFKHTDSLP-  72

Query  411   NFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLV  590
               P++PG D+AG+VV  G    KF +GDEVYG+I    ++   K+ GTLAE+T VEE L+
Sbjct  73    --PIVPGYDVAGVVVKVGDQAKKFKVGDEVYGDIIEKAVD-HPKQHGTLAEYTAVEERLL  129

Query  591   AMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGA  770
             A+KPKNL+F  AASLPLAI+TA +G   AGF  G+S+ ++GGAGGVGSL +QLAK V+GA
Sbjct  130   ALKPKNLSFVEAASLPLAIETAYEGLERAGFSPGKSILVLGGAGGVGSLVIQLAKEVFGA  189

Query  771   SSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENAT  950
             S VAAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD +G S  +    KE  +
Sbjct  190   SRVAATSSTGKLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAVGQSERAVRAVKEGGS  249

Query  951   IIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
             ++ I    + P AV   LT +G +LEKL PFLES K+K VIDP G F F    EAF Y++
Sbjct  250   VVTIAG-AATPPAVLFILTSNGSVLEKLNPFLESQKIKPVIDPKGTFPFSQAPEAFSYLQ  308

Query  1131  TGRARGKVVISPF  1169
             TGR  GKVVI P 
Sbjct  309   TGRVTGKVVIHPI  321



>ref|XP_010682556.1| PREDICTED: 2-methylene-furan-3-one reductase [Beta vulgaris subsp. 
vulgaris]
Length=386

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 217/324 (67%), Gaps = 11/324 (3%)
 Frame = +3

Query  219   STEPNGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLR-  389
             S E   +    KAW YEE+G  +VLK+ D  + VPQ   DQ+L++V AAA+NP+D K R 
Sbjct  68    SVESATIPTEMKAWVYEEYGGVDVLKV-DSNVKVPQVKDDQVLIKVVAAAINPVDAKRRL  126

Query  390   ---QTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLA  560
                + S  P+  P +PG D+AG+VV  GS V +  +GDEVYG+I+   LEG  K+ G+LA
Sbjct  127   GKFKASDSPL--PTVPGYDVAGVVVKVGSQVKELKVGDEVYGDINEKALEGP-KQFGSLA  183

Query  561   EFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgsla  740
             E+T VEE L+A+KPKNL F  AA LPL I+TA +G   AGF  G+S+ ++GGAGGVGSL 
Sbjct  184   EYTAVEEKLLALKPKNLDFVQAAGLPLVIETAYEGLERAGFSAGKSILVLGGAGGVGSLV  243

Query  741   vqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN  920
             +QLAK V+GAS VAAT S  K++F+K LG D  +DYT   +E +PE +D+VYD +G+   
Sbjct  244   IQLAKEVFGASKVAATASTGKLDFLKSLGVDLAIDYTKEKFEDLPEKFDVVYDAVGEGER  303

Query  921   SFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFC  1100
             +    KE  +++ +T   + P      +T +GE+L+KL P+L+SGKVK ++DP GPF F 
Sbjct  304   NVKAVKEGGSVVVLTGAVT-PPGFRFVVTSNGEVLKKLNPYLDSGKVKPIVDPKGPFPFD  362

Query  1101  NVVEAFGYIETGRARGKVVISPFP  1172
              V EAF Y+ET RA GKVVI P P
Sbjct  363   KVDEAFSYLETNRATGKVVIHPIP  386



>ref|XP_007031456.1| Oxidoreductase, zinc-binding dehydrogenase family protein isoform 
1 [Theobroma cacao]
 gb|EOY02382.1| Oxidoreductase, zinc-binding dehydrogenase family protein isoform 
1 [Theobroma cacao]
Length=320

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 209/315 (66%), Gaps = 10/315 (3%)
 Frame = +3

Query  237   LQDMQKAWYYEEHG-PKEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPM  410
             L    KAW Y E+G   +VLKLG D  +P    DQ+LV+V AA +NP+DFK R   L+  
Sbjct  7     LPSQMKAWTYAEYGKSSDVLKLGSDVAVPQLNDDQVLVKVVAAGINPVDFK-RMLGLIKA  65

Query  411   N---FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEE  581
                  P++PG D+AG+VV  GS V KF  GDEVYG+I+   L+   K+ GT+AE+T VEE
Sbjct  66    ADSPLPIVPGYDVAGVVVKVGSQVKKFKEGDEVYGDINEKALD-HPKQFGTIAEYTAVEE  124

Query  582   TLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHV  761
              L+A KPKNL+F  AA LPLAI+TA +G   + F  G+S+ ++GGAGGVG++ +QLAK V
Sbjct  125   RLLAFKPKNLSFIEAAGLPLAIETAHEGLERSQFSAGKSILVLGGAGGVGTMIIQLAKQV  184

Query  762   YGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKE  941
             YGAS VAAT+S  K++ +K LGAD  +DYT   YE +PE +D+VYD +G+   +    KE
Sbjct  185   YGASKVAATSSTGKLDLLKSLGADLPIDYTKENYEDLPEKFDVVYDAVGECERAVKAVKE  244

Query  942   NATI--IDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEA  1115
                +  ID+T  P  P AV   LT +G +LEKL PFLESGKVK +IDP G F F    EA
Sbjct  245   GGHVVAIDVT-SPVVPPAVFFVLTSNGAVLEKLNPFLESGKVKPMIDPKGVFPFSQTREA  303

Query  1116  FGYIETGRARGKVVI  1160
             F Y+ETGR  GKVVI
Sbjct  304   FAYLETGRVTGKVVI  318



>ref|XP_007140915.1| hypothetical protein PHAVU_008G151800g [Phaseolus vulgaris]
 gb|ESW12909.1| hypothetical protein PHAVU_008G151800g [Phaseolus vulgaris]
Length=319

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 157/319 (49%), Positives = 209/319 (66%), Gaps = 12/319 (4%)
 Frame = +3

Query  237   LQDMQKAWYYEEHG-PKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQ----T  395
             L    KAW Y E+G   EVLK  +  +P+PQ   DQ+L++V AA++NPID+K  +     
Sbjct  6     LPSHMKAWTYSEYGKSSEVLKF-NHSVPLPQVKEDQVLIKVAAASINPIDYKRMEGYFKN  64

Query  396   SLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVV  575
             S  P+  P  PG D+AG+VV  GS V KF +GDEVYG+I+   LE   K  G+LAE+T  
Sbjct  65    SDSPL--PTTPGFDVAGVVVKLGSKVKKFKVGDEVYGDINLKALEYP-KVSGSLAEYTTA  121

Query  576   EETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaK  755
             EE L+A KP+NL+F  AASLPL ++TA +G    GF  G+S+ ++GGAGGVG+  +QLAK
Sbjct  122   EEILLAHKPQNLSFAEAASLPLTLETAYEGLERTGFSAGKSILVLGGAGGVGTHVIQLAK  181

Query  756   HVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVA  935
             HVYGAS V AT S  K+E ++ LGAD  +DYT   +E +PE +D+VYDT+G +  +F   
Sbjct  182   HVYGASKVGATGSTRKLELLRNLGADLPIDYTKENFEDLPEKFDVVYDTVGQTEQAFKAL  241

Query  936   KENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEA  1115
             KE   ++ I  PP  P A+   L+  G ILEKL P+ ESGK+K V+DP  PF F   VEA
Sbjct  242   KEGGKVVTIV-PPGFPPAILFILSTDGAILEKLNPYFESGKLKPVLDPKSPFPFSQAVEA  300

Query  1116  FGYIETGRARGKVVISPFP  1172
             F ++ET RA GKVV+ P P
Sbjct  301   FSHLETNRATGKVVVYPIP  319



>ref|XP_003631255.1| PREDICTED: 2-methylene-furan-3-one reductase [Vitis vinifera]
Length=377

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/311 (50%), Positives = 209/311 (67%), Gaps = 7/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVP--QHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             KAW Y ++G  +VLK  D  + VP  + DQ+L++V AAALNP+D K RQ      +   P
Sbjct  70    KAWVYGDYGGVDVLKF-DTAVSVPPVKEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLP  128

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV  GS V +   GDEVYG+I+   L+G  K+ G+ AE+T VEE L+A+K
Sbjct  129   TVPGYDVAGVVVKVGSQVKELKEGDEVYGDINEKALDGP-KQFGSFAEYTAVEEKLLALK  187

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL F  AA LPLAI+TA +G    GF  G+S+ ++GGAGGVGSL +QLAK V+GAS V
Sbjct  188   PKNLDFVQAAGLPLAIETAYEGLERTGFSAGKSILVLGGAGGVGSLVIQLAKQVFGASRV  247

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K+E +K LGAD  +DYT   +E + E +D+VYD +G    +  V KE  +++ 
Sbjct  248   AATSSTAKLELLKSLGADLTIDYTKENFEDLAEKFDVVYDAVGQCDKAVKVVKEGGSVVA  307

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             +T   + P      +T +GE+L+KL P+LESGKVK V+DP GPF F  VVEAF Y+ET R
Sbjct  308   LTGAVTPP-GFRFVVTSNGEVLKKLNPYLESGKVKPVVDPKGPFPFSQVVEAFSYVETSR  366

Query  1140  ARGKVVISPFP  1172
             A GK+VI P P
Sbjct  367   ATGKIVIHPIP  377



>ref|XP_007044642.1| Quinone oxidoreductase-like protein isoform 1 [Theobroma cacao]
 gb|EOY00474.1| Quinone oxidoreductase-like protein isoform 1 [Theobroma cacao]
Length=384

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 203/304 (67%), Gaps = 5/304 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLK  + + +P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  81    KAWVYGEYGGVDVLKFDEKVAVPRVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLPT  140

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V +   GDEVYGNI+   LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  141   VPGYDVAGVVVKVGSQVKELKEGDEVYGNINEKALEGP-KQFGSLAEYTAVEEKLLALKP  199

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AA LPLA +TA +G    GF  G+S+ ++ GAGGVGSL +QLAK V+GAS VA
Sbjct  200   KNLDFAQAAGLPLAFETAYEGLERTGFSAGKSILVLNGAGGVGSLVIQLAKQVFGASKVA  259

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD IG    +    KE  +++ +
Sbjct  260   ATSSTGKLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVKAVKEGGSVVAL  319

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +GE+L+KL P+LESGKVK V+DP GPF F  V EAF YIET RA
Sbjct  320   TGAVTPP-GFRFVVTSNGEVLKKLNPYLESGKVKPVVDPKGPFPFAEVAEAFSYIETNRA  378

Query  1143  RGKV  1154
              GK+
Sbjct  379   VGKI  382



>ref|NP_001240976.1| uncharacterized protein LOC100788619 [Glycine max]
 gb|ACU23916.1| unknown [Glycine max]
Length=322

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/313 (49%), Positives = 206/313 (66%), Gaps = 9/313 (3%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKLGDFLIPVPQH---DQLLVQVQAAALNPIDFKLRQTSLVPMN--  413
             KAWYY EHG P +VLKL D   P+PQ    DQ+L++V AA++NP+D+K         +  
Sbjct  13    KAWYYSEHGSPGDVLKL-DPNWPLPQQLKDDQVLIKVIAASINPVDYKRMHGEFKDTDPH  71

Query  414   FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVA  593
              P++PG D+AGIVV  G  V KF +GDEVYG+I+   L   LK  GTL+E+T+ EE L+A
Sbjct  72    LPIVPGYDVAGIVVKVGGEVKKFKVGDEVYGDINEQGL-SNLKIHGTLSEYTIAEERLLA  130

Query  594   MKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGAS  773
              KP NL+F  AAS+PLA++TA +GF  A F  G+S+ ++GGAGGVG+  +QLAK VY AS
Sbjct  131   HKPSNLSFIEAASIPLALETANEGFEHAHFSAGKSILVLGGAGGVGNYVIQLAKQVYKAS  190

Query  774   SVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATI  953
              +AAT S  K+E ++ LG D  +DYT   +E +PE YDLVYD +G    +F   KE+  +
Sbjct  191   KIAATASTGKLELLRELGVDLPIDYTKENFEDLPEKYDLVYDVVGQGDRAFKAVKEDGKV  250

Query  954   IDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIET  1133
             + I  PP +P A+   LT  G ILE L+P+ ESGK+K ++D   P  F  V+EA  Y+ET
Sbjct  251   VTIV-PPGHPPAMFFVLTSKGSILENLRPYFESGKLKPILDAKTPVPFSQVIEAISYLET  309

Query  1134  GRARGKVVISPFP  1172
              RA GKVV+ P P
Sbjct  310   SRATGKVVVYPIP  322



>gb|KCW59869.1| hypothetical protein EUGRSUZ_H02605 [Eucalyptus grandis]
Length=398

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 210/320 (66%), Gaps = 12/320 (4%)
 Frame = +3

Query  234   GLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVP  407
             G+    KAW Y E+G  +VLK  D  + VP+   DQ+L++V AAALNP+D K RQ     
Sbjct  84    GVPGEMKAWVYGEYGGVDVLKF-DPKVSVPEVKEDQVLIKVAAAALNPVDAKRRQGKFKA  142

Query  408   MN--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEE  581
              +   P +PG D+AG+VV  GS V +   GDEVYG+I+   LEG  K+ G+LAE+T VEE
Sbjct  143   TDSPLPTVPGYDIAGVVVKVGSQVKELKEGDEVYGDINEKALEGP-KQFGSLAEYTAVEE  201

Query  582   TLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgsla-vqlaKH  758
              L+A+KPKN+ F  AA LPLAI TA +G    GF  G+S+ ++GG+GGVGSL   QLAKH
Sbjct  202   KLLALKPKNINFVQAAGLPLAISTAYEGLERTGFSAGKSILVLGGSGGVGSLVIQQLAKH  261

Query  759   VYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAK  938
             V+GAS VAAT+S  K+EF+K LGAD  +DYT   +E +PE +D+VYD +G    +    K
Sbjct  262   VFGASRVAATSSTGKLEFLKSLGADLAIDYTKENFEDLPEKFDVVYDAVGQCDRAVKAIK  321

Query  939   ENATIIDITWP--PSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
             E   ++ +T    P   R V   +T  GE+L+KL P++ESGKVK ++DP GPF F  V E
Sbjct  322   EGGIVVALTGAVVPPGFRFV---VTSKGEVLKKLNPYIESGKVKPIVDPKGPFPFSQVAE  378

Query  1113  AFGYIETGRARGKVVISPFP  1172
             AF YIET RA GKVVI P P
Sbjct  379   AFSYIETNRASGKVVIHPIP  398



>ref|XP_008230947.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Prunus mume]
Length=323

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/323 (50%), Positives = 217/323 (67%), Gaps = 23/323 (7%)
 Frame = +3

Query  246   MQKAWYYEEHG-PKEVLKLGDFLIPVP--QHDQLLVQVQAAALNPID-------FKLRQT  395
             + KAW Y E+G P +VLKL D   P+P  + DQ+L++V AAALNP+D       FK   T
Sbjct  10    VNKAWVYAEYGKPADVLKL-DPNAPLPRVEEDQVLIKVAAAALNPVDHKRLLGYFKDTDT  68

Query  396   SLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEG--ELKRMGTLAEFT  569
             +L     P +PG D+AG+VV  GS   KF +GDEVYG I   N +G   LK++G+LAE+T
Sbjct  69    AL-----PAVPGYDVAGVVVKLGSQARKFKVGDEVYGTI---NEQGIINLKKVGSLAEYT  120

Query  570   VVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql  749
              VEE L+A+KPKNL+F  AASLP+AI+TA +G + A     +S+ ++GGAGGVG+  +QL
Sbjct  121   AVEERLLAVKPKNLSFAEAASLPVAIETAYEGLQRAQISASKSILVLGGAGGVGTHVIQL  180

Query  750   aKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV  929
             AKHV+GAS VAAT S  K+++++ LGAD  +DYT   +E +PE +D+VYD +G S  +  
Sbjct  181   AKHVFGASRVAATASTKKLDWLRGLGADLAIDYTKDNFEDLPEKFDVVYDAVGQSDRAVK  240

Query  930   VAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVV  1109
               K+   ++ +  P + P A    LT SG ILEKL P+LESGKVKAVIDP GP+ F   +
Sbjct  241   AVKKGGKVVTVAGPITPP-AFMFMLTSSGSILEKLNPYLESGKVKAVIDPNGPYPFSKTL  299

Query  1110  EAFGYIE-TGRARGKVVISPFPS  1175
             EAF Y+E + RA GKVV+ P PS
Sbjct  300   EAFAYLEASSRAIGKVVVYPIPS  322



>ref|XP_010477676.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic 
[Camelina sativa]
Length=309

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 153/309 (50%), Positives = 201/309 (65%), Gaps = 5/309 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  + ++P    DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  2     KAWVYGEYGGVDVLKLESNIVVPEINEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F  GDEVYG++    LEG  K+ G+LAE+T VEE L+ +KP
Sbjct  62    VPGYDVAGVVVKVGSAVKNFKEGDEVYGDVSEKALEGP-KQFGSLAEYTAVEEKLLGLKP  120

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL +QLAKHVYGAS VA
Sbjct  121   KNIDFAQAAGLPLAIETADEGLVRTEFSAGKSILVLNGAGGVGSLVIQLAKHVYGASKVA  180

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E VK LGAD  +DYT    E +P+ YD+V+D IG    +  V KE   ++ +
Sbjct  181   ATASTGKLELVKSLGADLAIDYTKENIEDLPDKYDVVFDAIGMCDKAVKVIKEGGKVVAL  240

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T  GE+L+KL P++ESGKVK V+DP GPF F  V +AF Y+ET  A
Sbjct  241   TGAVT-PPGFRFVVTSDGEVLKKLNPYIESGKVKPVVDPKGPFPFSRVADAFSYLETNHA  299

Query  1143  RGKVVISPF  1169
              GKVV+ P 
Sbjct  300   TGKVVVYPI  308



>gb|AAC98029.1| Strong similarity to gb|U20808 auxin-induced protein from Vigna 
radiata and a member of the zinc-binding dehydrogenase family 
PF|00107. ESTs gb|T43674, gb|H77006 and gb|AA395179 come 
from this gene [Arabidopsis thaliana]
Length=309

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 203/310 (65%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y ++G  +VLKL  + ++P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  2     KAWVYSDYGGVDVLKLESNIVVPEIKEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V     GDEVY N+    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  62    VPGYDVAGVVVKVGSAVKDLKEGDEVYANVSEKALEGP-KQFGSLAEYTAVEEKLLALKP  120

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL +QLAKHVYGAS VA
Sbjct  121   KNIDFAQAAGLPLAIETADEGLVRTEFSAGKSILVLNGAGGVGSLVIQLAKHVYGASKVA  180

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E V+ LGAD  +DYT    E +P+ YD+V+D IG    +  V KE   ++ +
Sbjct  181   ATASTEKLELVRSLGADLAIDYTKENIEDLPDKYDVVFDAIGMCDKAVKVIKEGGKVVAL  240

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G++L+KL P++ESGKVK V+DP GPF F  V +AF Y+ET  A
Sbjct  241   TGAVT-PPGFRFVVTSNGDVLKKLNPYIESGKVKPVVDPKGPFPFSRVADAFSYLETNHA  299

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  300   TGKVVVYPIP  309



>ref|XP_010029191.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Eucalyptus 
grandis]
 gb|KCW56041.1| hypothetical protein EUGRSUZ_I01801 [Eucalyptus grandis]
 gb|KCW56042.1| hypothetical protein EUGRSUZ_I01801 [Eucalyptus grandis]
Length=322

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 159/310 (51%), Positives = 209/310 (67%), Gaps = 6/310 (2%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFP--  419
             KAW Y E G P +VLKL  D  +P  + DQ+LV+V AA+LNP+DFK        ++ P  
Sbjct  14    KAWVYAERGNPADVLKLVPDVGVPEIKEDQVLVKVVAASLNPVDFKRALGFFKDIDSPPP  73

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
             ++PG D+AG+VV  G  V KF +GDEVYG+I+   L+   K+ GTLAE+T VEE L+A+K
Sbjct  74    IVPGYDVAGVVVKVGDQVKKFKVGDEVYGDINEKALD-HPKQHGTLAEYTAVEERLLALK  132

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL+F  AASLPLAI+TA +G   A F  G+S+ ++GGAGGVG+L +QLAK V+GAS V
Sbjct  133   PKNLSFIEAASLPLAIETAYEGLERARFSPGKSILVLGGAGGVGTLVIQLAKEVFGASRV  192

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD +G S  +    KE  +++ 
Sbjct  193   AATSSTGKLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAVGQSERAVRAVKEGGSVVT  252

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I    + P AV   LT +G +LEKL PFLES K+K VIDP G F F    EAF Y++TGR
Sbjct  253   IAG-AATPPAVLFILTSNGSVLEKLNPFLESQKIKPVIDPKGTFPFSQAPEAFSYLQTGR  311

Query  1140  ARGKVVISPF  1169
               GKVVI P 
Sbjct  312   VTGKVVIHPI  321



>ref|XP_008389642.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Malus domestica]
Length=389

 Score =   263 bits (672),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 211/314 (67%), Gaps = 7/314 (2%)
 Frame = +3

Query  237   LQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPM  410
             L    KAW Y E+G  +VLK  D  + VP+   DQ+LV+V AAALNP+DFK RQ      
Sbjct  77    LPSEMKAWVYGEYGGVDVLKF-DTKVAVPELLEDQVLVKVVAAALNPVDFKRRQGKFKNT  135

Query  411   N--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEET  584
             +   P +PG D+AG+VV  GS V  F  GDEVYG+IH   LEG  K+ G+LAE+T VEE 
Sbjct  136   DSPLPTVPGYDVAGVVVKVGSKVKDFKEGDEVYGDIHEKALEGP-KQSGSLAEYTAVEER  194

Query  585   LVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVY  764
             L+A KPKNL F  AASLPLAI+TA +G    GF  G+S+ ++ GAGGVGSL +QLAKHV+
Sbjct  195   LLAAKPKNLDFAEAASLPLAIETAYEGLEKTGFSAGKSLLVLNGAGGVGSLVIQLAKHVF  254

Query  765   GASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKEN  944
             GAS +AAT+S  K+E +K LGAD  +DYT    E++PE +D+VYD IG    +  V KE 
Sbjct  255   GASRIAATSSTGKLELLKSLGADLAIDYTKENLEELPENFDVVYDAIGQCDKAVKVVKEG  314

Query  945   ATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGY  1124
              +++ +T   + P      +T +G +L+KL P+LE+GKVK VIDP GPF F  +VEAF Y
Sbjct  315   GSVVALTGAVTPP-GFRFVVTSNGAVLKKLNPYLETGKVKPVIDPKGPFPFSKLVEAFSY  373

Query  1125  IETGRARGKVVISP  1166
             +ET RA GKVVI P
Sbjct  374   LETNRATGKVVIHP  387



>ref|XP_008230613.1| PREDICTED: LOW QUALITY PROTEIN: 2-methylene-furan-3-one reductase-like 
[Prunus mume]
Length=322

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 154/321 (48%), Positives = 210/321 (65%), Gaps = 12/321 (4%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGPK-EVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFK-----LR  389
             + +  + KAW Y E+G   +VLK      +P  + DQ+L++V AA+LNPIDFK      +
Sbjct  7     DSIPSVNKAWVYSEYGQSADVLKFDPSVAVPEIKEDQVLIKVVAASLNPIDFKRMLGYFK  66

Query  390   QTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFT  569
             +    P   P +PG D+ G+VV  GS VTKF  GDEVYG++ N N     K+ G+LAE+T
Sbjct  67    EIDSPP---PTVPGYDVPGVVVKVGSQVTKFKXGDEVYGDL-NENALVNPKKFGSLAEYT  122

Query  570   VVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql  749
               EE ++A+KPKNL+F  AASLPLA++TA +G     F  G+S+ ++GGAGGVG+  +QL
Sbjct  123   AAEERVLALKPKNLSFVEAASLPLALETAYEGLERTEFSAGKSILVLGGAGGVGTHVIQL  182

Query  750   aKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV  929
             AKHV+GAS VAAT S  K++ ++ LGAD  +DYT   +E +PE +D+VYD +G S  +  
Sbjct  183   AKHVFGASKVAATASTKKLDLLRSLGADLAIDYTKDNFEDLPEKFDVVYDAVGQSDRAVK  242

Query  930   VAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVV  1109
               KEN  ++ I +    P A+   LT +G ILEKLKP+LESGKVK V+DP  P+ F   V
Sbjct  243   AVKENGKVVTI-FGSVTPPALTFVLTSTGTILEKLKPYLESGKVKPVLDPTSPYPFSKTV  301

Query  1110  EAFGYIETGRARGKVVISPFP  1172
             EAF Y+ET RA GKVV+ P P
Sbjct  302   EAFTYLETSRATGKVVVHPIP  322



>ref|XP_002961594.1| hypothetical protein SELMODRAFT_76590 [Selaginella moellendorffii]
 gb|EFJ36854.1| hypothetical protein SELMODRAFT_76590 [Selaginella moellendorffii]
Length=322

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 212/311 (68%), Gaps = 7/311 (2%)
 Frame = +3

Query  246   MQKAWYYEEHGP-KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLR--QTSLVPMNF  416
             + KAW Y+E+G  K+VLKL +  +P    DQ+LV+V AAALNP+DFK R  +      + 
Sbjct  11    LHKAWVYKEYGAAKDVLKLEELPVPPLAPDQVLVKVHAAALNPVDFKRRLGKFKATDSDL  70

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P +PG D+AG+V   GS V+    GDEVYG+I  F L+ + K+ G++A++T VEE L+A+
Sbjct  71    PTVPGYDVAGVVAKVGSEVSSLKQGDEVYGDISEFALD-KPKQWGSIAQYTAVEEKLLAI  129

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KP+NL+F  AASLPLAIQTA +GF  A  + GQSV ++GGAGGVGSLA+QLAK VYGAS 
Sbjct  130   KPRNLSFIQAASLPLAIQTAQEGFDKAKLRAGQSVLVLGGAGGVGSLAIQLAKFVYGASL  189

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENAT  950
             VAATTS PK+  VK LGAD V+DY    +E +PE YD+V+D +G         V KE  T
Sbjct  190   VAATTSTPKLGLVKSLGADIVIDYKEKNFEDMPERYDVVFDAVGMFWEPKGTNVVKEGGT  249

Query  951   IIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
              + +T  P NP      +T +G  L +LK FLESG VK VIDP GPF F +VV+AF Y+E
Sbjct  250   AVVLTG-PVNPPGFRFVVTSNGSNLVRLKDFLESGTVKPVIDPKGPFDFGSVVDAFCYLE  308

Query  1131  TGRARGKVVIS  1163
              GRA GKVVIS
Sbjct  309   GGRACGKVVIS  319



>ref|XP_010029192.1| PREDICTED: 2-methylene-furan-3-one reductase-like isoform X1 
[Eucalyptus grandis]
 gb|KCW56047.1| hypothetical protein EUGRSUZ_I01801 [Eucalyptus grandis]
Length=322

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 212/314 (68%), Gaps = 12/314 (4%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK-----LRQTSLVPM  410
             KAW Y E G P +VLKL  D  +P  + DQ+LV+  AAALNP+DFK      + T  +P 
Sbjct  14    KAWVYAERGNPVDVLKLVPDVGVPEIKEDQVLVKAVAAALNPVDFKRALGFFKHTDSLP-  72

Query  411   NFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLV  590
               P++PG D+AG+VV  G    KF +GDEVYG+I    ++   K+ GTLAE+T VEE L+
Sbjct  73    --PIVPGYDVAGVVVKVGDQAKKFKVGDEVYGDIIEKAVD-HPKQHGTLAEYTAVEERLL  129

Query  591   AMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGA  770
             A+KPKNL+F  AASLPLAI+TA +G   AGF  G+S+ ++GGAGGVGSL +QLAK V+GA
Sbjct  130   ALKPKNLSFVEAASLPLAIETAYEGLERAGFSPGKSILVLGGAGGVGSLVIQLAKEVFGA  189

Query  771   SSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENAT  950
             S VAAT+S  K++ +K LGAD  +DYT   +E +PE +D+VYD +G S  +    KE  +
Sbjct  190   SRVAATSSTGKLDLLKSLGADLAIDYTKENFEDLPEKFDVVYDAVGQSERAVRAVKEGGS  249

Query  951   IIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
             ++ I+   + P AV   LT +G +LEKL PFLE+ K+K VIDP G F F   +EAF +++
Sbjct  250   VVTISG-KATPPAVLFFLTSNGSVLEKLNPFLENQKIKPVIDPKGTFPFSQALEAFLFLQ  308

Query  1131  TGRARGKVVISPFP  1172
             TGR  GK+VI P P
Sbjct  309   TGRVTGKIVIHPIP  322



>gb|AAM62737.1| Quinone oxidoreductase-like protein [Arabidopsis thaliana]
Length=309

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 202/310 (65%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y ++G  +VLKL  +  +P  + DQ+L++V AA LNP+D K RQ      +   P 
Sbjct  2     KAWVYSDYGGVDVLKLESNIAVPEIKEDQVLIKVVAAGLNPVDAKRRQGKFKATDSPLPT  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F  GDEVY N+    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  62    VPGYDVAGVVVKVGSAVKDFKEGDEVYANVSEKALEGP-KQFGSLAEYTAVEEKLLALKP  120

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL +QLAKHVYGAS VA
Sbjct  121   KNIDFAQAAGLPLAIETADEGLVRTEFSAGKSILVLNGAGGVGSLMIQLAKHVYGASKVA  180

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E V+ LGAD  +DYT    E +P+ YD+V+D IG    +  V KE   ++ +
Sbjct  181   ATASTGKLELVRSLGADLAIDYTKENIEDLPDKYDVVFDAIGMCDKAVKVIKEGGKVVAL  240

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G++L+KL P++ESGKVK V+DP GPF F  V +AF Y+ET  A
Sbjct  241   TGAVT-PPGFRFVVTSNGDVLKKLNPYIESGKVKPVVDPKGPFPFSRVADAFSYLETNHA  299

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  300   TGKVVVYPIP  309



>ref|XP_009395684.1| PREDICTED: 2-methylene-furan-3-one reductase [Musa acuminata 
subsp. malaccensis]
Length=407

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 210/310 (68%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y+++G  ++L+L + + +P  + DQ+L++V AAALNP+D+K RQ      +   P 
Sbjct  100   KAWVYDDYGAADLLRLDEGVSVPEVKEDQVLIKVVAAALNPVDYKRRQGKFKATDSPLPT  159

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V    +GDEVYG+I+   LE   K+ G+LAE+T VEE L+A+KP
Sbjct  160   VPGYDVAGVVVKVGSQVKNLKVGDEVYGDINEKALENP-KQFGSLAEYTSVEEKLLALKP  218

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G   +GF  G+S+ ++GGAGGVGSL +QLAKHV+GAS VA
Sbjct  219   KNIDFVQAAGLPLAIETANEGLERSGFSAGKSILVLGGAGGVGSLVIQLAKHVFGASRVA  278

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K++ +K LGAD  +DYT   +E++PE +D+VYDT+G    +    KE  +++ +
Sbjct  279   ATASTGKLDLLKSLGADLAIDYTKENFEELPEKFDVVYDTVGQCEKAVKAVKEAGSVVVL  338

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T  G +L KL  F+E GK+K V+DP G F F  +VEAF Y+ETGRA
Sbjct  339   TGAVTPP-GFRFVVTSDGAVLSKLNTFIEDGKIKPVVDPKGAFPFSKLVEAFTYLETGRA  397

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  398   TGKVVIHPIP  407



>emb|CDP00161.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   261 bits (668),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 161/312 (52%), Positives = 207/312 (66%), Gaps = 9/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  EVLK  D + +P  + DQ+L++V AAALNPIDFK R       +   P 
Sbjct  86    KAWVYSEYGGVEVLKFDDNVAVPEIKDDQVLIKVAAAALNPIDFKRRLGKFKATDSPLPT  145

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V     GDEVYG+I+   LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  146   VPGYDVAGVVVKVGSQVKGLKGGDEVYGDINEKALEGP-KQFGSLAEYTAVEEKLLALKP  204

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             K + F  AA+LPLAI+TA +G   AGF  G+SV ++GGAGGVGSL +QLAKHV+GAS VA
Sbjct  205   KGIDFVQAAALPLAIETAYEGLERAGFSAGKSVLVLGGAGGVGSLVIQLAKHVFGASKVA  264

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+E ++ LGAD  +DYT   +E +PE +D+VYD +G    +    KE   ++ +
Sbjct  265   ATSSTGKLELLRSLGADLAIDYTRENFEDLPEKFDVVYDAVGQGEKAAKAVKEGGNVVFL  324

Query  963   TWP--PSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
             T    P   R V   +T +G  L KL  FLESG+VK V+DP GPF F  VVEAF Y+ET 
Sbjct  325   TGAVVPPGFRFV---VTSNGGTLTKLNAFLESGQVKPVVDPKGPFAFSKVVEAFSYLETN  381

Query  1137  RARGKVVISPFP  1172
             RA GKVVI P P
Sbjct  382   RATGKVVIHPIP  393



>gb|EYU22491.1| hypothetical protein MIMGU_mgv1a009679mg [Erythranthe guttata]
Length=334

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 217/312 (70%), Gaps = 9/312 (3%)
 Frame = +3

Query  255   AWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLR----QTSLVPMNFP  419
             AW Y E+G  EVLKL  D  +P P  DQ+L++V AAALNPID+K R    +++  P+  P
Sbjct  26    AWRYSEYGGVEVLKLESDVPLPEPADDQVLIKVFAAALNPIDYKRRLGFFKSTDSPL--P  83

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
             ++PG D+AG+VV  G  V +  +GDEVYG+I     +G  K++GTLAE+TV +E L+A+K
Sbjct  84    IVPGYDVAGVVVKVGGEVKQLKVGDEVYGDIIEKAFDGP-KQIGTLAEYTVADEKLLALK  142

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL F  AAS+P+AI+TA +G   A F +G+S+ ++GGAGGVGS  +QLAKHV+GAS V
Sbjct  143   PKNLDFGQAASIPMAIETAYEGLERARFSDGKSILVLGGAGGVGSFVIQLAKHVFGASKV  202

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K+E ++ LGAD  +DYT   +E +PE +D+VYD +G +  +  V KE+ +++ 
Sbjct  203   AATSSTAKLELLEKLGADLPIDYTKENFEDLPEKFDVVYDAVGQNDRAVKVVKESGSVVS  262

Query  960   -ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
              I  PP +  A H  LT SGE L+KL P+LESGKVK +IDP G F F  V EAF Y+ET 
Sbjct  263   VIPGPPVDRPAFHFVLTSSGEYLKKLNPYLESGKVKPLIDPKGQFPFDKVKEAFSYLETN  322

Query  1137  RARGKVVISPFP  1172
             RA GKVV+ P P
Sbjct  323   RASGKVVVYPIP  334



>pdb|4IDA|A Chain A, Structure Of The Fragaria X Ananassa Enone Oxidoreductase 
In Its Apo Form
 pdb|4IDB|A Chain A, Structure Of The Fragaria X Ananassa Enone Oxidoreductase 
In Complex With Nadp+
 pdb|4IDC|A Chain A, Structure Of The Fragaria X Ananassa Enone Oxidoreductase 
In Complex With Nadph And Hdmf
 pdb|4IDD|A Chain A, Structure Of The Fragaria X Ananassa Enone Oxidoreductase 
In Complex With Nadph And Ehmf
 pdb|4IDE|A Chain A, Structure Of The Fragaria X Ananassa Enone Oxidoreductase 
In Complex With Nadp+ And Edhmf
 pdb|4IDF|A Chain A, Structure Of The Fragaria X Ananassa Enone Oxidoreductase 
In Complex With Nadph And Hmf
Length=332

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 155/318 (49%), Positives = 210/318 (66%), Gaps = 8/318 (3%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGP-KEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK--LRQT  395
               +  + KAW Y E+G   +VLK  D  + VP+   DQ+L++V AA+LNP+DFK  L   
Sbjct  18    ESIPSVNKAWVYSEYGKTSDVLKF-DPSVAVPEIKEDQVLIKVVAASLNPVDFKRALGYF  76

Query  396   SLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVV  575
                    P IPG D+AG+VV  GS VTKF +GDEVYG+++   L     R G+LAE+T  
Sbjct  77    KDTDSPLPTIPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNETALVNPT-RFGSLAEYTAA  135

Query  576   EETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaK  755
             +E ++A KPKNL+F  AASLPLAI+TA +G   A    G+SV ++GGAGGVG+  +QLAK
Sbjct  136   DERVLAHKPKNLSFIEAASLPLAIETAHEGLERAELSAGKSVLVLGGAGGVGTHIIQLAK  195

Query  756   HVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVA  935
             HV+GAS VAAT S  K++ ++ LGAD  +DYT   +E +PE +D+VYD +G++  +    
Sbjct  196   HVFGASKVAATASTKKLDLLRTLGADLAIDYTKENFEDLPEKFDVVYDAVGETDKAVKAV  255

Query  936   KENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEA  1115
             KE   ++ I   P+ P A+   LT  G +LEKLKP+LESGKVK V+DP  P+ F  VVEA
Sbjct  256   KEGGKVVTIVG-PATPPAILFVLTSKGSVLEKLKPYLESGKVKPVLDPTSPYPFTKVVEA  314

Query  1116  FGYIETGRARGKVVISPF  1169
             FGY+E+ RA GKVV+ P 
Sbjct  315   FGYLESSRATGKVVVYPI  332



>ref|XP_007153730.1| hypothetical protein PHAVU_003G060300g [Phaseolus vulgaris]
 gb|ESW25724.1| hypothetical protein PHAVU_003G060300g [Phaseolus vulgaris]
Length=391

 Score =   261 bits (667),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 204/310 (66%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +P  + DQ+LV+V AAALNP+D K RQ      +   P 
Sbjct  84    KAWVYGEYGGVDVLKLDSNVAVPDVKEDQVLVKVAAAALNPVDGKRRQGKFKATDSPLPT  143

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F +GDEVYG++    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  144   VPGYDVAGVVVKVGSEVKDFKVGDEVYGDLSEKALEGP-KQFGSLAEYTAVEEKLLALKP  202

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AA+LPLAI+TA +G     F  G+S+ ++ G+GGVGSL +QLAK V+GAS VA
Sbjct  203   KNLDFAQAAALPLAIETAHEGLERTAFSPGKSILVLNGSGGVGSLVIQLAKQVFGASRVA  262

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S   ++ +K LGAD  +DYT   +E + E +D+V+D IG    +    KE  +++ +
Sbjct  263   ATSSTRNLDLLKSLGADLAIDYTKENFEDLSEKFDVVFDAIGQCDRAVKAVKEGGSVVAL  322

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G +L KL P+LESGKVK ++DP GPF F  + EAF Y+ET RA
Sbjct  323   TGAVTPP-GFRFVVTSNGAVLRKLNPYLESGKVKPIVDPKGPFPFDQLAEAFSYLETNRA  381

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  382   TGKVVIHPIP  391



>emb|CDY47631.1| BnaC05g18870D [Brassica napus]
Length=385

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 203/310 (65%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +PV   DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  78    KAWVYSEYGGVDVLKLESNIAVPVVNDDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  137

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F  GDEVY N+    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  138   VPGYDVAGVVVKVGSAVKDFKEGDEVYANVSEKALEGP-KQSGSLAEYTAVEEKLLALKP  196

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+SV ++ GAGGVGSLA+QLAKHVYGAS VA
Sbjct  197   KNIDFAQAAGLPLAIETADEGLVRTEFSAGKSVLVLNGAGGVGSLAIQLAKHVYGASKVA  256

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E V+ LGAD  +DYT    E + E +D+V+D IG    +  V KE   ++ +
Sbjct  257   ATASTGKLELVRSLGADLAIDYTKENIEDLTERFDVVFDAIGMCDKAVKVIKEGGKVVAL  316

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G++L+KL P++ESGKVK V+DP GPF F  V +AF Y+ET  A
Sbjct  317   TGAVTPP-GFRFVVTSNGDVLKKLNPYIESGKVKPVVDPKGPFPFSRVADAFSYLETNHA  375

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  376   TGKVVVYPIP  385



>ref|XP_010460148.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic 
[Camelina sativa]
Length=389

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 153/309 (50%), Positives = 201/309 (65%), Gaps = 5/309 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +P    DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  82    KAWVYSEYGGVDVLKLESNIAVPEINEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  141

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F  GDEVYG++    LEG  K+ G+LAE+T VEE L+ +KP
Sbjct  142   VPGYDVAGVVVKVGSAVKDFKEGDEVYGDVSEKALEGP-KQFGSLAEYTAVEEKLLGLKP  200

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL +QLAKHVYGAS VA
Sbjct  201   KNIDFAQAAGLPLAIETADEGLVRTEFSSGKSILVLNGAGGVGSLVIQLAKHVYGASKVA  260

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E VK LGAD  +DYT    E +P+ YD+V+D IG    +  V KE   ++ +
Sbjct  261   ATASTGKLELVKSLGADLAIDYTKENIEDLPDKYDIVFDAIGMCDKAVKVIKEGGKVVAL  320

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +GE+L+KL P++ESGKVK V+DP GPF F  V +AF Y+ET  A
Sbjct  321   TGAVTPP-GFRFVVTSNGEVLKKLNPYIESGKVKPVVDPKGPFPFSRVADAFSYLETNHA  379

Query  1143  RGKVVISPF  1169
              GKVV+ P 
Sbjct  380   TGKVVVYPI  388



>gb|KHG13834.1| hypothetical protein F383_18331 [Gossypium arboreum]
Length=321

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 208/316 (66%), Gaps = 6/316 (2%)
 Frame = +3

Query  237   LQDMQKAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTSLV  404
             L    KAW Y E+G   +VLKL  D ++P P+ DQ+L+QV AA +NPIDFK  L     +
Sbjct  8     LPSKMKAWTYPEYGKSSDVLKLQSDVVVPQPRDDQVLLQVVAAGINPIDFKRMLGMFKNI  67

Query  405   PMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEET  584
                 P+IPG D+AG+VV  GS V KF  GD+VYG+I+   ++    + GT+AEFTVV E 
Sbjct  68    DSPLPIIPGYDVAGVVVKVGSQVKKFKEGDQVYGDINEKAVD-HPTQFGTIAEFTVVAEK  126

Query  585   LVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVY  764
             L+A+KPKNL+F  AASLPL I+TA +G     F  G+S+ ++GGAGGVG++ +QLAK VY
Sbjct  127   LLALKPKNLSFVEAASLPLVIETAYEGLERCHFSAGKSILVLGGAGGVGTMIIQLAKQVY  186

Query  765   GASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKEN  944
             GAS +AAT S  K++ +K LGAD  +DYTN  +E +PE +D+VYD +G    +    KE 
Sbjct  187   GASKIAATASTAKLDLLKSLGADLPIDYTNQNFEDLPEKFDVVYDAVGQCERAVKAVKEG  246

Query  945   ATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGY  1124
               ++ I +    P A    LT +G ILEKL+PFLESGKVK +IDP G F F    +AF Y
Sbjct  247   GDVVTI-YGAVVPPATTFMLTSNGAILEKLEPFLESGKVKPMIDPNGIFPFSETPQAFAY  305

Query  1125  IETGRARGKVVISPFP  1172
             +ETGR  GKVVIS  P
Sbjct  306   LETGRVTGKVVISIIP  321



>ref|XP_004135246.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Cucumis sativus]
 gb|KGN51807.1| hypothetical protein Csa_5G601570 [Cucumis sativus]
Length=383

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 210/324 (65%), Gaps = 7/324 (2%)
 Frame = +3

Query  213   IFSTEPNGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK-  383
             + ++E   +    KAW Y E+G  +VLK  D  + VP+   DQ+L++V AAALNP+D K 
Sbjct  63    VVTSEVASVPSEMKAWVYGEYGGVDVLKF-DSSVSVPEVKEDQVLIKVVAAALNPVDGKR  121

Query  384   -LRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLA  560
              L +        P +PG D+AG+VV  GS V +   GDEVYGNI+   L+G  K+ G+LA
Sbjct  122   MLGKFKATDSPLPTVPGYDVAGVVVKVGSQVKELKEGDEVYGNINEKALDGP-KQFGSLA  180

Query  561   EFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgsla  740
             E+T VEE L+A+KPKN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL 
Sbjct  181   EYTAVEEKLLAVKPKNIDFVQAAGLPLAIETAYEGLEKTNFSTGKSILVLNGAGGVGSLV  240

Query  741   vqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN  920
             +QLAK+V+GAS VAAT S  K+EF+K LG D  +DYT    E +PE +D+VYD IG    
Sbjct  241   IQLAKNVFGASKVAATASTGKLEFLKSLGVDLAIDYTKENIEDLPEKFDVVYDAIGQCDK  300

Query  921   SFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFC  1100
             +  V KE  +++ +T   + P      +T  G +L+KL P+LESGKVK ++DP GPF F 
Sbjct  301   AVKVVKEGGSVVALTGAVT-PPGFRFVVTSDGAVLKKLNPYLESGKVKPIVDPKGPFSFS  359

Query  1101  NVVEAFGYIETGRARGKVVISPFP  1172
              VVEAF Y+E+ RA GKVVI P P
Sbjct  360   QVVEAFAYVESSRATGKVVIHPIP  383



>ref|XP_009363557.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Pyrus x bretschneideri]
Length=389

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 210/314 (67%), Gaps = 7/314 (2%)
 Frame = +3

Query  237   LQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPM  410
             L    KAW Y E+G  +VLK  D  + VP+   DQ+LV+V AAALNP+DFK RQ      
Sbjct  77    LPSEMKAWVYGEYGGVDVLKF-DTKVAVPELLEDQVLVKVVAAALNPVDFKRRQGKFKNT  135

Query  411   N--FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEET  584
             +   P +PG D+AG+VV  GS V     GDEVYG+IH   LEG  K+ G+LAE+T VEE 
Sbjct  136   DSPLPTVPGYDVAGVVVKVGSKVKDSKEGDEVYGDIHEKALEGP-KQSGSLAEYTAVEER  194

Query  585   LVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVY  764
             L+A KPKNL F  AASLPLAI+TA +G    GF  G+S+ ++ GAGGVGSL +QLAKHV+
Sbjct  195   LLAPKPKNLDFAQAASLPLAIETAYEGLEKTGFSAGKSLLVLNGAGGVGSLVIQLAKHVF  254

Query  765   GASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKEN  944
             GAS +AAT+S  K+E +K LGAD  +DYT    E++PE +D+VYD IG    +  V KE 
Sbjct  255   GASRIAATSSTGKLELLKSLGADSAIDYTKENLEELPEKFDVVYDAIGQCDKAVKVVKEG  314

Query  945   ATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGY  1124
              +++ +T   + P      +T +G +L+KL P+LESGKVK VIDP GPF F  +VEAF Y
Sbjct  315   GSVVALTGAVTPP-GFRFVVTSNGAVLKKLNPYLESGKVKPVIDPKGPFPFSKLVEAFSY  373

Query  1125  IETGRARGKVVISP  1166
             +ET RA GKVVI P
Sbjct  374   LETNRATGKVVIHP  387



>gb|ACJ11721.1| quinone oxidoreductase [Gossypium hirsutum]
Length=321

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 208/316 (66%), Gaps = 6/316 (2%)
 Frame = +3

Query  237   LQDMQKAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTSLV  404
             L    KAW Y E+G   +VLKL  D ++P P+ DQ+L+QV AA +NPIDFK  L     +
Sbjct  8     LPSKMKAWTYPEYGKSSDVLKLQSDVVVPQPRDDQVLLQVVAAGINPIDFKRMLGMFKNI  67

Query  405   PMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEET  584
                 P+IPG D+AG+VV  GS V KF  GD+VYG+I+   ++    + GT+AEFTVV E 
Sbjct  68    DSPLPIIPGYDVAGVVVKVGSQVKKFKEGDQVYGDINEKAVD-HPTQFGTIAEFTVVAEK  126

Query  585   LVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVY  764
             L+A+KPKNL+F  AASLPL I+TA +G     F  G+S+ ++GGAGGVG++ +QLAK VY
Sbjct  127   LLALKPKNLSFVEAASLPLVIETAYEGLERCHFSAGKSILVLGGAGGVGTMIIQLAKQVY  186

Query  765   GASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKEN  944
             GAS +AAT S  K++ +K LGAD  +DYTN  +E +PE +D+VYD +G    +    KE 
Sbjct  187   GASKIAATASTGKLDLLKSLGADLPIDYTNQNFEDLPEKFDVVYDAVGQCERAVKAVKEG  246

Query  945   ATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGY  1124
               ++ I +    P A    LT +G ILEKL+PFLESGKVK +IDP G F F    +AF Y
Sbjct  247   GDVVTI-YGAVVPPATTFMLTSNGAILEKLEPFLESGKVKPMIDPNGIFPFSETPQAFAY  305

Query  1125  IETGRARGKVVISPFP  1172
             +ETGR  GKVVIS  P
Sbjct  306   LETGRVTGKVVISIIP  321



>ref|NP_173786.1| alkenal/one oxidoreductase [Arabidopsis thaliana]
 sp|Q9ZUC1.2|QORL_ARATH RecName: Full=Quinone oxidoreductase-like protein At1g23740, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL06488.1|AF411799_1 At1g23740/F5O8_27 [Arabidopsis thaliana]
 gb|AAM16188.1| At1g23740/F5O8_27 [Arabidopsis thaliana]
 gb|AEE30427.1| alkenal/one oxidoreductase [Arabidopsis thaliana]
Length=386

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 203/310 (65%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y ++G  +VLKL  + ++P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  79    KAWVYSDYGGVDVLKLESNIVVPEIKEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  138

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V     GDEVY N+    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  139   VPGYDVAGVVVKVGSAVKDLKEGDEVYANVSEKALEGP-KQFGSLAEYTAVEEKLLALKP  197

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL +QLAKHVYGAS VA
Sbjct  198   KNIDFAQAAGLPLAIETADEGLVRTEFSAGKSILVLNGAGGVGSLVIQLAKHVYGASKVA  257

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E V+ LGAD  +DYT    E +P+ YD+V+D IG    +  V KE   ++ +
Sbjct  258   ATASTEKLELVRSLGADLAIDYTKENIEDLPDKYDVVFDAIGMCDKAVKVIKEGGKVVAL  317

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G++L+KL P++ESGKVK V+DP GPF F  V +AF Y+ET  A
Sbjct  318   TGAVTPP-GFRFVVTSNGDVLKKLNPYIESGKVKPVVDPKGPFPFSRVADAFSYLETNHA  376

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  377   TGKVVVYPIP  386



>ref|XP_008446207.1| PREDICTED: 2-methylene-furan-3-one reductase [Cucumis melo]
 gb|ADN33837.1| alcohol dehydrogenase [Cucumis melo subsp. melo]
Length=383

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 209/324 (65%), Gaps = 7/324 (2%)
 Frame = +3

Query  213   IFSTEPNGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK-  383
             + ++E   +    KAW Y E+G  +VLK  D  + VP+   DQ+L++V AAALNP+D K 
Sbjct  63    VVTSEVASVPSEMKAWVYGEYGGVDVLKF-DTSVSVPEVKEDQVLIKVVAAALNPVDGKR  121

Query  384   -LRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLA  560
              L +        P +PG D+AG+VV  GS V +   GDEVYGNI+   L+G  K+ G+LA
Sbjct  122   MLGKFKATDSPLPTVPGYDVAGVVVKVGSQVKELKEGDEVYGNINEKALDGP-KQFGSLA  180

Query  561   EFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgsla  740
             E+T VEE L+A+KPKN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL 
Sbjct  181   EYTAVEEKLLALKPKNIDFIQAAGLPLAIETAYEGLEKTNFSAGKSILVLNGAGGVGSLV  240

Query  741   vqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN  920
             +QLAK+V+GAS VAAT S  K+EF+K LG D  +DYT    E +PE +D+VYD IG    
Sbjct  241   IQLAKNVFGASKVAATASTGKLEFLKSLGVDLAIDYTKENIEDLPEKFDVVYDAIGQCDK  300

Query  921   SFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFC  1100
             +  V KE  +++ +T     P      +T  G +L+KL P+LESGKVK ++DP GPF F 
Sbjct  301   AVKVVKEGGSVVALTG-AVTPPGFRFVVTSDGAVLKKLNPYLESGKVKPIVDPKGPFPFS  359

Query  1101  NVVEAFGYIETGRARGKVVISPFP  1172
              VVEAF Y+E+ RA GKVVI P P
Sbjct  360   QVVEAFAYVESSRATGKVVIHPIP  383



>ref|XP_003553852.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Glycine max]
Length=320

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 156/313 (50%), Positives = 208/313 (66%), Gaps = 10/313 (3%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLGDFLIPVP--QHDQLLVQVQAAALNPIDFKLRQTSL---VPMN  413
             KAW Y E+G  +E+LK  +  IP+P  + DQ+L++V AAALNP D+ +R           
Sbjct  12    KAWVYYEYGNIEEILKF-ESNIPIPDIKEDQVLIKVVAAALNPADY-MRALGFFKDTDAP  69

Query  414   FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVA  593
              P++PG D AG+VV  GS V+KF +GDEVYG+I  +      K +GTLAE+T  EE ++A
Sbjct  70    LPIVPGFDAAGVVVRVGSKVSKFKVGDEVYGDIIEYAWNNP-KTIGTLAEYTATEEKVLA  128

Query  594   MKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGAS  773
              KP NL+F  AASLP AI TA QGF    F  G+S+ ++GGAGGVGSL +QLAKHV+GAS
Sbjct  129   HKPSNLSFIEAASLPAAIITAYQGFDKIEFSAGKSILVLGGAGGVGSLVIQLAKHVFGAS  188

Query  774   SVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATI  953
              VAAT S PK + ++ LGAD  +DYT   +E++ E +D+VYDT+G+S  +    KE   +
Sbjct  189   KVAATASTPKQDLLRSLGADLAIDYTKENFEELVEKFDVVYDTVGESNKALKAVKEGGKV  248

Query  954   IDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIET  1133
             + I  PP+ P A+       G +LEKL+P+LESGKVK V+DP GPF F   VEAF Y++T
Sbjct  249   VTIV-PPATPPAITFSAVSDGAVLEKLQPYLESGKVKPVLDPKGPFPFSQTVEAFAYLKT  307

Query  1134  GRARGKVVISPFP  1172
              RA GKVV+ P P
Sbjct  308   NRAIGKVVLHPIP  320



>emb|CDY61544.1| BnaA09g29920D [Brassica napus]
Length=385

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 154/310 (50%), Positives = 202/310 (65%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +P    DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  78    KAWVYSEYGGVDVLKLESNIAVPEVNDDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  137

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F  GDEVY N+    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  138   VPGYDVAGVVVKVGSAVKDFKEGDEVYANVSEKALEGP-KQSGSLAEYTAVEEKLLALKP  196

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSLA+QLAKHVYGAS VA
Sbjct  197   KNIDFAQAAGLPLAIETADEGLVRTEFSAGKSILVLNGAGGVGSLAIQLAKHVYGASKVA  256

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E V+ LGAD  +DYT    E + E +D+V+D IG    +  V KE   ++ +
Sbjct  257   ATASTGKLELVRSLGADLAIDYTKENIEDLTEKFDVVFDAIGMCDKAVKVIKEGGKVVAL  316

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +GE+L+KL P++ESGKVK V+DP GPF F  V +AF Y+ET  A
Sbjct  317   TGAVTPP-GFRFVVTSNGEVLKKLNPYIESGKVKPVVDPKGPFPFSRVADAFSYLETNHA  375

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  376   TGKVVVYPIP  385



>ref|XP_006305049.1| hypothetical protein CARUB_v10009414mg [Capsella rubella]
 gb|EOA37947.1| hypothetical protein CARUB_v10009414mg [Capsella rubella]
Length=387

 Score =   259 bits (663),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 200/309 (65%), Gaps = 5/309 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  EV+KL  +  +P    DQ+L++V AA LNP+D K RQ      +   P 
Sbjct  80    KAWVYGEYGGVEVMKLESNITVPEINEDQVLIKVVAAGLNPVDAKRRQGKFKATDSPLPT  139

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F +GDEVY N+    LEG  K+ G+LAE+T VEE L+ +KP
Sbjct  140   VPGYDVAGVVVKVGSAVKDFKVGDEVYANVSEKALEGP-KQFGSLAEYTAVEEKLLGLKP  198

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLA++TA +G     F  G+S+ ++ GAGGVGSL +QLAKHVYGAS VA
Sbjct  199   KNIDFVQAAGLPLAMETADEGLVRTEFSAGKSILVLNGAGGVGSLVIQLAKHVYGASKVA  258

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E VK LGAD  +DYT    E +P+ YD+V+D IG    +  V KE   ++ +
Sbjct  259   ATASTGKLELVKSLGADLAIDYTKENIEDLPDKYDVVFDAIGMCDKAVKVIKEGGKVVAL  318

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +GE+L+KL P++ESGKVK V+DP GPF F  V EAF Y+ET  A
Sbjct  319   TGAVT-PPGFRFVVTSNGEVLKKLNPYIESGKVKPVVDPKGPFPFSRVAEAFTYLETNHA  377

Query  1143  RGKVVISPF  1169
              GKVV+ P 
Sbjct  378   TGKVVVYPI  386



>ref|XP_008230610.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Prunus mume]
Length=325

 Score =   258 bits (658),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 156/321 (49%), Positives = 208/321 (65%), Gaps = 21/321 (7%)
 Frame = +3

Query  246   MQKAWYYEEHGPK-EVLKL-GDFLIPVPQHDQLLVQVQAAALNPID-------FKLRQTS  398
             + KAW Y EHG    VLK   +  +P  + DQ+L++V AAALNPID       F+   T+
Sbjct  14    VNKAWIYREHGETAHVLKFETNVAVPQIKEDQVLIKVVAAALNPIDAKRILGVFRATDTA  73

Query  399   LVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGE--LKRMGTLAEFTV  572
             L     P +PG D+AG+VV  GS  +KF+IGDEVYG+I   N EG   LK+ GTLAE+T 
Sbjct  74    L-----PTVPGFDVAGVVVKLGSKASKFNIGDEVYGDI---NEEGSINLKKFGTLAEYTA  125

Query  573   VEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqla  752
              EE L+A+KPKNL F  AASLP+ ++TA +G    G   GQS+ ++GGAGG+G+  +QLA
Sbjct  126   AEERLLALKPKNLGFVEAASLPMVMETAYEGLERVGLSAGQSILVLGGAGGLGTHVIQLA  185

Query  753   KHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVV  932
             KHV+GAS VAAT S  K++ ++ LGAD  +DYT    E +PE +D+V+D +G S  +   
Sbjct  186   KHVFGASRVAATASTKKLDLLRSLGADLAIDYTEENVEDLPEKFDVVFDAVGQSDKAVKA  245

Query  933   AKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
              KE   ++ I + P  P A    LT +G  LEKLKP+LESGKVK V+DP GP+ F   +E
Sbjct  246   VKEEGRVVTI-FGPITPPAFMFVLTSTGSNLEKLKPYLESGKVKPVLDPTGPYPFSKTLE  304

Query  1113  AFGYIETGRAR-GKVVISPFP  1172
             AF Y++T RA  GKVV+ P P
Sbjct  305   AFAYLQTSRATGGKVVVYPIP  325



>gb|AFK35692.1| unknown [Lotus japonicus]
Length=387

 Score =   259 bits (662),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 202/310 (65%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLK   +  +P  + DQ+LV+V AAALNP+D K RQ      +   P 
Sbjct  80    KAWVYGEYGGVDVLKFDSNVAVPDLKEDQVLVRVVAAALNPVDAKRRQGKFKATDSPLPT  139

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V +F +GDEVYG+++   LEG  K+ G+LAE+T VEE L+A KP
Sbjct  140   VPGYDVAGVVVKVGSEVKEFRVGDEVYGDVNEKALEGP-KQFGSLAEYTAVEEKLLAPKP  198

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AASLPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAK V+GA+ VA
Sbjct  199   KNLDFAQAASLPLAIETAYEGLERTGFSSGKSILVLNGSGGVGSLVIQLAKQVFGAARVA  258

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT     +E +K LG D  +DYT   +E +PE +D+VYD IG    +    KE  +++ +
Sbjct  259   ATPGTRNLELLKSLGVDLAIDYTKENFEDLPEKFDVVYDAIGQCDRAVKAIKEGGSVVAL  318

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G +L KL P+LESGKVK ++D  GPF F  + EAF Y+ET RA
Sbjct  319   TGAVTPP-GFRFVVTSNGTVLRKLNPYLESGKVKPIVDSKGPFPFTQLAEAFSYLETNRA  377

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  378   TGKVVIHPIP  387



>ref|XP_008458755.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Cucumis melo]
Length=320

 Score =   257 bits (656),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 156/313 (50%), Positives = 210/313 (67%), Gaps = 9/313 (3%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMNF--  416
             KAW Y + G   +VLKL DF  PVPQ   +QLL++V AA+LNPID+K    +L   N+  
Sbjct  11    KAWVYHDFGNTPDVLKL-DFNYPVPQINENQLLIKVVAASLNPIDYKRIHGALKAFNYFP  69

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P IPG D+AG+VV  GS V KF +GDEVYG+I++  L+ + K +GTLAE+T  EE ++A+
Sbjct  70    PSIPGYDVAGVVVKVGSEVKKFKVGDEVYGDINHKALD-KPKNVGTLAEYTATEENVLAL  128

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KPKNL+F  AASLPLA++TA +G   AG   G+SV ++GGAGGVG+  +QLAK V+GAS 
Sbjct  129   KPKNLSFLEAASLPLAMETAYEGLERAGLSPGKSVIVLGGAGGVGAHVIQLAKQVFGASK  188

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             V AT S  K + ++ LGAD+ +DYT   +E + E +D+VYD +G    +    KE  +++
Sbjct  189   VVATASTSKQDLLRSLGADQPIDYTKENFEDLDEKFDVVYDAVGQPDKAVKALKEGGSLV  248

Query  957   DITWP-PSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIET  1133
              I  P P  P A    LT    +LEKL P+LESGKVK +IDP  PF F + ++AF Y+ET
Sbjct  249   SIAAPVPGFPDAFFL-LTSDAVMLEKLNPYLESGKVKPLIDPKSPFPFSDTLDAFAYLET  307

Query  1134  GRARGKVVISPFP  1172
              RA GK+VI P P
Sbjct  308   SRATGKIVIYPIP  320



>dbj|BAJ23910.1| chloroplastic alkenal/one oxidoreductase [Cucumis sativus]
Length=383

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 155/324 (48%), Positives = 210/324 (65%), Gaps = 7/324 (2%)
 Frame = +3

Query  213   IFSTEPNGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK-  383
             + ++E   +    KAW Y E+G  +VLK  D  + VP+   DQ+L++V AAALNP+D K 
Sbjct  63    VVTSEVASVPSEMKAWVYGEYGGVDVLKF-DSSVSVPEVKEDQVLIKVVAAALNPVDGKR  121

Query  384   -LRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLA  560
              L +        P +PG D+AG+VV  GS V +   GDEVYGNI+   L+G  K+ G+LA
Sbjct  122   MLGKFKATDSPLPTVPGYDVAGVVVKVGSQVKELKEGDEVYGNINEKALDGP-KQFGSLA  180

Query  561   EFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgsla  740
             E+T VEE L+A+KPKN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL 
Sbjct  181   EYTAVEEKLLAVKPKNIDFVQAAGLPLAIETAYEGLEKTNFSTGKSILVLNGAGGVGSLV  240

Query  741   vqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN  920
             +QLAK+V+GAS VAAT S  K+EF+K LG D  +DYT    E +PE +D+VYD IG    
Sbjct  241   IQLAKNVFGASKVAATASTGKLEFLKSLGVDLAIDYTKENIEDLPEKFDVVYDAIGQCDK  300

Query  921   SFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFC  1100
             +  V K+  +++ +T   + P      +T  G +L+KL P+LESGKVK ++DP GPF F 
Sbjct  301   AVKVVKKGGSVVALTGAVT-PPGFRFVVTSDGAVLKKLNPYLESGKVKPIVDPKGPFSFS  359

Query  1101  NVVEAFGYIETGRARGKVVISPFP  1172
              VVEAF Y+E+ RA GKVVI P P
Sbjct  360   QVVEAFAYVESSRATGKVVIHPIP  383



>ref|XP_004155355.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Cucumis sativus]
Length=383

 Score =   259 bits (661),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 155/324 (48%), Positives = 210/324 (65%), Gaps = 7/324 (2%)
 Frame = +3

Query  213   IFSTEPNGLQDMQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK-  383
             + ++E   +    KAW Y E+G  +VLK  D  + VP+   DQ+L++V AAALNP+D K 
Sbjct  63    VVTSEVASVPSEMKAWVYGEYGGVDVLKF-DSSVSVPEVKEDQVLIKVVAAALNPVDGKR  121

Query  384   -LRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLA  560
              L +        P +PG D+AG+VV  GS V +   GDEVYGNI+   L+G  K+ G+LA
Sbjct  122   MLGKFKATDSPLPTVPGYDVAGVVVKVGSQVKELKEGDEVYGNINEKALDGP-KQFGSLA  180

Query  561   EFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgsla  740
             E+T VEE L+A+KPKN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL 
Sbjct  181   EYTAVEEKLLAVKPKNIDFVQAAGLPLAIETAYEGLEKTNFSTGKSILVLNGAGGVGSLV  240

Query  741   vqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN  920
             +QLAK+V+GAS VAAT S  K+EF+K LG D  +DYT    E +PE +D+VYD IG    
Sbjct  241   IQLAKNVFGASKVAATASTGKLEFLKSLGVDLAIDYTKENIEDLPEKFDVVYDAIGQCDK  300

Query  921   SFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFC  1100
             +  V K+  +++ +T   + P      +T  G +L+KL P+LESGKVK ++DP GPF F 
Sbjct  301   AVKVVKKGGSVVALTGAVT-PPGFRFVVTSDGAVLKKLNPYLESGKVKPIVDPKGPFSFS  359

Query  1101  NVVEAFGYIETGRARGKVVISPFP  1172
              VVEAF Y+E+ RA GKVVI P P
Sbjct  360   QVVEAFAYVESSRATGKVVIHPIP  383



>gb|KEH22218.1| zinc-binding dehydrogenase family oxidoreductase [Medicago truncatula]
Length=317

 Score =   256 bits (655),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 212/312 (68%), Gaps = 8/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGPK-EVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN--F  416
             KAW Y E+G   +VLK  D  +P+PQ   DQ+L++V AA+LNPID+K  + +    +   
Sbjct  9     KAWTYSEYGHSVDVLKF-DPNVPIPQVKDDQVLIKVAAASLNPIDYKRMEGAFKASDSPL  67

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P  PG D++G+VV  GS V KF +GDEVYG+I+   LE   K +G+LAE+T  EE L+A 
Sbjct  68    PTAPGYDVSGVVVKVGSEVKKFKVGDEVYGDINVKALEYP-KVIGSLAEYTAAEEILLAH  126

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KPKNL+F  AASLPL I+TA +G    GF  G+S+ ++GGAGGVG+  +QLAKHVYGAS 
Sbjct  127   KPKNLSFAEAASLPLTIETAYEGLERTGFSAGKSILVLGGAGGVGTHVIQLAKHVYGASK  186

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             VAAT+S  K+E +  LGAD  +DYT   +E +PE +D+V+DT+G++  +F   KE   ++
Sbjct  187   VAATSSTKKLELLSNLGADLPIDYTKENFEDLPEKFDVVFDTVGETEKAFKALKEGGKVV  246

Query  957   DITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
              I  PP  P ++   L  +G ILEKL P+LESGKVK V+DP  PF F   VEAF Y+ETG
Sbjct  247   TIV-PPGFPPSIFFILPSNGAILEKLNPYLESGKVKPVLDPKSPFPFSQSVEAFSYLETG  305

Query  1137  RARGKVVISPFP  1172
             RA GKVVI P P
Sbjct  306   RATGKVVIHPIP  317



>ref|XP_004489284.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Cicer arietinum]
Length=320

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 151/311 (49%), Positives = 204/311 (66%), Gaps = 6/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTSLVPMNFP  419
             KAW Y ++G  +E+LK   +   P P++DQ+L++V AAALNP+D K  L     +    P
Sbjct  12    KAWVYSQYGKIEEILKFDSNVPTPHPKNDQVLIKVVAAALNPVDIKRALGHFKDIDSPLP  71

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+V++ G  V KF +GDEVYG+I+   L    K +GTLAE+ V EE ++A K
Sbjct  72    TVPGYDVAGVVISVGEEVKKFKVGDEVYGDINEITLHNP-KTIGTLAEYVVAEEKVLAHK  130

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P NL+F  AASLPLAI TA QG     F   +S+ I+GGAGGVGSL +QLAKHV+GAS +
Sbjct  131   PSNLSFVEAASLPLAIITAYQGLEKVEFSSSKSLLILGGAGGVGSLVIQLAKHVFGASRI  190

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT S PK+E ++ LGAD  +DYT   +E++ E +D+VYD +G S  +    KE   ++ 
Sbjct  191   AATASTPKLEILRKLGADFPIDYTKENFEELTEKFDVVYDAVGQSDRALKAIKEGGKVVT  250

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I  PP  P A+   LT  G +LE L+P+LESGKVK ++DP  PF F   +EAF Y+ T R
Sbjct  251   I-LPPGTPPAIPFLLTSDGIVLETLQPYLESGKVKPILDPKSPFPFSQTLEAFSYLNTNR  309

Query  1140  ARGKVVISPFP  1172
             A GK+VI P P
Sbjct  310   AIGKIVIHPIP  320



>sp|Q941I0.2|ENOXC_FRAAN RecName: Full=2-methylene-furan-3-one reductase; AltName: Full=Enone 
oxidoreductase; Short=FaEO; AltName: Full=Quinone oxidoreductase; 
Short=FaQR [Fragaria x ananassa]
Length=323

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 208/319 (65%), Gaps = 7/319 (2%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTS  398
               +  + KAW Y E+G   +VLK      +P  + DQ+L++V AA+LNP+DFK  L    
Sbjct  7     ESIPSVNKAWVYSEYGKTSDVLKFDPSVAVPEIKEDQVLIKVVAASLNPVDFKRALGYFK  66

Query  399   LVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVE  578
                   P IPG D+AG+VV  GS VTKF +GDEVYG+++   L     R G+LAE+T   
Sbjct  67    DTDSPLPTIPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNETALVNP-TRFGSLAEYTAAY  125

Query  579   ETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKH  758
             E ++A KPKNL+F  AASLPLAI+TA +G   A    G+SV ++GGAGGVG+  +QLAKH
Sbjct  126   ERVLAHKPKNLSFIEAASLPLAIETAHEGLERAELSAGKSVLVLGGAGGVGTHIIQLAKH  185

Query  759   VYGASSVAATTSAPKVEFVKCLGA-DKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVA  935
             V+GAS VAAT S  K++ ++ LGA D  +DYT   +E +PE +D+VYD +G++  +    
Sbjct  186   VFGASKVAATASTKKLDLLRTLGAADLAIDYTKENFEDLPEKFDVVYDAVGETDKAVKAV  245

Query  936   KENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEA  1115
             KE   ++ I  P + P A+   LT  G +LEKLKP+LESGKVK V+DP  P+ F  VVEA
Sbjct  246   KEGGKVVTIVGP-ATPPAILFVLTSKGSVLEKLKPYLESGKVKPVLDPTSPYPFTKVVEA  304

Query  1116  FGYIETGRARGKVVISPFP  1172
             FGY+E+ RA GKVV+ P P
Sbjct  305   FGYLESSRATGKVVVYPIP  323



>ref|XP_003618487.1| Quinone oxidoreductase-like protein [Medicago truncatula]
 gb|AES74705.1| zinc-binding dehydrogenase family oxidoreductase [Medicago truncatula]
Length=320

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 152/311 (49%), Positives = 206/311 (66%), Gaps = 6/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTSLVPMNFP  419
             KAW Y ++G  +E+LK   +   P P+ DQ+L++V AAALNP+D K  L     +    P
Sbjct  12    KAWVYSQYGNIEEILKFDSNVPTPHPKEDQVLIKVVAAALNPVDIKRALGHFKDIDSPLP  71

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV+ G  V KF +GDEVYG+I+   L    K +GTL+E+TV EE ++A K
Sbjct  72    TVPGYDVAGVVVSVGEQVKKFKVGDEVYGDINEITLHNP-KTIGTLSEYTVAEEKVLAHK  130

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P NL+F  AASLPLAI TA QG     F  G+S+ ++GGAGGVGSL +QLAKHV+ AS +
Sbjct  131   PSNLSFVEAASLPLAIITAYQGLERVEFSSGKSLLVLGGAGGVGSLVIQLAKHVFEASRI  190

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT S  K++F++ LGAD  +DYT   YE++ E +D+VYD +GDS  +   A E   ++ 
Sbjct  191   AATASTTKLDFLRKLGADLAIDYTKENYEELTEKFDVVYDAVGDSERAVKAANEGGKVVT  250

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I  PP  P A+   LT  G +LEKL+P+LE+GKVK ++DP  PF F   +EAF Y+ T R
Sbjct  251   I-LPPGTPPAIPFLLTSDGAVLEKLQPYLENGKVKPILDPKSPFPFYQTLEAFSYLNTNR  309

Query  1140  ARGKVVISPFP  1172
             A GK+VI P P
Sbjct  310   AIGKIVIHPIP  320



>gb|ACU19769.1| unknown [Glycine max]
Length=319

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 154/313 (49%), Positives = 207/313 (66%), Gaps = 10/313 (3%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQ----TSLVPMN  413
             KAW Y E+G  KEVLK    + +P    DQ+L++V AA+LNPID K  +     S  P+ 
Sbjct  11    KAWTYSEYGKSKEVLKFNQSVALPEVNEDQVLIKVAAASLNPIDHKRMEGYFKNSDSPL-  69

Query  414   FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVA  593
              P  PG D+AG+VV  GS V KF +GDEVYG+I+   LE   K +G+LAE+T  EE L+A
Sbjct  70    -PTAPGYDVAGVVVKVGSEVKKFKVGDEVYGDINVKALEYP-KVIGSLAEYTAAEERLLA  127

Query  594   MKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGAS  773
              KP+NL+F  AASLPL ++TA +G    GF  G+S+ ++GGAGGVG+  +QLAKHVYGAS
Sbjct  128   HKPQNLSFAEAASLPLTLETAYEGLERTGFSAGKSILVLGGAGGVGTHVIQLAKHVYGAS  187

Query  774   SVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATI  953
              VAAT S  K+E ++ LGAD  +DYT   +E + E +D+VYDT+G +  +F V KE   +
Sbjct  188   KVAATASTRKLELLRNLGADWPIDYTKENFEDLSEKFDVVYDTVGQTEQAFKVLKEGGKV  247

Query  954   IDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIET  1133
             + I  P  +P A+   L+  G ILEKL P+ ESGK+K ++DP  PF F   VEAF ++ET
Sbjct  248   VTIVPPGFHP-AILFILSTDGAILEKLNPYFESGKLKPILDPKSPFPFSQTVEAFAHLET  306

Query  1134  GRARGKVVISPFP  1172
              RA GK+V+ P P
Sbjct  307   NRATGKIVVYPIP  319



>ref|NP_001275527.1| quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Cucumis sativus]
 dbj|BAJ23911.1| cytosolic alkenal/one oxidoreductase [Cucumis sativus]
 gb|KGN52377.1| hypothetical protein Csa_5G630800 [Cucumis sativus]
Length=320

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 155/313 (50%), Positives = 210/313 (67%), Gaps = 9/313 (3%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMNF--  416
             KAW Y + G   +VLKL D   PVPQ   +QLL++V AA+LNPID+K    +L   N+  
Sbjct  11    KAWVYHDFGNTPDVLKL-DSNYPVPQINENQLLIKVVAASLNPIDYKRIHGALKAFNYFP  69

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P IPG D+AG+V   GS V KF +GDEVYG+I++  L+ + K +GTLAE+TV EE ++A+
Sbjct  70    PSIPGYDVAGVVAKVGSEVKKFKVGDEVYGDINHKALD-KPKNVGTLAEYTVTEENVLAL  128

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KPKNL+F  AASLPLA++TA +G   AG   G+S+ ++GGAGGVG+  +QLAKHV+GAS 
Sbjct  129   KPKNLSFLEAASLPLAMETAYEGLERAGLSPGKSIIVLGGAGGVGAFIIQLAKHVFGASK  188

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             V AT S  K + ++ LGAD+ +DYT   +E + E +D+VYD +G    +    KE  +++
Sbjct  189   VVATASTTKQDLLRSLGADQPIDYTKENFEDLDEKFDVVYDAVGQPDKAVKALKEGGSLV  248

Query  957   DITWP-PSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIET  1133
              I  P P  P A    LT    +LEKL P+LESGKVK +IDP  PF F + ++AF Y+ET
Sbjct  249   SIAAPVPGFPDAFFL-LTSDAVMLEKLNPYLESGKVKPLIDPKSPFPFSDTLDAFAYLET  307

Query  1134  GRARGKVVISPFP  1172
              RA GK+VI P P
Sbjct  308   SRATGKIVIYPIP  320



>gb|AAL06644.1| putative quinone oxidoreductase [Fragaria x ananassa]
Length=339

 Score =   256 bits (654),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 208/319 (65%), Gaps = 7/319 (2%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTS  398
               +  + KAW Y E+G   +VLK      +P  + DQ+L++V AA+LNP+DFK  L    
Sbjct  23    ESIPSVNKAWVYSEYGKTSDVLKFDPSVAVPEIKEDQVLIKVVAASLNPVDFKRALGYFK  82

Query  399   LVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVE  578
                   P IPG D+AG+VV  GS VTKF +GDEVYG+++   L     R G+LAE+T   
Sbjct  83    DTDSPLPTIPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNETALVNP-TRFGSLAEYTAAY  141

Query  579   ETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKH  758
             E ++A KPKNL+F  AASLPLAI+TA +G   A    G+SV ++GGAGGVG+  +QLAKH
Sbjct  142   ERVLAHKPKNLSFIEAASLPLAIETAHEGLERAELSAGKSVLVLGGAGGVGTHIIQLAKH  201

Query  759   VYGASSVAATTSAPKVEFVKCLGA-DKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVA  935
             V+GAS VAAT S  K++ ++ LGA D  +DYT   +E +PE +D+VYD +G++  +    
Sbjct  202   VFGASKVAATASTKKLDLLRTLGAADLAIDYTKENFEDLPEKFDVVYDAVGETDKAVKAV  261

Query  936   KENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEA  1115
             KE   ++ I  P + P A+   LT  G +LEKLKP+LESGKVK V+DP  P+ F  VVEA
Sbjct  262   KEGGKVVTIVGP-ATPPAILFVLTSKGSVLEKLKPYLESGKVKPVLDPTSPYPFTKVVEA  320

Query  1116  FGYIETGRARGKVVISPFP  1172
             FGY+E+ RA GKVV+ P P
Sbjct  321   FGYLESSRATGKVVVYPIP  339



>gb|AFK33810.1| unknown [Medicago truncatula]
Length=317

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 211/312 (68%), Gaps = 8/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGPK-EVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN--F  416
             KAW Y E+G   +VLK  D  +P+PQ   DQ L++V AA+LNPID+K  + +    +   
Sbjct  9     KAWTYSEYGHSVDVLKF-DPNVPIPQVKDDQALIKVAAASLNPIDYKRMEGAFKASDSPL  67

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P  PG D++G+VV  GS V KF +GDEVYG+I+   LE   K +G+LAE+T  EE L+A 
Sbjct  68    PTAPGYDVSGVVVKVGSEVKKFKVGDEVYGDINVKALEYP-KVIGSLAEYTAAEEILLAH  126

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KPKNL+F  AASLPL I+TA +G    GF  G+S+ ++GGAGGVG+  +QLAKHVYGAS 
Sbjct  127   KPKNLSFAEAASLPLTIETAYEGLERTGFSAGKSILVLGGAGGVGTHVIQLAKHVYGASK  186

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             VAAT+S  K+E +  LGAD  +DYT   +E +PE +D+V+DT+G++  +F   KE   ++
Sbjct  187   VAATSSTKKLELLSNLGADLPIDYTKENFEDLPEKFDVVFDTVGETEKAFKALKEGGKVV  246

Query  957   DITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
              I  PP  P ++   L  +G ILEKL P+LESGKVK V+DP  PF F   VEAF Y+ETG
Sbjct  247   TIV-PPGFPPSIFFILPSNGAILEKLNPYLESGKVKPVLDPKSPFPFSQSVEAFSYLETG  305

Query  1137  RARGKVVISPFP  1172
             RA GKVVI P P
Sbjct  306   RATGKVVIHPIP  317



>sp|O23939.2|ENOX_FRAVE RecName: Full=2-methylene-furan-3-one reductase; AltName: Full=Enone 
oxidoreductase; AltName: Full=Quinone oxidoreductase; 
Short=FaQR [Fragaria vesca]
Length=322

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 152/318 (48%), Positives = 207/318 (65%), Gaps = 6/318 (2%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTS  398
               +  + KAW   E+G   +VLK      +P  + DQ+L++V AA+LNP+DFK  L    
Sbjct  7     ESIPSVNKAWVXSEYGKTSDVLKFDPSVAVPEIKEDQVLIKVVAASLNPVDFKRALGYFK  66

Query  399   LVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVE  578
                   P IPG  +AG+VV  GS VTKF +GDEVYG+++   L     R G+LAE+T  +
Sbjct  67    DTDSPLPTIPGYYVAGVVVKVGSQVTKFKVGDEVYGDLNETALVNP-TRFGSLAEYTAAD  125

Query  579   ETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKH  758
             E ++A KPKNL+F  AASLPLAI+TA +G   A    G+SV ++GGAGGVG+  +QLAKH
Sbjct  126   ERVLAHKPKNLSFIEAASLPLAIETAHEGLERAELSAGKSVLVLGGAGGVGTHIIQLAKH  185

Query  759   VYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAK  938
             V+GAS VAAT S  K++ ++ LGAD  +DYT   +E +PE +D+VYD +G++  +    K
Sbjct  186   VFGASKVAATASTKKLDLLRTLGADLAIDYTKENFEDLPEKFDVVYDAVGETDKAVKAVK  245

Query  939   ENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAF  1118
             E   ++ I   P+ P A+   LT  G +LEKLKP+LESGKVK V+DP  P+ F  VVEAF
Sbjct  246   EGGKVVTIVG-PATPPAILFVLTSKGSVLEKLKPYLESGKVKPVLDPTSPYPFTKVVEAF  304

Query  1119  GYIETGRARGKVVISPFP  1172
             GY+E+ RA GKVV+ P P
Sbjct  305   GYLESSRATGKVVVYPIP  322



>ref|XP_009115505.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic 
[Brassica rapa]
Length=385

 Score =   257 bits (657),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 202/310 (65%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +P    DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  78    KAWVYGEYGGVDVLKLESNIAVPEVNDDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  137

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F  GDEVY N+    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  138   VPGYDVAGVVVKVGSAVKDFKEGDEVYANVSEKALEGP-KQSGSLAEYTAVEEKLLALKP  196

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSLA+QLAKHVYGAS VA
Sbjct  197   KNIDFAQAAGLPLAIETADEGLVRTEFSAGKSILVLNGAGGVGSLAIQLAKHVYGASKVA  256

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E V+ LGAD  +DYT    E + E +D+V+D IG    +  V KE   ++ +
Sbjct  257   ATASTGKLELVRSLGADLAIDYTKENIEDLTEKFDVVFDAIGMCDKAVKVIKEGGKVVAL  316

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G++L+KL P++ESGKVK V+DP GPF F  V +AF Y+ET  A
Sbjct  317   TGAVTPP-GFRFVVTSNGDVLKKLNPYIESGKVKPVVDPKGPFPFSRVADAFSYLETNHA  375

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  376   TGKVVVYPIP  385



>emb|CAA04767.1| ripening-induced protein [Fragaria vesca]
Length=337

 Score =   254 bits (650),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 152/318 (48%), Positives = 207/318 (65%), Gaps = 6/318 (2%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTS  398
               +  + KAW   E+G   +VLK      +P  + DQ+L++V AA+LNP+DFK  L    
Sbjct  22    ESIPSVNKAWVXSEYGKTSDVLKFDPSVAVPEIKEDQVLIKVVAASLNPVDFKRALGYFK  81

Query  399   LVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVE  578
                   P IPG  +AG+VV  GS VTKF +GDEVYG+++   L     R G+LAE+T  +
Sbjct  82    DTDSPLPTIPGYYVAGVVVKVGSQVTKFKVGDEVYGDLNETALVNP-TRFGSLAEYTAAD  140

Query  579   ETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKH  758
             E ++A KPKNL+F  AASLPLAI+TA +G   A    G+SV ++GGAGGVG+  +QLAKH
Sbjct  141   ERVLAHKPKNLSFIEAASLPLAIETAHEGLERAELSAGKSVLVLGGAGGVGTHIIQLAKH  200

Query  759   VYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAK  938
             V+GAS VAAT S  K++ ++ LGAD  +DYT   +E +PE +D+VYD +G++  +    K
Sbjct  201   VFGASKVAATASTKKLDLLRTLGADLAIDYTKENFEDLPEKFDVVYDAVGETDKAVKAVK  260

Query  939   ENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAF  1118
             E   ++ I   P+ P A+   LT  G +LEKLKP+LESGKVK V+DP  P+ F  VVEAF
Sbjct  261   EGGKVVTIVG-PATPPAILFVLTSKGSVLEKLKPYLESGKVKPVLDPTSPYPFTKVVEAF  319

Query  1119  GYIETGRARGKVVISPFP  1172
             GY+E+ RA GKVV+ P P
Sbjct  320   GYLESSRATGKVVVYPIP  337



>ref|NP_001241983.1| uncharacterized protein LOC100817947 [Glycine max]
 gb|ACU18295.1| unknown [Glycine max]
Length=319

 Score =   253 bits (645),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 153/313 (49%), Positives = 207/313 (66%), Gaps = 10/313 (3%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQ----TSLVPMN  413
             KAW Y E+G  KEVLK    + +P  + DQ+L++V AA+LNPID K  +     S  P+ 
Sbjct  11    KAWTYSEYGKSKEVLKFNQSVALPEVKEDQVLIKVAAASLNPIDHKRMEGYFKNSGSPL-  69

Query  414   FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVA  593
              P  PG D+AG+VV  GS V KF +GD VYG+I+   LE   K +G+LAE+T  EE L+A
Sbjct  70    -PTAPGYDVAGVVVKVGSEVKKFKVGDVVYGDINVKALEYP-KVIGSLAEYTAAEERLLA  127

Query  594   MKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGAS  773
              KP+NL+F  AASLPL ++TA +G    GF  G+S+ ++GGAGGVG+  +QLAKHVYGAS
Sbjct  128   HKPQNLSFAEAASLPLTLETAYEGLERTGFSAGKSILVLGGAGGVGTHVIQLAKHVYGAS  187

Query  774   SVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATI  953
              VAAT S  K+E ++ LGAD  +DYT   +E + E +D+VYDT+G +  +F V KE   +
Sbjct  188   KVAATASTRKLELLRNLGADWPIDYTKENFEDLSEKFDVVYDTVGQTEQAFKVLKEGGKV  247

Query  954   IDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIET  1133
             + I  P  +P A+   L+  G ILEKL P+ ESGK+K ++DP  PF F   VEAF ++ET
Sbjct  248   VTIVPPGFHP-AILFILSTDGAILEKLNPYFESGKLKPILDPKSPFPFSQTVEAFAHLET  306

Query  1134  GRARGKVVISPFP  1172
              RA GK+V+ P P
Sbjct  307   NRATGKIVVYPIP  319



>gb|KFK44450.1| hypothetical protein AALP_AA1G258400 [Arabis alpina]
Length=381

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 201/310 (65%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  74    KAWVYGEYGGVDVLKLESNIAVPEIKEDQVLIKVVAAALNPVDAKRRQGKFKSTDSPLPT  133

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS V  F   DEVYG++    LEG  K+ G+LAE+T VEE L+A+KP
Sbjct  134   VPGYDVAGVVVKVGSAVKDFKEADEVYGDVSEKALEGP-KQFGSLAEYTAVEEKLLALKP  192

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL +QLAK VYGAS VA
Sbjct  193   KNIDFVQAAGLPLAIETADEGLVRTEFSAGKSILVLNGAGGVGSLVIQLAKEVYGASKVA  252

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E V+ LGAD  +DYT    E +PE +D+V+D IG    +  V KE   ++ +
Sbjct  253   ATASTGKLELVRSLGADLAIDYTKENIEDLPEKFDVVFDAIGMCDKAVKVIKEGGKVVAL  312

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G +L+KL P++ESGKVK V+DP GPF F  V +AF Y+ET  A
Sbjct  313   TGAVTPP-GFRFVVTSNGAVLKKLNPYIESGKVKPVVDPKGPFPFSQVADAFSYLETNHA  371

Query  1143  RGKVVISPFP  1172
              GK+V+ P P
Sbjct  372   TGKIVVYPIP  381



>ref|XP_009334069.1| PREDICTED: 2-methylene-furan-3-one reductase [Pyrus x bretschneideri]
Length=326

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 156/328 (48%), Positives = 219/328 (67%), Gaps = 14/328 (4%)
 Frame = +3

Query  213   IFSTEPNGLQDMQKAWYYEEHGPK-EVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK  383
             + S++   +  + KAW Y E+G   +VLK  D  +PVP+   DQ+L++V AA+LNP+DFK
Sbjct  5     VASSDSVSIPSVNKAWVYSEYGKSADVLKF-DPNVPVPEIKEDQVLIKVVAASLNPVDFK  63

Query  384   -----LRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRM  548
                   + T   P   P +PG D+AG+VV  GS VTKF +GDEVYG+++   L+ + K++
Sbjct  64    RMLGYFKDTDSSP---PTVPGYDVAGVVVKVGSKVTKFKVGDEVYGDLNEKALD-KPKKI  119

Query  549   GTLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggv  728
             G+LAE+T  EE  +A+K KNL+F  AASLPLAI+TA +G     F  G+S+ ++GGAGGV
Sbjct  120   GSLAEYTAAEERGLALKAKNLSFVEAASLPLAIETAYEGLERVEFFAGKSILVLGGAGGV  179

Query  729   gslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG  908
             G+  +QLAKHV+GAS VAAT S  K++ ++ LGAD  +DYT   +E +PE +D+VYD +G
Sbjct  180   GTHVIQLAKHVFGASKVAATASTKKLDLLRSLGADLAIDYTKENFEDLPEKFDVVYDAVG  239

Query  909   DSINSFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGP  1088
              S  +    KE   ++ I   P  P A+   LT +G +LEKLKP+LESGKV+ V+DP GP
Sbjct  240   QSDRALKAVKEGGKVVTIVG-PVTPPAIIFILTSTGTVLEKLKPYLESGKVRPVLDPTGP  298

Query  1089  FHFCNVVEAFGYIETGRARGKVVISPFP  1172
             + F   VEAF Y+ET RA GKV++ P P
Sbjct  299   YPFSKTVEAFAYLETSRATGKVIVYPIP  326



>ref|XP_008230948.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Prunus mume]
Length=322

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 148/323 (46%), Positives = 203/323 (63%), Gaps = 16/323 (5%)
 Frame = +3

Query  231   NGLQDMQKAWYYEEHGPK-EVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFK-----LR  389
             + +  + KAW Y E+G   +VLK      +P  + DQ+L++V AA+LNPIDFK      +
Sbjct  7     DSIPSVNKAWVYSEYGQSADVLKFDPSVAVPEIKEDQVLIKVVAASLNPIDFKRMLGYFK  66

Query  390   QTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFT  569
             +    P     +PG D+AG+VV  G  VTKF +GDEVYG++ N N     K+ G+LAE+T
Sbjct  67    EIDSTPHT---VPGYDVAGVVVKVGRQVTKFKVGDEVYGDL-NENALVNPKKFGSLAEYT  122

Query  570   VVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql  749
              VEETL+A+KP+NL+F  AASLP+AI+TA +G   A    G+S+      GG G +   +
Sbjct  123   TVEETLLAVKPENLSFAEAASLPVAIETAYEGLEGAEISAGKSI---LVLGGTGGVGTHV  179

Query  750   aKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV  929
              +HV+GAS VAATTS  K+++++ LGAD  +DYT   +E +PE +D+VYD +G S  +  
Sbjct  180   IQHVFGASRVAATTSTKKLDWLRSLGADLAIDYTKDNFEDLPENFDVVYDAVGQSDRAMK  239

Query  930   VAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVV  1109
               +E   ++ +   P  P A    LT SG ILEKL P+LESGKVK VIDP GP  F   +
Sbjct  240   EVEERGKVVAVV-DPITPPAFMFTLTSSGSILEKLNPYLESGKVKVVIDPNGPCPFSKTL  298

Query  1110  EAFGYIE-TGRARGKVVISPFPS  1175
             EAF YIE + RA GKVV+ P PS
Sbjct  299   EAFAYIEASSRAIGKVVVYPIPS  321



>gb|AFK40629.1| unknown [Medicago truncatula]
Length=320

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 151/311 (49%), Positives = 205/311 (66%), Gaps = 6/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTSLVPMNFP  419
             KAW Y ++G  +E+LK   +   P P+ DQ+L++V AAALNP+D K  L     +    P
Sbjct  12    KAWVYSQYGNIEEILKFDSNVPTPHPKEDQVLIKVVAAALNPVDIKRALGHFKDIDSPLP  71

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV+ G  V KF +GD VYG+I+   L    K +GTL+E+TV EE ++A K
Sbjct  72    TVPGYDVAGVVVSVGEQVKKFKVGDGVYGDINETTLHNP-KTIGTLSEYTVAEEKVLAHK  130

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P NL+F  AASLPLAI TA QG     F  G+S+ ++GGAGGVGSL +QLAKHV+ AS +
Sbjct  131   PSNLSFVEAASLPLAIITAYQGLERVEFSSGKSLLVLGGAGGVGSLVIQLAKHVFEASRI  190

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT S  K++F++ LGAD  +DYT   YE++ E +D+VYD +GDS  +   A E   ++ 
Sbjct  191   AATASTTKLDFLRKLGADFAIDYTKENYEELTEKFDVVYDAVGDSERAVKAANEGGKVVT  250

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I  PP  P A+   LT  G +LEKL+P+LE+GKVK ++DP  PF F   +EAF Y+ T R
Sbjct  251   I-LPPGTPPAIPFLLTSDGAVLEKLQPYLENGKVKPILDPKSPFPFYQTLEAFSYLNTNR  309

Query  1140  ARGKVVISPFP  1172
             A GK+VI P P
Sbjct  310   AIGKIVIHPIP  320



>ref|XP_004515401.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Cicer arietinum]
Length=317

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 158/312 (51%), Positives = 211/312 (68%), Gaps = 8/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGPK-EVLKLGDFLIPVP--QHDQLLVQVQAAALNPIDFKLRQTSLVPMN--F  416
             KAW Y E+G   +VLK  D  +P+P  + DQ+L++V AA+LNPID+K  +      +   
Sbjct  9     KAWSYSEYGHSIDVLKF-DPNVPLPDVKDDQVLIKVAAASLNPIDYKRMEGGFKNSDSPL  67

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P  PG D++G+VV  GS V KF +GDEVYG+I+   LE   K +G+LAE+T  EE L+A 
Sbjct  68    PTAPGYDVSGVVVKVGSEVKKFKVGDEVYGDINGSALEYP-KVIGSLAEYTAAEEKLLAH  126

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KPKNLTF  AASLPL I+TA +G +   F   +S+ ++GGAGGVG+  +QLAKHV+GAS 
Sbjct  127   KPKNLTFPEAASLPLTIETAYEGLQRTDFSANKSILVLGGAGGVGTHVIQLAKHVFGASK  186

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             VAAT+S  K+  ++ LGAD  +DYT   +E +PE +D+V+DT+G++  +F   KE   ++
Sbjct  187   VAATSSTGKLGLLRKLGADLPIDYTKDNFEDLPEKFDVVFDTVGETERAFKALKEGGKVV  246

Query  957   DITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
              I  PP  P A+   L  +G ILEKL P+LESGKVKAV+DP  PF F   VEAF Y+ETG
Sbjct  247   TIV-PPGFPPAIFFLLPSNGAILEKLNPYLESGKVKAVLDPKSPFPFSQSVEAFSYLETG  305

Query  1137  RARGKVVISPFP  1172
             RA GKVVI P P
Sbjct  306   RATGKVVIHPIP  317



>gb|AAA87182.1| auxin-induced protein [Vigna radiata]
Length=317

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 208/312 (67%), Gaps = 8/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK--LRQTSLVPMNF  416
             +AW Y E+G  +EVLK  D  +P P    +Q+L++V AAA+NP+D+K  L     +    
Sbjct  9     RAWIYSEYGNIEEVLKF-DPNVPTPHLMENQVLIKVVAAAINPVDYKRALGHFKDIDSPL  67

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P  PG D+AG+VV  G+ V KF +GDEVYG+I+   L+   K +G+LAE+T VEE ++A 
Sbjct  68    PTAPGYDVAGVVVKVGNQVKKFQVGDEVYGDINEVTLD-HPKTIGSLAEYTAVEEKVLAH  126

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KP NL+F  AASLPLAI TA QG  TA F  G+S+ ++GGAGGVGSL +Q+AKH++GAS 
Sbjct  127   KPSNLSFVEAASLPLAIITAYQGLETAQFSVGKSILVLGGAGGVGSLVIQIAKHIFGASK  186

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             +AAT S  K+E  + LG D  +DYT   +E++ E +D+VYD +G S  +    KE   ++
Sbjct  187   IAATGSTGKLELFENLGTDLPIDYTKENFEELAEKFDVVYDAVGQSERALKSVKEGGKVV  246

Query  957   DITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
              I   P+ P A+   LT  G++LEKL+P+LE+G+VK ++DP  PF F   VEAF Y++T 
Sbjct  247   TIVA-PATPPAIPFLLTSDGDLLEKLRPYLENGQVKPILDPKSPFPFSQTVEAFSYLKTN  305

Query  1137  RARGKVVISPFP  1172
             RA GKVVI P P
Sbjct  306   RATGKVVIYPIP  317



>ref|XP_010029190.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Eucalyptus 
grandis]
 gb|KCW56038.1| hypothetical protein EUGRSUZ_I01800 [Eucalyptus grandis]
Length=322

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 206/311 (66%), Gaps = 6/311 (2%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFP--  419
             KAW Y E G P +VL+L  D  +P  + DQ+LV+V AAALN ID K  +  L   + P  
Sbjct  14    KAWVYAELGNPNDVLELVSDVRVPEIKEDQVLVKVVAAALNIIDAKRARGFLKDDDSPPP  73

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
             ++PG D+AG+VV  G  V KF +GDEVYG+I+  +L    K+ GTLAE+T VEE L+A+K
Sbjct  74    IVPGYDVAGVVVKVGDQVKKFKVGDEVYGDINEISLV-RPKQHGTLAEYTAVEERLLALK  132

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL+F  AASLPL I+TA +G     F  G+S+ ++GGAGG+GSL +QLAK V+GAS V
Sbjct  133   PKNLSFAEAASLPLVIETAYEGLERTHFSPGKSILVLGGAGGIGSLVIQLAKQVFGASRV  192

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K++ ++ LGAD  +DYT   +E +PE +D+VYD IG S  +    KE  +++ 
Sbjct  193   AATSSTGKLDLLRSLGADLAIDYTKENFEDLPEKFDVVYDAIGQSERAIHGVKEGGSVVT  252

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             +  P + P A    +T  G ILEKL PFLES  +K V+DP G F F  V+EA  ++ETGR
Sbjct  253   VGGPVTPP-AFKFHVTSKGSILEKLNPFLESQIIKPVLDPKGTFPFSRVLEAISHLETGR  311

Query  1140  ARGKVVISPFP  1172
               GK+VI P P
Sbjct  312   PAGKIVIYPIP  322



>ref|XP_010108764.1| Quinone oxidoreductase-like protein [Morus notabilis]
 gb|EXC20279.1| Quinone oxidoreductase-like protein [Morus notabilis]
Length=323

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 203/315 (64%), Gaps = 12/315 (4%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPM--N  413
             + KAW Y  +G    +   +  + VPQ   +Q+L++V AA+LNPID+K R   L+     
Sbjct  15    VNKAWIYSVYGKSSDILRFEENVDVPQITDNQVLIKVVAASLNPIDYK-RMHGLLKHADT  73

Query  414   FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELK--RMGTLAEFTVVEETL  587
              P++PG D+AG+VV  GS V KF +GDEVYG+I   N  G  K  + GTLAE+T   E +
Sbjct  74    LPIVPGFDVAGVVVKAGSQVKKFKVGDEVYGDI---NESGSSKPAQFGTLAEYTAASEKV  130

Query  588   VAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYG  767
             +A+KPKNL+F  AASLPLAI+TA +G        G+SV ++GGAGGVG+  +QLAKHV+G
Sbjct  131   IALKPKNLSFVEAASLPLAIETAYEGLERGELSAGKSVLVLGGAGGVGTHIIQLAKHVFG  190

Query  768   ASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENA  947
             AS VAAT S  K++ ++ LGAD  +DYT   +E +PE +D+VYDT+G +     V KE  
Sbjct  191   ASKVAATASTAKLDLLRSLGADLAIDYTKENFEDLPEKFDVVYDTVGQADRGLKVVKEGG  250

Query  948   TIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYI  1127
              ++ I  P   P A+   L  +G  LEKL+P+LESGK+K +IDP G F     VEA+ Y+
Sbjct  251   KVVSIVGPA--PGAISFFLNSTGSTLEKLEPYLESGKIKPLIDPKGQFPLSKAVEAYAYL  308

Query  1128  ETGRARGKVVISPFP  1172
             ET RA GK+VI P P
Sbjct  309   ETSRATGKIVIYPIP  323



>gb|KHN23541.1| Quinone oxidoreductase-like protein, chloroplastic [Glycine soja]
Length=322

 Score =   249 bits (636),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 153/313 (49%), Positives = 208/313 (66%), Gaps = 8/313 (3%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVP--QHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             KAW Y E+G  E +   +  IP+P  + DQ+L++V AAALNPID+K     L   +  FP
Sbjct  12    KAWVYSEYGNTEEILKFESNIPIPDIKEDQVLIKVVAAALNPIDYKRAHGFLKNTDSPFP  71

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV  GS V+KF +GD VYG+I N +     K +G+LAE+T VEE ++A K
Sbjct  72    TVPGYDVAGVVVKVGSQVSKFKVGDGVYGDI-NEDPVNNPKAIGSLAEYTAVEEKVLAHK  130

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P NL+F  AASLPLAI TA QGF    F  G+S+ ++GGAGGVGSL +QLAKHV+GAS V
Sbjct  131   PSNLSFVEAASLPLAIITAYQGFEKVEFSAGKSILVLGGAGGVGSLVIQLAKHVFGASKV  190

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDS--INSFVVAKENATI  953
             AAT S  K++ ++ LGAD  +DYT   +E++ E +D+VYDT+G+S    +    KE+  +
Sbjct  191   AATASTAKLDLLRNLGADLAIDYTKENFEELEEKFDVVYDTVGESETEKALKAVKESGKV  250

Query  954   IDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIET  1133
             + I     +P A+       G +LEKLKP+LESGKVK ++DP  P+ F   VEAF +++T
Sbjct  251   VTIVR-FGHPEAIFFIRISDGTVLEKLKPYLESGKVKPILDPKSPYPFSQTVEAFAHLKT  309

Query  1134  GRARGKVVISPFP  1172
              RA GKVVI P P
Sbjct  310   NRAIGKVVIHPIP  322



>ref|XP_003553854.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Glycine max]
Length=322

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 153/313 (49%), Positives = 208/313 (66%), Gaps = 8/313 (3%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVP--QHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             KAW Y E+G  E +   +  IP+P  + DQ+L++V AAALNPID+K     L   +  FP
Sbjct  12    KAWAYSEYGNTEEILKFESNIPIPDIKEDQVLIKVVAAALNPIDYKRAHGFLKNTDSPFP  71

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV  GS V+KF +GD VYG+I N +     K +G+LAE+T VEE ++A K
Sbjct  72    TVPGYDVAGVVVKVGSQVSKFKVGDGVYGDI-NEDPVNNPKAIGSLAEYTAVEEKVLAHK  130

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P NL+F  AASLPLAI TA QGF    F  G+S+ ++GGAGGVGSL +QLAKHV+GAS V
Sbjct  131   PSNLSFVEAASLPLAIITAYQGFEKVEFSAGKSILVLGGAGGVGSLVIQLAKHVFGASKV  190

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDS--INSFVVAKENATI  953
             AAT S  K++ ++ LGAD  +DYT   +E++ E +D+VYDT+G+S    +    KE+  +
Sbjct  191   AATASTAKLDLLRNLGADLAIDYTKENFEELEEKFDVVYDTVGESETEKALKAVKESGKV  250

Query  954   IDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIET  1133
             + I     +P A+       G +LEKLKP+LESGKVK ++DP  P+ F   VEAF +++T
Sbjct  251   VTIVR-FGHPEAIFFIRISDGTVLEKLKPYLESGKVKPILDPKSPYPFSQTVEAFAHLKT  309

Query  1134  GRARGKVVISPFP  1172
              RA GKVVI P P
Sbjct  310   NRAIGKVVIHPIP  322



>gb|KDP45353.1| hypothetical protein JCGZ_09602 [Jatropha curcas]
Length=321

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 209/315 (66%), Gaps = 9/315 (3%)
 Frame = +3

Query  249   QKAWYYEEHG--PKEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--  413
             QKAW Y E+G    ++LKL  D  +P  + DQ+L++V AAALNPIDFK         +  
Sbjct  9     QKAWVYREYGNSAADILKLDTDIAVPEIKEDQVLIKVVAAALNPIDFKRFAGWFKATDSP  68

Query  414   FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVA  593
              P +PG D+AG+VV  G+ V KF +GDEVYGNI N +     K+ G++AE+T VEE L+A
Sbjct  69    LPTVPGYDVAGVVVKVGNQVRKFKVGDEVYGNI-NEDPVNHPKQFGSVAEYTAVEEKLLA  127

Query  594   MKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGAS  773
              KP+NL F  A+SLPLAI+TA  G    GF  G+S+ ++GGAGGVG+LA+Q+AK+V+GAS
Sbjct  128   FKPENLNFAEASSLPLAIETAYGGLEKVGFLGGKSILVLGGAGGVGTLAIQVAKNVFGAS  187

Query  774   SVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATI  953
              +AAT S  K++ +K LG D  +DYT   YE +PE +D+V+DT+G+   +    K   ++
Sbjct  188   RIAATASTGKLDLLKSLGVDLPIDYTKEKYEHLPEKFDVVFDTVGEVERAVKAVKGGGSV  247

Query  954   IDITWP--PSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYI  1127
             + I  P  PS P A   G +  G +LEKLKP+LESGKVK ++DP GPF F    +AF ++
Sbjct  248   VAIAGPLNPS-PPAFFFGESSDGAMLEKLKPYLESGKVKPILDPKGPFPFSQAKDAFVHL  306

Query  1128  ETGRARGKVVISPFP  1172
             +T RA GKVV+ P P
Sbjct  307   QTNRAIGKVVVYPIP  321



>ref|XP_010530541.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic 
[Tarenaya hassleriana]
Length=382

 Score =   249 bits (635),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 205/310 (66%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  EVLKL  +  +P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  75    KAWLYGEYGGVEVLKLESNVAVPEFKEDQVLLKVVAAALNPVDAKRRQGKFKATDSPLPT  134

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  G  V +   GDEVYGNI    LEG  K+ G+LAE+T  EE L+A+KP
Sbjct  135   VPGYDVAGVVVKVGKAVKELKEGDEVYGNISEKALEGP-KQFGSLAEYTAAEEKLLALKP  193

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN++F  AA LPLAI+TA +G +  GF  G+S+ ++ GAGGVGSL +QLAK VYGAS VA
Sbjct  194   KNISFAEAAGLPLAIETADEGLQRTGFSSGKSILVLNGAGGVGSLVIQLAKQVYGASKVA  253

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E ++ LGAD  +DYT   +E +P+ +D+V+D IG    +  V KE  +++ +
Sbjct  254   ATASTGKLELLRSLGADLAIDYTKDNFEDLPDKFDVVFDAIGMCERAVKVVKEGGSVVAL  313

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +GE+L+KL P+LESGKVK V+DP  PF F N  +AF Y+ET  A
Sbjct  314   TGAVTPP-GFRFVVTSNGEVLKKLNPYLESGKVKPVVDPKAPFPFSNAADAFSYLETNHA  372

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  373   TGKVVVYPIP  382



>ref|XP_006844972.1| hypothetical protein AMTR_s00058p00182650 [Amborella trichopoda]
 gb|ERN06647.1| hypothetical protein AMTR_s00058p00182650 [Amborella trichopoda]
Length=390

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 149/311 (48%), Positives = 209/311 (67%), Gaps = 5/311 (2%)
 Frame = +3

Query  249   QKAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             QKAW+YE++G  EVLK G+ + +P  + DQ+L++V AAALNP+D K RQ      +   P
Sbjct  82    QKAWFYEDYGGGEVLKFGEQVEVPEIKEDQVLLKVVAAALNPVDAKRRQGKFKATDSPLP  141

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D++G+VV  GS V     GDEVYGNI+   LE +LK+ G+LA+FT VEE L+A+K
Sbjct  142   TVPGYDVSGVVVKVGSQVKGLKEGDEVYGNINEKALE-DLKQYGSLAQFTAVEEKLLALK  200

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PK++ F  AA LPL I+TA  G    GF  G+S+ ++GGAGGVG++ +QLAK V+GAS V
Sbjct  201   PKSIDFLQAAGLPLVIETAYGGLERTGFSAGKSILVLGGAGGVGTMVIQLAKQVFGASKV  260

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             A+T S  K+E +K LG +  +DYT   +E + E +D+VYD +G    +    KE  +++ 
Sbjct  261   ASTASTKKLELLKSLGVEVAIDYTKQNFEDLTEKFDVVYDAVGQCERAVKAVKEGGSVVA  320

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             +T   ++P      +T  G +L+KL PFLE+GK+K V+DPAGPF F  V +AF ++ETGR
Sbjct  321   LTGAVTSP-GFRFVVTSKGSVLDKLNPFLEAGKIKPVVDPAGPFPFSKVPDAFSHLETGR  379

Query  1140  ARGKVVISPFP  1172
             A GKVVI P P
Sbjct  380   ATGKVVIYPIP  390



>ref|XP_003553850.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Glycine max]
 gb|KHN23540.1| Quinone oxidoreductase-like protein, chloroplastic [Glycine soja]
Length=320

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 203/311 (65%), Gaps = 6/311 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVP--QHDQLLVQVQAAALNPIDFK--LRQTSLVPMNFP  419
             K W Y E+G  E +   D  +P+P  + DQ+L++V A ALNP+D+K  L          P
Sbjct  12    KTWVYSEYGNTEEILKFDPNVPIPDIKEDQVLIKVVATALNPVDYKRALGYFKNTDSPLP  71

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV  GS V KF +GDEVYG+I+ + +    K +GTLAE+T  EE L+A K
Sbjct  72    SVPGYDVAGVVVRVGSKVRKFKVGDEVYGDINEYAVNNP-KTIGTLAEYTATEEKLLAHK  130

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P NL+F  AASLPLAI TA QG     F  G+S+ ++GGAGGVGSL +QLAKHV+GAS V
Sbjct  131   PSNLSFIEAASLPLAIITAYQGLERVDFSAGKSILVLGGAGGVGSLVIQLAKHVFGASKV  190

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT S+ K++ ++ LGAD  +DYT   +E++ E +D+VYDTIG S  +    KE   ++ 
Sbjct  191   AATASSAKLDLLRNLGADFPIDYTKENFEELAEKFDVVYDTIGQSDKALKAIKEGGKVVT  250

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             I  P + P      LT  G +LEKL+P LESGKVK V+DP  PF F  +VEA+ Y++T R
Sbjct  251   IAPPATPPAIPFF-LTSDGAVLEKLQPHLESGKVKPVLDPKSPFPFSQIVEAYSYLKTNR  309

Query  1140  ARGKVVISPFP  1172
             A GKVVI P P
Sbjct  310   AIGKVVIHPIP  320



>ref|XP_010533157.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic 
[Tarenaya hassleriana]
Length=440

 Score =   248 bits (633),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 205/310 (66%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  EVLKL  +  +P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  133   KAWLYGEYGGVEVLKLESNVAVPEFKEDQVLLKVVAAALNPVDAKRRQGKFKATDSPLPT  192

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  G  V +   GDEVYGNI    LEG  K+ G+LAE+T  EE L+A+KP
Sbjct  193   VPGYDVAGVVVKVGKAVKELKEGDEVYGNISEKALEGP-KQFGSLAEYTAAEEKLLALKP  251

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN++F  AA LPLAI+TA +G +  GF  G+S+ ++ GAGGVGSL +QLAK VYGAS VA
Sbjct  252   KNISFAEAAGLPLAIETADEGLQRTGFSSGKSILVLNGAGGVGSLVIQLAKQVYGASKVA  311

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E ++ LGAD  +DYT   +E +P+ +D+V+D IG    +  V KE  +++ +
Sbjct  312   ATASTGKLELLRSLGADLAIDYTKDNFEDLPDKFDVVFDAIGMCERAVKVVKEGGSVVAL  371

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +GE+L+KL P+LESGKVK V+DP  PF F N  +AF Y+ET  A
Sbjct  372   TGAVTPP-GFRFVVTSNGEVLKKLNPYLESGKVKPVVDPKAPFPFSNAADAFSYLETNHA  430

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  431   TGKVVVYPIP  440



>gb|KHN27525.1| Quinone oxidoreductase-like protein, chloroplastic [Glycine soja]
Length=313

 Score =   243 bits (621),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 203/313 (65%), Gaps = 16/313 (5%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQ----TSLVPMN  413
             KAW Y E+G  KEVLK    + +P  + DQ+L++V AA+LNPID K  +     S  P+ 
Sbjct  11    KAWTYSEYGKSKEVLKFNQSVALPEVKEDQVLIKVAAASLNPIDHKRMEGYFKNSDSPL-  69

Query  414   FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVA  593
              P  PG D+AG+VV  GS V KF +GDEVYG+I+   LE   K +G+LAE+T  EE L  
Sbjct  70    -PTAPGYDVAGVVVKVGSEVKKFKVGDEVYGDINVKALEYP-KVIGSLAEYTAAEERL--  125

Query  594   MKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGAS  773
                 NL+F  AASLPL ++TA +G    GF  G+S+ ++GGAGGVG+  +QLAKHVYGAS
Sbjct  126   ----NLSFAEAASLPLTLETAYEGLERTGFSAGKSILVLGGAGGVGTHVIQLAKHVYGAS  181

Query  774   SVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATI  953
              VAAT S  K+E ++ LGAD  +DYT   +E + E +D+VYDT+G +  +F V KE   +
Sbjct  182   KVAATASTRKLELLRNLGADWPIDYTKENFEDLSEKFDVVYDTVGQTEQAFKVLKEGGKV  241

Query  954   IDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIET  1133
             + I  P  +P A+   L+  G ILEKL P+ ESGK+K ++DP  PF F   VEAF ++ET
Sbjct  242   VTIVPPGFHP-AILFILSTDGAILEKLNPYFESGKLKPILDPKSPFPFSQTVEAFAHLET  300

Query  1134  GRARGKVVISPFP  1172
              RA GK+V+ P P
Sbjct  301   NRATGKIVVYPIP  313



>ref|XP_010498879.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic 
[Camelina sativa]
Length=388

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 153/309 (50%), Positives = 201/309 (65%), Gaps = 5/309 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +P    DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  81    KAWVYGEYGGVDVLKLESNIAVPEISEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  140

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D++G+VV  GS V  F  GDEVYG++    LEG  K+ G+LAE+T VEE L+ +KP
Sbjct  141   VPGYDVSGVVVKVGSAVKDFKEGDEVYGDVSEKALEGP-KQFGSLAEYTAVEEKLLGLKP  199

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL +QLAKHVYGAS VA
Sbjct  200   KNIDFVQAAGLPLAIETADEGLVRTEFSAGKSILVLNGAGGVGSLVIQLAKHVYGASKVA  259

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E VK LGAD  +DYT    E +P+ YD+V+D IG    +  V KE   ++ +
Sbjct  260   ATASTGKLELVKSLGADLAIDYTKENIEDLPDKYDVVFDAIGMCDKAVKVIKEGGKVVAL  319

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +GE+L+KL P++ESGKVK V+DP GPF F  V EAF Y+ET  A
Sbjct  320   TGAVTPP-GFRFVVTSNGEVLKKLNPYIESGKVKPVVDPKGPFPFSRVAEAFTYLETNHA  378

Query  1143  RGKVVISPF  1169
              GKVV+ P 
Sbjct  379   TGKVVVYPI  387



>ref|XP_002893304.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69563.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=386

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 202/310 (65%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  D  +P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  79    KAWVYSEYGGVDVLKLESDIAVPEVKEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  138

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  G+ V  F  GDEVY N+    LEG  K+ G+L E+T VEE L+A+KP
Sbjct  139   VPGYDVAGVVVKVGAAVKDFKEGDEVYANVSEKALEGP-KQFGSLGEYTAVEEKLLALKP  197

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL +QLAKHVYGAS VA
Sbjct  198   KNIDFAQAAGLPLAIETADEGLVRTEFSAGKSILVLNGAGGVGSLVIQLAKHVYGASKVA  257

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E V+ LGAD  +DYT    E +P+ YD+V+D IG    +  V KE   ++ +
Sbjct  258   ATASTGKLELVRSLGADLAIDYTKENIEDLPDKYDVVFDAIGMCDKAVKVIKEGGKVVAL  317

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +G++L+KL P++ESG+VK V+DP GPF F  V +AF Y+ET  A
Sbjct  318   TGAVTPP-GFRFVVTSNGDVLKKLNPYIESGEVKPVVDPKGPFPFSRVADAFSYLETNHA  376

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  377   TGKVVVYPIP  386



>ref|XP_004489907.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Cicer arietinum]
Length=328

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 217/324 (67%), Gaps = 9/324 (3%)
 Frame = +3

Query  219   STEPN-GLQDMQKAWYYEEHG-PKEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFKLR  389
             ST+P   +    KAW+Y EHG P ++LKL  ++ IP  + +Q+L++V A +LNP+D+K R
Sbjct  8     STDPTTNIPTHTKAWFYSEHGKPTDILKLHPNWSIPQLKDNQVLIKVVAVSLNPVDYK-R  66

Query  390   QTSL---VPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLA  560
               +L      + P++PG D++GIVV  G  V KF +GDEVYG+I+   L   LK +GTL+
Sbjct  67    MHALFKDTDPHLPIVPGFDVSGIVVKVGFKVVKFKVGDEVYGDINEEGLSN-LKILGTLS  125

Query  561   EFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgsla  740
             E+T+ EE L+A KP NL+F  AAS+PLAI+TA +G   A    G+S+ ++GGAGGVGS A
Sbjct  126   EYTIAEERLLAHKPNNLSFIEAASIPLAIETAYEGLERAQLSPGKSILVLGGAGGVGSFA  185

Query  741   vqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN  920
             +QLAKHVYGAS +AAT+S  K+  ++ LG D  +DYT   +E +P+ +D+VYDT+G+   
Sbjct  186   IQLAKHVYGASEIAATSSTGKLHLLRELGVDLPIDYTKDNFEDLPQKFDVVYDTVGEVDR  245

Query  921   SFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFC  1100
             +    KE   ++ I  PP  P A+   LT  G ILEKL+P+ ESG++K ++DP  P  F 
Sbjct  246   AMKAIKEGGKVVTIV-PPGFPPALFFVLTSKGSILEKLRPYFESGQLKPILDPKTPIPFS  304

Query  1101  NVVEAFGYIETGRARGKVVISPFP  1172
              V+EA+ Y+ET RA GKVVI P P
Sbjct  305   EVIEAYSYLETSRATGKVVIYPIP  328



>emb|CDP10913.1| unnamed protein product [Coffea canephora]
Length=324

 Score =   241 bits (616),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 153/323 (47%), Positives = 215/323 (67%), Gaps = 6/323 (2%)
 Frame = +3

Query  219   STEPNGLQDMQKAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ  392
             ++ P  +    KAW Y ++G P++VL+L  +  +P    +Q+L++V AA+LNP+D K+  
Sbjct  3     TSTPVRIPSKMKAWVYGQYGKPEDVLRLESEVDVPEVNDEQVLIKVAAASLNPVDIKIMA  62

Query  393   TSLVPMNFPV--IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEF  566
                   + PV  + G D+AG+VV  GS V +F++GDEVYG+IH   L    K  G+L+E+
Sbjct  63    GLFKATDSPVPTVAGYDVAGVVVKVGSKVKEFNVGDEVYGDIHEHALNNP-KGSGSLSEY  121

Query  567   TVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavq  746
               VEE +VA+KPKNL+F  AASLPLA++TA  G   AGF  GQS+ ++GGAGGVGSL VQ
Sbjct  122   AAVEEKVVALKPKNLSFAEAASLPLAVETAYGGLERAGFSAGQSILVLGGAGGVGSLVVQ  181

Query  747   laKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSF  926
             LAKHV+GAS VAAT+SA K+E ++ LGAD  +DY    YE +P+ +D+VYDT+G+S    
Sbjct  182   LAKHVFGASKVAATSSAGKLELLQVLGADLAIDYKKDKYEDMPKKFDVVYDTVGESGRGN  241

Query  927   VVAKENATIIDIT-WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCN  1103
                KE  +++ I    P  P A    +T +G +L +LKPF+E  K+K VIDP  PF F +
Sbjct  242   KAVKEGGSVVTIVGGTPVVPPAFVFEVTSTGTVLNRLKPFIEEEKLKPVIDPKSPFPFSH  301

Query  1104  VVEAFGYIETGRARGKVVISPFP  1172
              +EAF +++TGRA GKVVI P P
Sbjct  302   TIEAFSHLQTGRATGKVVIYPIP  324



>ref|XP_010029197.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Eucalyptus 
grandis]
 gb|KCW56048.1| hypothetical protein EUGRSUZ_I01803 [Eucalyptus grandis]
Length=308

 Score =   239 bits (609),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 202/316 (64%), Gaps = 18/316 (6%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDF-KLRQTSLVP-MNFP  419
             KAW Y EHG   +VL L  +  +P  Q  Q+LV+V AAALNPID  +++    +P  + P
Sbjct  2     KAWVYREHGDVADVLGLDPELKVPELQEGQVLVKVLAAALNPIDTARVKGVIKLPGFSLP  61

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV  G  V +  +GD+VYG + +       K+ G+LAE+  VEE+ +A+K
Sbjct  62    AVPGYDLAGVVVKVGREVKELKVGDDVYGFMWH------AKKDGSLAEYAAVEESFLALK  115

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PK L+F+ AASLP+ IQTA  G   AG   G+S+ ++GGAGGVG+L +QLAK V+GAS V
Sbjct  116   PKKLSFEEAASLPVVIQTAYGGLERAGLSHGKSLLVLGGAGGVGTLVIQLAKEVFGASRV  175

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYDT+G S  +    K   +++ 
Sbjct  176   AATSSTGKLELLKSLGADLAIDYTKVNFEDLPEKFDVVYDTVGQSERAAKAVKPGGSMVT  235

Query  960   I-----TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGY  1124
             I     T PP    A     T     LEKLKPFLESGKVK +IDP  PF F   +EAF Y
Sbjct  236   IVEHNKTLPPP---AFFFAATSDRLTLEKLKPFLESGKVKPLIDPKSPFPFSQAIEAFSY  292

Query  1125  IETGRARGKVVISPFP  1172
             ++TGRA GKVVI P P
Sbjct  293   LQTGRATGKVVIHPVP  308



>ref|XP_010029188.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Eucalyptus 
grandis]
 gb|KCW56037.1| hypothetical protein EUGRSUZ_I01799 [Eucalyptus grandis]
Length=336

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 152/327 (46%), Positives = 204/327 (62%), Gaps = 24/327 (7%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK-----LRQTSLVPM  410
             KAW Y EHG P  VL L  D  +P  + DQ+LV+V AAALNP+D K      R     P 
Sbjct  14    KAWLYAEHGNPVNVLTLDSDVRVPEIKEDQVLVKVVAAALNPVDAKRALGFFRDADSSP-  72

Query  411   NFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLE-----GEL--------KRMG  551
               P++PG D+AG+VV  G  V KF IGDEVYG ++  +L+     G++        K+ G
Sbjct  73    --PIVPGYDVAGVVVKVGDQVKKFKIGDEVYGAVNEKSLDQDEVYGDINDKSLDRPKQHG  130

Query  552   TLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvg  731
             T+AE+  VE+ L+A+KPKNL+F  AASLP AI+TA +G     F  G+S+ ++GGAGGVG
Sbjct  131   TMAEYNAVEDRLLALKPKNLSFVEAASLPAAIETAYEGLERTRFSSGKSILVLGGAGGVG  190

Query  732   slavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD  911
             SL +QLAK V+GAS VAAT+S  K++ +K LGAD  +DYT   +E + E +D+VYD +G 
Sbjct  191   SLVIQLAKEVFGASRVAATSSTGKLDLLKSLGADSAIDYTKENFEDLSEKFDVVYDAVGQ  250

Query  912   SINSFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPF  1091
             + ++    KE  +++       NP A    L   G ILEKL PF+ES K+K VIDP G F
Sbjct  251   TESAIRAVKEGGSVV-TVVGGVNPPAFKFFLASKGSILEKLNPFIESQKIKPVIDPRGTF  309

Query  1092  HFCNVVEAFGYIETGRARGKVVISPFP  1172
              F  V+EAF Y+ TGR  G++VI   P
Sbjct  310   SFSRVLEAFSYLGTGRVTGEIVIHSIP  336



>ref|XP_001761154.1| predicted protein [Physcomitrella patens]
 gb|EDQ73876.1| predicted protein [Physcomitrella patens]
Length=314

 Score =   238 bits (607),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 146/313 (47%), Positives = 203/313 (65%), Gaps = 10/313 (3%)
 Frame = +3

Query  246   MQKAWYYEEHGP-KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--F  416
             + KAW Y E GP K+VLK  +  +P  + +Q+L++V+AAA+NP+D K R   L   +   
Sbjct  6     VHKAWVYHELGPAKDVLKFEEVAVPEVKPNQVLIKVKAAAINPVDNKRRTGYLGDKDSPL  65

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P++PG D AG+VV  G   +KF++ DEVYG      +    K+ GTLA +T  E+  +A+
Sbjct  66    PIVPGYDCAGVVVKLGDQASKFEVDDEVYGMTSEIPVV-HPKQWGTLASYTACEDKFLAL  124

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KPKNL+F+ AASLPLAI TA +G + AG +EG++V ++GG+GGVG+  +Q+AKHV  A+ 
Sbjct  125   KPKNLSFEEAASLPLAILTATEGLQKAGCEEGKTVLVLGGSGGVGTHVIQVAKHVLKAAH  184

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFV-VAKENATI  953
             V  T S+ K EF+K LGAD+V+DY +T Y Q PE YD+VYDT+G+     V V K+   +
Sbjct  185   VTTTGSSKKTEFLKNLGADEVLDYHSTDYTQKPERYDVVYDTVGEGPTKGVKVLKDGGVL  244

Query  954   IDI-TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
             + I T  P+    V S      E+LE L P+LESG VK +IDP G F F  VV+A+ Y+E
Sbjct  245   VSILTKDPAFRHVVQS----KAEVLEMLNPYLESGAVKPIIDPEGRFKFSEVVQAYEYLE  300

Query  1131  TGRARGKVVISPF  1169
              G A GKV ISP 
Sbjct  301   AGHATGKVTISPI  313



>gb|EPS71691.1| alcohol dehydrogenase [Genlisea aurea]
Length=301

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 149/314 (47%), Positives = 198/314 (63%), Gaps = 21/314 (7%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y ++G  +VLKL  DF +P  + DQ+L++V AAALNP+DFK R       +   P 
Sbjct  2     KAWAYHQYGGLDVLKLEVDFPLPEIKDDQVLIKVVAAALNPVDFKRRLGYFKATDSQLPT  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             IPG D+AG+VV  G  V +F  GDEVYG+     +  E +  GTLAE+T+ EE L+A KP
Sbjct  62    IPGLDVAGVVVNVGRQVKQFKEGDEVYGDAIE-KVITEPRNYGTLAEYTISEERLLAHKP  120

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AASLP+AI+TA      AG  EG+S+ ++GGAGG+GSLA+QL K V+ AS VA
Sbjct  121   KNLDFVQAASLPVAIETAYGALEKAGLSEGKSLLVLGGAGGIGSLAIQLGKEVFKASRVA  180

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K++F++ LGAD  +DYT  ++EQ+ E +D++YDT+G         +     ID 
Sbjct  181   ATASTGKLDFIRSLGADLAIDYTKESFEQLAEKFDVIYDTVG-------FKRRRLGSID-  232

Query  963   TWPPSNPRAVHSG----LTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
                    R   +G    L   GE+L+KL P+ ESGK+K +IDP GPF F    EAF Y+E
Sbjct  233   -----RRRDSAAGFFFVLNSDGEVLKKLNPYFESGKLKPIIDPKGPFPFHKADEAFAYLE  287

Query  1131  TGRARGKVVISPFP  1172
             T RA GKVV+ P P
Sbjct  288   TNRAVGKVVVYPVP  301



>gb|EPS71670.1| quinone oxidoreductase-like protein, partial [Genlisea aurea]
Length=322

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 204/316 (65%), Gaps = 13/316 (4%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFKLR----QTSLVPM  410
             + KAW Y ++G  EVLKL  DF +P  + DQ+L++V AAALNP+D+K R    + +  P+
Sbjct  13    IMKAWAYHQYGGIEVLKLEVDFPLPEIKDDQVLIKVVAAALNPVDYKRRLGYYKNTDSPL  72

Query  411   NFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLV  590
               P I G D+AG+VV  GS V +F  GDEVYG++    + G  +  GT+AE+T+ EE L+
Sbjct  73    --PTIVGYDVAGVVVKVGSQVKEFKEGDEVYGDVIEKAVSGP-RNYGTIAEYTIAEERLL  129

Query  591   AMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGA  770
             A KPKNL F  AASLPLA++TA QG   AG  EG+S+ ++GGAGGVGSLA+QL K V+ A
Sbjct  130   AHKPKNLDFVQAASLPLALETAYQGLEKAGLSEGKSLLVLGGAGGVGSLAIQLGKQVFRA  189

Query  771   SSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENAT  950
             S VAAT S  K++ ++ LGAD  +DYT   +E+  E +D+VYD +G+   +    KE   
Sbjct  190   SKVAATASTGKLDLIRSLGADLAIDYTKEKFEESSEKFDVVYDAVGEGDRAVKAIKEGGA  249

Query  951   IIDI--TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGY  1124
              + I    PP     V   LT  G  L+KL P+ ESGK+K ++DP GPF F   VEAF +
Sbjct  250   ALTIASAIPPPGFFFV---LTSDGGTLKKLNPYFESGKLKPIVDPKGPFPFEKTVEAFAH  306

Query  1125  IETGRARGKVVISPFP  1172
             +ET RA GKVVI P P
Sbjct  307   LETNRATGKVVIYPIP  322



>ref|XP_004973313.1| PREDICTED: quinone oxidoreductase-like protein At1g23740, chloroplastic-like 
[Setaria italica]
Length=385

 Score =   239 bits (609),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 159/312 (51%), Positives = 203/312 (65%), Gaps = 9/312 (3%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLR----QTSLVPMNF  416
             KAW Y+ +G   VLK+ +   +P    DQ+LV+V AAALNP+D K R    Q +  P+  
Sbjct  78    KAWAYDAYGDASVLKIDEAAAVPAVGEDQVLVKVVAAALNPVDAKRRAGKFQATDSPL--  135

Query  417   PVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAM  596
             P +PG D+AG+VV  G  V  F  GDEVYG I    LEG  K+ G+LAE+T VEE L+A 
Sbjct  136   PTVPGYDVAGVVVKVGGQVKGFQEGDEVYGMISEKPLEGP-KQSGSLAEYTAVEEKLLAR  194

Query  597   KPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASS  776
             KPK++ F  AA LP+AI TA +G   AG   G+SV ++GGAGGVGSLA+QLAK VYGAS 
Sbjct  195   KPKSIDFAQAAGLPVAILTANEGLEKAGLCAGKSVLVLGGAGGVGSLAIQLAKQVYGASK  254

Query  777   VAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATII  956
             VAAT S  K+E +K LG D  +DYT   +E +P+ YD+V+D +G    +  V KE  +++
Sbjct  255   VAATASTKKIELLKSLGTDVAIDYTKENFEDLPDKYDVVFDAVGQGEKAVKVVKEGGSVV  314

Query  957   DITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETG  1136
              +T     P      +T +G  LEKL P+LESGKVK V+D  GPF F  VVEAF Y+ETG
Sbjct  315   VLTG-AVTPPGFRFVVTSNGSTLEKLNPYLESGKVKPVVDLQGPFPFSKVVEAFSYLETG  373

Query  1137  RARGKVVISPFP  1172
             RA GKVVISP P
Sbjct  374   RATGKVVISPVP  385



>gb|KCW56040.1| hypothetical protein EUGRSUZ_I01801 [Eucalyptus grandis]
Length=291

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 142/275 (52%), Positives = 187/275 (68%), Gaps = 4/275 (1%)
 Frame = +3

Query  348   VQAAALNPIDFKLRQTSLVPMNFP--VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNF  521
             V AA+LNP+DFK        ++ P  ++PG D+AG+VV  G  V KF +GDEVYG+I+  
Sbjct  17    VVAASLNPVDFKRALGFFKDIDSPPPIVPGYDVAGVVVKVGDQVKKFKVGDEVYGDINEK  76

Query  522   NLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSV  701
              L+   K+ GTLAE+T VEE L+A+KPKNL+F  AASLPLAI+TA +G   A F  G+S+
Sbjct  77    ALD-HPKQHGTLAEYTAVEERLLALKPKNLSFIEAASLPLAIETAYEGLERARFSPGKSI  135

Query  702   FIvggaggvgslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPET  881
              ++GGAGGVG+L +QLAK V+GAS VAAT+S  K+E +K LGAD  +DYT   +E +PE 
Sbjct  136   LVLGGAGGVGTLVIQLAKEVFGASRVAATSSTGKLELLKSLGADLAIDYTKENFEDLPEK  195

Query  882   YDLVYDTIGDSINSFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKV  1061
             +D+VYD +G S  +    KE  +++ I    + P AV   LT +G +LEKL PFLES K+
Sbjct  196   FDVVYDAVGQSERAVRAVKEGGSVVTIAG-AATPPAVLFILTSNGSVLEKLNPFLESQKI  254

Query  1062  KAVIDPAGPFHFCNVVEAFGYIETGRARGKVVISP  1166
             K VIDP G F F    EAF Y++TGR  GKVVI P
Sbjct  255   KPVIDPKGTFPFSQAPEAFSYLQTGRVTGKVVIHP  289



>ref|XP_007031458.1| Oxidoreductase, zinc-binding dehydrogenase family protein, putative 
[Theobroma cacao]
 gb|EOY02384.1| Oxidoreductase, zinc-binding dehydrogenase family protein, putative 
[Theobroma cacao]
Length=350

 Score =   237 bits (604),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 145/304 (48%), Positives = 196/304 (64%), Gaps = 6/304 (2%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
             KAW Y +HG P +VLKL  D  +P  + DQ+LV+V AA LNP D K      +     FP
Sbjct  15    KAWVYAQHGKPADVLKLKSDVAVPQVKEDQVLVKVAAAGLNPPDNKRMIGIFIHAECPFP  74

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              IPG D+AG+VV  GS V    +GDEVYGN+H   L+   K+ GTLAE+T VEE L+A+K
Sbjct  75    TIPGYDVAGVVVKVGSQVKNLKVGDEVYGNVHEKALD-HPKQYGTLAEYTAVEERLLALK  133

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKN++F  AA+LP+   TA +G +   F  GQS+ ++GGAGGVGS+ VQLAKHV+GAS V
Sbjct  134   PKNVSFPEAAALPVGTGTAYEGLQRCQFSAGQSILVLGGAGGVGSMVVQLAKHVFGASRV  193

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT S  K+E +K LGAD  +DYT   +E +PE +D+VYD +G    +    K    ++ 
Sbjct  194   AATASTGKLELLKSLGADLAIDYTEENFEYLPEKFDVVYDCVGQCERTVKAMKGGGRVVT  253

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
             ++   + P A    ++ +G+ LEKL P+LESGKVKAVIDP G + F   +E   +++TGR
Sbjct  254   VSGAVTVP-AFKFIVSSNGDDLEKLNPYLESGKVKAVIDPKGIYPFSQTLEGLAHVDTGR  312

Query  1140  ARGK  1151
               GK
Sbjct  313   VAGK  316



>gb|AAK66565.1|AF384244_1 quinone oxidoreductase-like protein [Helianthus annuus]
Length=309

 Score =   235 bits (600),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 152/310 (49%), Positives = 201/310 (65%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y+E+G  +VLKL  D  +P  + DQ+LV+V AAA+NP+D+K R      ++   P+
Sbjct  2     KAWKYDEYGSVDVLKLATDVAVPEIKDDQVLVKVVAAAVNPVDYKRRLGYFKAIDSPLPI  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             IPG D+ G+V+  GS V     GDEVYG+I++  LEG   + GTLAE+T VEE L+A+KP
Sbjct  62    IPGFDVLGVVLKVGSQVKDLKEGDEVYGDINDKGLEGP-TQFGTLAEYTAVEERLLALKP  120

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL F  AA+LPLAI+TA +G   A F EG+++ ++ GAGGVGS  +QLAKHVYGAS VA
Sbjct  121   KNLDFIQAAALPLAIETAYEGLERAKFSEGKTILVLNGAGGVGSFIIQLAKHVYGASKVA  180

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT+S  K+E +K LGAD  +DYT   +E +P+ YD+VYD IG    +     E    + I
Sbjct  181   ATSSTGKLELLKSLGADVAIDYTKENFEDLPDKYDVVYDAIGQPEKALKAVNETGVAVSI  240

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T  P  P      LT  G IL KL P+LESGK+K+  DP  PF F  + EA+ Y+E+   
Sbjct  241   TG-PIPPPGFSFILTSDGSILTKLNPYLESGKIKSDNDPKSPFPFDKLNEAYAYLESTGP  299

Query  1143  RGKVVISPFP  1172
              GKVVI P P
Sbjct  300   TGKVVIYPIP  309



>ref|XP_006416058.1| hypothetical protein EUTSA_v10007901mg [Eutrema salsugineum]
 gb|ESQ34411.1| hypothetical protein EUTSA_v10007901mg [Eutrema salsugineum]
Length=385

 Score =   237 bits (605),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 153/310 (49%), Positives = 201/310 (65%), Gaps = 5/310 (2%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
             KAW Y E+G  +VLKL  +  +P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  78    KAWVYGEYGGVDVLKLESNIAVPEIKDDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  137

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GSGV  F  GDEVY N+    LEG  K+ G+LAE+T VEE L+AMKP
Sbjct  138   VPGYDVAGVVVKVGSGVRDFKEGDEVYANVSEKALEGP-KQFGSLAEYTAVEEKLLAMKP  196

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KN+ F  AA LPLAI+TA +G     F  G+S+ ++ GAGGVGSL +QLAK VYGAS VA
Sbjct  197   KNIDFAQAAGLPLAIETADEGLVRTEFSAGKSILVLNGAGGVGSLVIQLAKQVYGASKVA  256

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K+E V+ LGAD  +DYT    E + E +D+V+D IG    +  V KE   ++ +
Sbjct  257   ATASTGKLELVRSLGADLAIDYTKENIEDLLEKFDVVFDAIGMCDKAVKVIKEGGKVVAL  316

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
             T   + P      +T +GE+L+KL P++ESGKVK V+D  GPF F  V +AF Y+ET  A
Sbjct  317   TGAVTPP-GFRFVVTSNGEVLKKLNPYIESGKVKPVVDTKGPFPFSRVADAFSYLETNHA  375

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  376   TGKVVVYPIP  385



>ref|XP_008348198.1| PREDICTED: LOW QUALITY PROTEIN: 2-methylene-furan-3-one reductase-like, 
partial [Malus domestica]
Length=253

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/250 (51%), Positives = 175/250 (70%), Gaps = 2/250 (1%)
 Frame = +3

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             +PG D+AG+VV  GS VTKF +GDEVYG+++   ++   K++G+LAE+T  EE ++A+KP
Sbjct  6     VPGYDVAGVVVKVGSQVTKFKVGDEVYGDLNEKAIDNP-KKIGSLAEYTAAEERVLALKP  64

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
             KNL+F  AASLPLAI+TA +G     F  G+S+ ++GGAGGVG+  +QLAKHV+ AS VA
Sbjct  65    KNLSFVEAASLPLAIETAYEGLERVEFSAGKSILVLGGAGGVGTHVIQLAKHVFSASKVA  124

Query  783   ATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDI  962
             AT S  K++ ++ LGAD  +DYT   +E +PE +D+VYD +G S  +    KE   +  I
Sbjct  125   ATASTKKLDLLRSLGADLAIDYTXKNFEDLPEKFDVVYDAVGQSDRALKXVKEGGKVXTI  184

Query  963   TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRA  1142
                P+ P A+  GLT +G +LEKLKP+LESGKV  V+DP GP+ F   VEAF Y+ET RA
Sbjct  185   VG-PATPPAIIFGLTSTGTVLEKLKPYLESGKVXPVLDPTGPYPFSKXVEAFAYLETSRA  243

Query  1143  RGKVVISPFP  1172
              GKVV+ P P
Sbjct  244   TGKVVVYPIP  253



>ref|XP_010029195.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Eucalyptus 
grandis]
 gb|KCW56052.1| hypothetical protein EUGRSUZ_I01807 [Eucalyptus grandis]
Length=318

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 199/316 (63%), Gaps = 18/316 (6%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDF-KLRQTSLVP-MNFP  419
             KAW Y EHG   +VL L  +  +P  Q  Q+LV+V AA LNP D  +++    +P  + P
Sbjct  12    KAWVYREHGNVADVLGLDPELEVPKLQEGQVLVKVLAATLNPADAARVKGVFQLPGFSLP  71

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV  G  V +  +GDEVYG + +       K+ GTLAE+  VEE+ +A+K
Sbjct  72    AVPGYDLAGVVVKVGREVKELKVGDEVYGFMWH------AKKDGTLAEYAAVEESFLALK  125

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PK L F  AASLP+ IQTA  G   AG   G+S+ ++GGAGGVG+L +QLAK V+GAS V
Sbjct  126   PKKLRFGEAASLPVVIQTAYGGLERAGLSHGKSLLVLGGAGGVGTLIIQLAKEVFGASRV  185

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K++ +K LGAD  +DYT   +E +PE +D+VYDT+G+   +    K   +I+ 
Sbjct  186   AATSSTGKLDLLKSLGADLAIDYTKVNFEDLPEKFDVVYDTVGEIERAAKAVKPGGSIVT  245

Query  960   I-----TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGY  1124
             I     T PP    A    +T +   LEKLKPFLESGKVK VIDP  PF F   +EAF Y
Sbjct  246   IVKQNKTLPPP---AFFFAVTSNRSTLEKLKPFLESGKVKPVIDPKSPFPFSQAIEAFSY  302

Query  1125  IETGRARGKVVISPFP  1172
             ++T RA GKVVI P P
Sbjct  303   LQTRRATGKVVIHPIP  318



>ref|XP_010029193.1| PREDICTED: 2-methylene-furan-3-one reductase-like isoform X2 
[Eucalyptus grandis]
 gb|KCW56046.1| hypothetical protein EUGRSUZ_I01801 [Eucalyptus grandis]
Length=296

 Score =   233 bits (593),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 146/309 (47%), Positives = 197/309 (64%), Gaps = 28/309 (9%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVI  425
             KAW Y E G P +VLKL  D  +P  + DQ+LV++                        +
Sbjct  14    KAWVYAERGNPVDVLKLVPDVGVPEIKEDQVLVKI------------------------V  49

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
             PG D+AG+VV  G    KF +GDEVYG+I    ++   K+ GTLAE+T VEE L+A+KPK
Sbjct  50    PGYDVAGVVVKVGDQAKKFKVGDEVYGDIIEKAVD-HPKQHGTLAEYTAVEERLLALKPK  108

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
             NL+F  AASLPLAI+TA +G   AGF  G+S+ ++GGAGGVGSL +QLAK V+GAS VAA
Sbjct  109   NLSFVEAASLPLAIETAYEGLERAGFSPGKSILVLGGAGGVGSLVIQLAKEVFGASRVAA  168

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDIT  965
             T+S  K++ +K LGAD  +DYT   +E +PE +D+VYD +G S  +    KE  +++ I+
Sbjct  169   TSSTGKLDLLKSLGADLAIDYTKENFEDLPEKFDVVYDAVGQSERAVRAVKEGGSVVTIS  228

Query  966   WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRAR  1145
                + P AV   LT +G +LEKL PFLE+ K+K VIDP G F F   +EAF +++TGR  
Sbjct  229   G-KATPPAVLFFLTSNGSVLEKLNPFLENQKIKPVIDPKGTFPFSQALEAFLFLQTGRVT  287

Query  1146  GKVVISPFP  1172
             GK+VI P P
Sbjct  288   GKIVIHPIP  296



>gb|KDO66208.1| hypothetical protein CISIN_1g021628mg [Citrus sinensis]
Length=284

 Score =   228 bits (582),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 187/282 (66%), Gaps = 6/282 (2%)
 Frame = +3

Query  252   KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTSLVPMNFP  419
             KAW Y+E+G  + VLK   +  +P  + DQ+L++V AAALNPIDFK  L   S      P
Sbjct  2     KAWVYKEYGNSQSVLKFETNVEVPSLREDQVLIKVVAAALNPIDFKRMLGAFSATDSPLP  61

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              IPG D+AG+V   GS V KF +GDEVYG+I+   L+   KR G+LAE+T VEE L+A+K
Sbjct  62    TIPGYDVAGVVEKVGSQVKKFKVGDEVYGDINEKALD-HPKRNGSLAEYTAVEENLLALK  120

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PKNL+F  AASLPLA +TA +G   + F  G+S+ ++GGAGGVG++ +QLAKHV+GAS V
Sbjct  121   PKNLSFVEAASLPLATETAYEGLERSAFSAGKSILVLGGAGGVGTMVIQLAKHVFGASKV  180

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K++ ++ LGAD  +DYT    E +PE +D+V+D +G    +    KE   ++ 
Sbjct  181   AATSSTAKLDLLRSLGADLAIDYTKENIEDLPEKFDVVFDAVGQCDKALKAVKEGGRVVS  240

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAG  1085
             I    + P A    LT  G ILEKL P+ ESGKVKA+IDP G
Sbjct  241   IIGSVT-PPASSFVLTSDGSILEKLNPYFESGKVKAIIDPKG  281



>ref|XP_006379865.1| hypothetical protein POPTR_0008s16150g [Populus trichocarpa]
 gb|ERP57662.1| hypothetical protein POPTR_0008s16150g [Populus trichocarpa]
Length=320

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 140/295 (47%), Positives = 195/295 (66%), Gaps = 14/295 (5%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFKLRQTSLVPMN---  413
             KAW Y E+G    VLKL D  + VPQ   DQ+L++V AA++NP+D K R   +  ++   
Sbjct  14    KAWVYGEYGNVSNVLKL-DSNVTVPQVKEDQVLIKVVAASINPVDAK-RMLGMFKVSDSP  71

Query  414   FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVA  593
              P +PG D+AG+VV  GS V +  +GDEVYG+I+   L+   KR G+LAE+T VEE LVA
Sbjct  72    VPTVPGYDVAGVVVKVGSQVKRLKVGDEVYGDINEKALDHP-KRFGSLAEYTAVEENLVA  130

Query  594   MKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGAS  773
             +KPKNL+F  AASLPL I+TA +G    GF  G+S+ ++GGAGGVG+  +QLAKHV+GAS
Sbjct  131   LKPKNLSFAEAASLPLVIETAHEGLERTGFSAGKSILVLGGAGGVGTQIIQLAKHVFGAS  190

Query  774   SVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATI  953
             +VAAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD +G    +    KE+ ++
Sbjct  191   TVAATSSTSKLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAVGQCDRAVKAVKEDGSV  250

Query  954   IDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAF  1118
             + I  P + P  +   LT +G +L+KLKP+LESGKVK V+      HF  +   F
Sbjct  251   VTIVGPITPPALIFV-LTSNGSVLDKLKPYLESGKVKPVLHS----HFLKLQRHF  300



>ref|XP_010029198.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Eucalyptus 
grandis]
 gb|KCW56056.1| hypothetical protein EUGRSUZ_I01810 [Eucalyptus grandis]
Length=315

 Score =   226 bits (575),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 193/316 (61%), Gaps = 21/316 (7%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPID-FKLRQTSLVP-MNFP  419
             KAW Y E+G    VL+L  +F +P  Q  Q+LV+V AAALNPID  ++     +P    P
Sbjct  12    KAWVYREYGDVGNVLRLNQEFEVPEVQKGQVLVKVLAAALNPIDHMRVNAVYKLPHFTLP  71

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AGIVV  G  V K  +GDEVYG    +         GTLAE+T V+E+ +A+K
Sbjct  72    AVPGYDLAGIVVKVGGEVEKLKVGDEVYGCATIY---------GTLAEYTAVDESTLALK  122

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PK L+F+ AASLPL I TA  G    G   G+S+ ++GGAGGVG+L +QLAK V+GAS V
Sbjct  123   PKKLSFEEAASLPLVIHTAYGGLERVGLSPGKSLLVLGGAGGVGTLVIQLAKEVFGASRV  182

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT S  K++ +K LGAD  +DYT   +E + E +D+VY  IG S  +    K   +++ 
Sbjct  183   AATCSTGKLDLLKSLGADLAIDYTKVNFEDLSEKFDVVYVAIGQSERAVKAVKPGGSVVT  242

Query  960   I-----TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGY  1124
             I     T PP     V +     G  LEKLKPFLESGKVK VIDP  PF F   +EAF +
Sbjct  243   IVEHSKTLPPPAFSFVSAS---DGATLEKLKPFLESGKVKPVIDPKSPFPFSQAIEAFSH  299

Query  1125  IETGRARGKVVISPFP  1172
             ++T RA GKVVI P P
Sbjct  300   LQTCRAAGKVVIHPVP  315



>ref|XP_007216786.1| hypothetical protein PRUPE_ppa023751mg, partial [Prunus persica]
 gb|EMJ17985.1| hypothetical protein PRUPE_ppa023751mg, partial [Prunus persica]
Length=286

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 136/280 (49%), Positives = 181/280 (65%), Gaps = 16/280 (6%)
 Frame = +3

Query  246   MQKAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK-----LRQTSLV  404
             + KAW Y EHG    VLK   +  +P  + DQ+L++V AAALNPID K      R T   
Sbjct  14    VNKAWIYREHGETAHVLKFETNVAVPQIKEDQVLIKVVAAALNPIDAKRILGVFRATDTA  73

Query  405   PMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGE--LKRMGTLAEFTVVE  578
                 P +PG D+AG+VV  GS  +KF+IGDEVYG+I   N EG   LK+ GTLAE+T  E
Sbjct  74    ---LPTVPGFDVAGVVVKLGSKASKFNIGDEVYGDI---NEEGSINLKKFGTLAEYTAAE  127

Query  579   ETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKH  758
             E L+A+KPKNL+F  AASLP AI+TA +G +  G   GQS+ ++GGAGG G+  +QLAKH
Sbjct  128   ERLLALKPKNLSFVEAASLPAAIETAYEGLKRVGLSAGQSILVLGGAGGCGTHVIQLAKH  187

Query  759   VYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAK  938
             V+GAS VAAT S  K++ ++ LGAD  +DYT    E +PE +D+VYD +G S  +    K
Sbjct  188   VFGASRVAATASTKKLDLLRSLGADLAIDYTKENVEDLPEKFDVVYDAVGQSDKAVKAVK  247

Query  939   ENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGK  1058
             E   ++ +  P + P ++   LT +G ILEKLKP+LES K
Sbjct  248   EGGRVVTLIGPITPPASMFV-LTSTGSILEKLKPYLESRK  286



>gb|KCW72925.1| hypothetical protein EUGRSUZ_E01364 [Eucalyptus grandis]
Length=177

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = +3

Query  420  VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
            V+PGCDMAG+VVAKG+GVTKFD+GD VYGNI +FN  G+LK++GTLAEF  VEETLVAMK
Sbjct  3    VVPGCDMAGVVVAKGTGVTKFDLGDAVYGNIQDFNAPGKLKQLGTLAEFIAVEETLVAMK  62

Query  600  PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
            P+NL+F+ AASLPLA+QTA +GF TA F+EGQ+VFIVGGAGGVG+LAVQLAK+ Y AS V
Sbjct  63   PQNLSFEEAASLPLAVQTAMEGFVTADFKEGQTVFIVGGAGGVGTLAVQLAKNFYNASYV  122

Query  780  AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVA  935
             AT S+ KVEFVK LGADKV+DYTNT YE+I E +D +YDTIG+ +   + +
Sbjct  123  VATCSSAKVEFVKKLGADKVIDYTNTKYEEIKEKFDFLYDTIGEGLQELLCS  174



>ref|XP_003618486.1| Quinone oxidoreductase-like protein [Medicago truncatula]
 gb|AES74704.1| zinc-binding dehydrogenase family oxidoreductase [Medicago truncatula]
Length=309

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 137/284 (48%), Positives = 190/284 (67%), Gaps = 6/284 (2%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTSLVPMNFP  419
             KAW Y ++G  ++VLK   +   P P+ DQ+L++V AAALNP++ K  L Q   +    P
Sbjct  12    KAWVYSQYGIIEDVLKFDPNVPTPHPKEDQVLIKVVAAALNPVEIKRALGQLKDIDSPLP  71

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV+ G  V KF +GDEVYG+I+   L    K +G+L+E+TV EE ++A K
Sbjct  72    TVPGYDVAGVVVSVGEKVNKFKVGDEVYGDINETALNNP-KTVGSLSEYTVAEEKVLAHK  130

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P NL+F  AASLPLAI TA QG     F  G+S+ ++GGAGGVGSL +QLAKHV+ AS +
Sbjct  131   PSNLSFVEAASLPLAIITAYQGLERVEFSSGKSLLVLGGAGGVGSLVIQLAKHVFEASRI  190

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT S  K+EF++ LGAD  +DYT   YE+I E +D+VYD +GDS  +   A E   ++ 
Sbjct  191   AATASTTKLEFLRKLGADLAIDYTKENYEEITEKFDVVYDAVGDSERAVKAANEGGKVVT  250

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPF  1091
             I  PP  P A+   LT  G +LEKL+P+LE+G+V+ ++DP  PF
Sbjct  251   I-LPPGTPPAIPFLLTSDGAVLEKLQPYLENGRVRPILDPKSPF  293



>ref|XP_010030252.1| PREDICTED: 2-methylene-furan-3-one reductase-like, partial [Eucalyptus 
grandis]
Length=275

 Score =   221 bits (563),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 138/284 (49%), Positives = 184/284 (65%), Gaps = 16/284 (6%)
 Frame = +3

Query  342   VQVQAAALNPIDF-KLRQTSLVP-MNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIH  515
             V+V AAALNP+D  +++    +P  + P +PG D+AG+VV  G  V +  +GDEVYG + 
Sbjct  1     VKVLAAALNPVDAARMKGVIKLPGFSLPAVPGYDLAGVVVKVGREVKELKVGDEVYGFMF  60

Query  516   NFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQ  695
             +       K+ GTLAE+  VEE+ +A+KPK L F  AASLP+ IQTA  G   AG   G+
Sbjct  61    H------AKKDGTLAEYAAVEESFLALKPKKLRFGEAASLPVVIQTAYGGLERAGLSHGK  114

Query  696   SVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIP  875
             S+ ++GGAGGVG+L +QLAK V+GAS VAAT+S  K+E +K LGAD  +DYT   +E +P
Sbjct  115   SLLVLGGAGGVGTLIIQLAKEVFGASRVAATSSTGKLELLKSLGADLAIDYTKVNFEDLP  174

Query  876   ETYDLVYDTIGDSINSFVVAKENATIIDI-----TWPPSNPRAVHSGLTVSGEILEKLKP  1040
             E +D+VYDT+G+   +    K   +I+ I     T PP    A    +T +   LEKLKP
Sbjct  175   EKFDVVYDTVGEIERAAKAVKPGGSIVTIVKQNKTLPPP---AFFFAVTSNRSTLEKLKP  231

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVISPFP  1172
             FLESGKVK VIDP  PF F  V+EAF Y++T RA GK+VI P P
Sbjct  232   FLESGKVKPVIDPKNPFPFSQVIEAFSYLQTRRATGKLVIHPVP  275



>gb|KHN23538.1| Quinone oxidoreductase-like protein, chloroplastic [Glycine soja]
Length=259

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 121/254 (48%), Positives = 162/254 (64%), Gaps = 5/254 (2%)
 Frame = +3

Query  411   NFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLV  590
             + P++PG D+AGIVV  G  V KF +GDEVYG+I+   L   LK  GTL+E+T+ EE L+
Sbjct  11    HLPIVPGYDVAGIVVKVGGEVKKFKVGDEVYGDINEQGL-SNLKIHGTLSEYTIAEERLL  69

Query  591   AMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGA  770
             A KP NL+F  AAS+PLA++TA +GF  A F  G+S+      GG G +   LAK VY A
Sbjct  70    AHKPSNLSFIEAASIPLALETANEGFEHAHFSAGKSI---LVLGGAGGVGNYLAKQVYKA  126

Query  771   SSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENAT  950
             S +AAT S  K+E ++ LG D  +DYT   +E +PE YDLVYD +G    +F   KE+  
Sbjct  127   SKIAATASTGKLELLRELGVDLPIDYTKENFEDLPEKYDLVYDVVGQGDRAFKAVKEDGK  186

Query  951   IIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIE  1130
             ++ I  PP +P A+   LT  G ILE L+P+ ESGK+K ++D   P  F  V+EA  Y+E
Sbjct  187   VVTIV-PPGHPPAMFFVLTSKGSILENLRPYFESGKLKPILDAKTPVPFSQVIEAISYLE  245

Query  1131  TGRARGKVVISPFP  1172
             T RA GKVV+ P P
Sbjct  246   TSRATGKVVVYPIP  259



>gb|KCW56053.1| hypothetical protein EUGRSUZ_I01807 [Eucalyptus grandis]
Length=284

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 142/311 (46%), Positives = 187/311 (60%), Gaps = 42/311 (14%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDF-KLRQTSLVP-MNFP  419
             KAW Y EHG   +VL L  +  +P  Q  Q+LV+V AA LNP D  +++    +P  + P
Sbjct  12    KAWVYREHGNVADVLGLDPELEVPKLQEGQVLVKVLAATLNPADAARVKGVFQLPGFSLP  71

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
              +PG D+AG+VV  G  V +  +GDEVYG + +       K+ GTLAE+  VEE+ +A+K
Sbjct  72    AVPGYDLAGVVVKVGREVKELKVGDEVYGFMWH------AKKDGTLAEYAAVEESFLALK  125

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             PK L F  AASLP+ IQTA  G   AG   G+S+ ++GGAGGVG+L +QLAK V+GAS V
Sbjct  126   PKKLRFGEAASLPVVIQTAYGGLERAGLSHGKSLLVLGGAGGVGTLIIQLAKEVFGASRV  185

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             AAT+S  K++ +K LGAD  +DYT   +E +PE +D+VYDT+                  
Sbjct  186   AATSSTGKLDLLKSLGADLAIDYTKVNFEDLPEKFDVVYDTV------------------  227

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
                           +T +   LEKLKPFLESGKVK VIDP  PF F   +EAF Y++T R
Sbjct  228   --------------VTSNRSTLEKLKPFLESGKVKPVIDPKSPFPFSQAIEAFSYLQTRR  273

Query  1140  ARGKVVISPFP  1172
             A GKVVI P P
Sbjct  274   ATGKVVIHPIP  284



>ref|XP_007216927.1| hypothetical protein PRUPE_ppa016638mg [Prunus persica]
 gb|EMJ18126.1| hypothetical protein PRUPE_ppa016638mg [Prunus persica]
Length=311

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 137/284 (48%), Positives = 183/284 (64%), Gaps = 20/284 (7%)
 Frame = +3

Query  246   MQKAWYYEEHGPK-EVLKL-GDFLIPVPQHDQLLVQVQAAALNPID-------FKLRQTS  398
             + KAW Y EHG    VLK   +  +P  + DQ+L++V AAALNPID       F+   T+
Sbjct  14    VNKAWIYREHGETAHVLKFETNVAVPQIKEDQVLIKVVAAALNPIDAKRILGVFRATDTA  73

Query  399   LVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGE--LKRMGTLAEFTV  572
             L     P +PG D+AG+VV  GS   KF+IGDEVYG+I   N EG   LK+ GTLAE+T 
Sbjct  74    L-----PTVPGFDVAGVVVKLGSKARKFNIGDEVYGDI---NEEGSINLKKFGTLAEYTA  125

Query  573   VEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqla  752
              EE L+A+KP NL+F  AASLP+A++TA +G    G   GQS+ ++GGAGG+G+  +QLA
Sbjct  126   AEERLLALKPTNLSFVEAASLPMAMETAYEGLERVGLSAGQSILVLGGAGGLGTHVIQLA  185

Query  753   KHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVV  932
             KHV+GAS VAAT S  K++ +K LGAD  +DYT  + E +PE +D+V+D +G S  +   
Sbjct  186   KHVFGASRVAATASTKKLDLLKSLGADLAIDYTEESVEDLPEKFDVVFDAVGQSDKAVKA  245

Query  933   AKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVK  1064
              K    ++ I + P  P A    LT +G  LEKLKP+LESGKVK
Sbjct  246   VKAEGRVVTI-FGPITPPAFMFVLTSTGSSLEKLKPYLESGKVK  288



>emb|CDP10306.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 146/326 (45%), Positives = 209/326 (64%), Gaps = 13/326 (4%)
 Frame = +3

Query  219   STEPNGLQDMQKAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK---  383
             ++ P  +    KAW Y ++G P++VLKL  +  +P    +Q+L++V AA+LNP+DFK   
Sbjct  3     TSTPVNVPSKMKAWVYGQYGKPEDVLKLESEVDVPDVNDNQVLIKVVAASLNPVDFKRMY  62

Query  384   --LRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTL  557
                + T   P   P + G D+ G+VV  GS V +F +GDEVYG++H   L    K  GTL
Sbjct  63    GEFKATDSPP---PTVAGYDVVGVVVRVGSKVKEFKVGDEVYGDVHEHALNP--KGCGTL  117

Query  558   AEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgsl  737
             AE+T  EE ++A+KPKNL+F  AASLPLA++TA +G  +A     +SV ++GGAGGVG+ 
Sbjct  118   AEYTAAEEKVLALKPKNLSFAEAASLPLAVETAYEGLESARLSACESVLVLGGAGGVGTF  177

Query  738   avqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSI  917
              +QL+KHV+GAS VAAT SA K+E +K LGAD  +DY +  YE +PE +D+VYDT+G++ 
Sbjct  178   TIQLSKHVFGASKVAATCSAGKLELLKTLGADLAIDYKSNKYEDLPEKFDVVYDTVGEAD  237

Query  918   NSFVVAKENATIIDITWPPS-NPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFH  1094
                   KE   ++ I    S  P A    +T +G +L +LKP +E  K+K V+DP  PF 
Sbjct  238   RGIKALKEGGRVVTIVGGQSVVPPAFVFVVTSTGSVLTRLKPLIEEKKLKPVMDPKSPFP  297

Query  1095  FCNVVEAFGYIETGRARGKVVISPFP  1172
             F + +EAF +++ GRA GKVVI P P
Sbjct  298   FSHTIEAFSHLQCGRATGKVVIYPIP  323



>gb|AFK39081.1| unknown [Lotus japonicus]
Length=218

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 144/178 (81%), Gaps = 1/178 (1%)
 Frame = +3

Query  639   LAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEFVK  818
             L  QTA +GF TA +++ Q++F+VGGAGGVG+L +QLAKH+ GA  V ATTS PKVEFVK
Sbjct  11    LGSQTAIEGFTTASYKKDQTIFVVGGAGGVGNLVIQLAKHL-GAPYVVATTSTPKVEFVK  69

Query  819   CLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIIDITWPPSNPRAVHS  998
              LGADKVVDYT   YE I E +D +YDT+GD   S VVAK++A I+DITWPPS+P AV+S
Sbjct  70    QLGADKVVDYTKIKYEDIEEKFDFLYDTVGDCQKSVVVAKDDAAIVDITWPPSHPGAVYS  129

Query  999   GLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVISPFP  1172
              LTVSGE LEKL+P+LE G++KAVIDP GP+HF NV+EAF Y+ETGRA GKVVIS FP
Sbjct  130   SLTVSGESLEKLEPYLERGELKAVIDPTGPYHFDNVIEAFRYLETGRAWGKVVISCFP  187



>ref|XP_007151049.1| hypothetical protein PHAVU_004G014200g [Phaseolus vulgaris]
 gb|ESW23043.1| hypothetical protein PHAVU_004G014200g [Phaseolus vulgaris]
Length=321

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 208/315 (66%), Gaps = 13/315 (4%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK----LRQTSLVPMN  413
             KAW Y E+G  E +   +  IP+PQ   D +L++V AAALNPID+K      + +  P+ 
Sbjct  12    KAWVYSEYGNTEDILKFESNIPIPQIKEDHVLIKVVAAALNPIDYKRALGFFKNTDSPL-  70

Query  414   FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVA  593
              P +PG D+AG+VV+ GS V KF +GDEVYG+I+   L+   K +G+LAE+T VEE L+A
Sbjct  71    -PTVPGYDVAGVVVSVGSQVRKFKVGDEVYGDINEDPLDNP-KTVGSLAEYTAVEEKLLA  128

Query  594   MKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGAS  773
              KP NL+F  AASLPLAI TA QG     F  GQSV ++GGAGGVGSL +QLAKHV+GAS
Sbjct  129   HKPSNLSFVEAASLPLAIITAYQGLERVEFSAGQSVLVLGGAGGVGSLVIQLAKHVFGAS  188

Query  774   SVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTI--GDSINSFVVAKENA  947
              VAAT S  K++ ++ LGAD  +DYT   +E++ E +D+VYDT+  G+   +    KE+ 
Sbjct  189   KVAATASTGKLDLLRNLGADLAIDYTKEKFEELEEKFDVVYDTVGRGEIERASKAVKESG  248

Query  948   TIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYI  1127
              ++ +    ++  A+       G +LEKL+P+LESGKVK ++DP  PF F   VEAF ++
Sbjct  249   KVVTVAAIGTS--AIFVKRISDGGVLEKLQPYLESGKVKPILDPKSPFLFSQTVEAFAHL  306

Query  1128  ETGRARGKVVISPFP  1172
             +T RA GKVVI P P
Sbjct  307   KTNRAIGKVVIHPIP  321



>gb|ACZ74700.1| quinone oxidoreductase-like protein [Phaseolus vulgaris]
Length=321

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 151/315 (48%), Positives = 208/315 (66%), Gaps = 13/315 (4%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK----LRQTSLVPMN  413
             KAW Y E+G  E +   +  IP+PQ   D +L++V AAALNPID+K      + +  P+ 
Sbjct  12    KAWVYSEYGNTEDILKFESNIPIPQIKEDHVLIKVVAAALNPIDYKRALGFFKNTDSPL-  70

Query  414   FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVA  593
              P +PG D+AG+VV+ GS V KF +GDEVYG+I+   L+   K +G+LAE+T VEE L+A
Sbjct  71    -PTVPGYDVAGVVVSVGSQVRKFKVGDEVYGDINEDPLDNP-KTVGSLAEYTAVEEKLLA  128

Query  594   MKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGAS  773
              KP NL+F  AASLPLAI TA QG     F  GQSV ++GGAGGVGSL +QLAKHV+G+S
Sbjct  129   HKPSNLSFVEAASLPLAIITAYQGLERVEFSAGQSVLVLGGAGGVGSLVIQLAKHVFGSS  188

Query  774   SVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTI--GDSINSFVVAKENA  947
              VAAT S  K++ ++ LGAD  +DYT   +E++ E +D+VYDT+  G+   +    KE+ 
Sbjct  189   KVAATASTGKLDLLRNLGADLAIDYTKEKFEELEEKFDVVYDTVGRGEIERASKAVKESG  248

Query  948   TIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYI  1127
              ++ +    ++  A+       G +LEKL+P+LESGKVK ++DP  PF F   VEAF ++
Sbjct  249   KVVTVAAIGTS--AIFVKRISDGGVLEKLQPYLESGKVKPILDPKSPFSFSQTVEAFAHL  306

Query  1128  ETGRARGKVVISPFP  1172
             +T RA GKVVI P P
Sbjct  307   KTNRAIGKVVIHPIP  321



>gb|KCW56055.1| hypothetical protein EUGRSUZ_I01808 [Eucalyptus grandis]
Length=260

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 128/260 (49%), Positives = 168/260 (65%), Gaps = 14/260 (5%)
 Frame = +3

Query  408   MNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETL  587
              + P +PG D+AG+VV  G  V +  +GDEVYG + +       K+ GTLAE+  VEE+ 
Sbjct  10    FSLPAVPGYDLAGVVVKVGREVKELKVGDEVYGFMFH------AKKDGTLAEYAAVEESF  63

Query  588   VAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYG  767
             +A+KPK L F  AASLP+ IQTA  G   AG   G+S+ ++GGAGGVG+L +QLAK V+G
Sbjct  64    LALKPKKLRFGEAASLPVVIQTAYGGLERAGLSHGKSLLVLGGAGGVGTLIIQLAKEVFG  123

Query  768   ASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENA  947
             AS VAAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYDT+G+   +    K   
Sbjct  124   ASRVAATSSTGKLELLKSLGADLAIDYTKVNFEDLPEKFDVVYDTVGEIERAAKAVKPGG  183

Query  948   TIIDI-----TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
             +I+ I     T PP    A    +T +   LEKLKPFLESGKVK VIDP  PF F  V+E
Sbjct  184   SIVTIVKQNKTLPPP---AFFFAVTSNRSTLEKLKPFLESGKVKPVIDPKNPFPFSQVIE  240

Query  1113  AFGYIETGRARGKVVISPFP  1172
             AF Y++T RA GK+VI P P
Sbjct  241   AFSYLQTRRATGKLVIHPVP  260



>gb|AFK39993.1| unknown [Lotus japonicus]
Length=214

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 152/211 (72%), Gaps = 1/211 (0%)
 Frame = +3

Query  540   KRMGTLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvgga  719
             K +G+LAE+T  EE L++ KP+NL+F  AASLPL I+TA  G   AGF  G+S+ ++GGA
Sbjct  5     KVVGSLAEYTAAEEKLLSHKPRNLSFAEAASLPLTIETAYNGLELAGFSAGKSILVLGGA  64

Query  720   ggvgslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYD  899
             GGVG+L +QLAKHVYGAS +AAT+S  K+E ++ LGAD  +DYT   +E +PE +D+VYD
Sbjct  65    GGVGTLIIQLAKHVYGASKIAATSSTGKLELLRKLGADTPIDYTKENFEDLPEKFDVVYD  124

Query  900   TIGDSINSFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDP  1079
             T+G + ++F V KE   ++ I  PP  P A+   LT  G +LEKL+PFLESGKVK ++DP
Sbjct  125   TVGQTESAFKVLKEGGKVVTIV-PPGLPPAIFFVLTSDGAVLEKLRPFLESGKVKPILDP  183

Query  1080  AGPFHFCNVVEAFGYIETGRARGKVVISPFP  1172
               PF F   VEAF Y+ETGRA GKVVI P P
Sbjct  184   KSPFPFSQTVEAFSYLETGRATGKVVIHPIP  214



>ref|XP_008357880.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Malus domestica]
Length=303

 Score =   199 bits (507),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 124/280 (44%), Positives = 183/280 (65%), Gaps = 16/280 (6%)
 Frame = +3

Query  213   IFSTEPNGLQDMQKAWYYEEHGPK-EVLKLGDFLIPVPQ--HDQLLVQVQAAALNPIDFK  383
             + S++   +  + KAW Y E+G   +VLK  D  +PVP+   DQ+L++V AA+LNP+DFK
Sbjct  5     VASSDSVSIPSVNKAWVYSEYGKSADVLKF-DPNVPVPEIKEDQVLIKVVAASLNPVDFK  63

Query  384   -----LRQTSLVPMNFPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRM  548
                   + +   P   P +PG D+AG+VV  GS VTKF +GDEVYG+++   L+ + K++
Sbjct  64    RMLGYFKDSDSSP---PTVPGYDVAGVVVKVGSRVTKFKVGDEVYGDLNEKALD-KPKKI  119

Query  549   GTLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggv  728
             G+LAE+T  EE ++A+KPKNL+F  AASLPLAI+TA +G     F  G+S+ ++GGAGGV
Sbjct  120   GSLAEYTAAEERVLALKPKNLSFVEAASLPLAIETAYEGLERVEFSAGKSILVLGGAGGV  179

Query  729   gslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG  908
             G+  +QLAKH++GAS VAAT S  K++ ++ LGAD  +DYT   +E +PE +D+VYD +G
Sbjct  180   GTHVIQLAKHMFGASKVAATASTKKLDXLRSLGADLAIDYTKENFEDLPEKFDVVYDAVG  239

Query  909   DSINSFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILE  1028
              S  +    KE  T  D    PS  +A    +T S ++L+
Sbjct  240   QSDRALKAVKEGGTSRDAISXPSEYKA---WVTDSADVLK  276



>gb|ABK23099.1| unknown [Picea sitchensis]
Length=242

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 127/309 (41%), Positives = 174/309 (56%), Gaps = 74/309 (24%)
 Frame = +3

Query  246   MQKAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL--VPMNFP  419
             MQKAW+Y E+GP+ VL+ GDF +P     Q+LV+V+AAALNP+DFKLR        + FP
Sbjct  4     MQKAWFYNEYGPRAVLQYGDFPVPQLGDTQVLVRVRAAALNPVDFKLRNGVFKDTGLEFP  63

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
             V+PGCD+AG++V +G  V+ F  GDEVYGNI +FN  G  K+ GTL ++T VEE+L+A+K
Sbjct  64    VVPGCDVAGVIVDEGDNVSMFSKGDEVYGNIQSFNTVGP-KQYGTLTQYTAVEESLIALK  122

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P+N++F+ AAS PLA+QTA +GF  A FQ GQ+VFIVGG GGVGSL          A  +
Sbjct  123   PENMSFEEAASFPLALQTAQEGFDRAKFQRGQTVFIVGGEGGVGSL----------AIQL  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAKENATIID  959
             A ++  P+ EF                Y   P   +L      + + S++  ++   +ID
Sbjct  173   ANSSPHPRAEF----------------YIVTPSGSNL------ERLRSYIECEKLKPVID  210

Query  960   ITWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
              T P                                       + F NV+EAF ++E+GR
Sbjct  211   PTGP---------------------------------------YAFSNVMEAFKHLESGR  231

Query  1140  ARGKVVISP  1166
             ARGKVVISP
Sbjct  232   ARGKVVISP  240



>gb|KCW56044.1| hypothetical protein EUGRSUZ_I01801 [Eucalyptus grandis]
Length=259

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 158/223 (71%), Gaps = 5/223 (2%)
 Frame = +3

Query  252  KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFP--  419
            KAW Y E G P +VLKL  D  +P  + DQ+LV+V AA+LNP+DFK        ++ P  
Sbjct  14   KAWVYAERGNPADVLKLVPDVGVPEIKEDQVLVKVVAASLNPVDFKRALGFFKDIDSPPP  73

Query  420  VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
            ++PG D+AG+VV  G  V KF +GDEVYG+I+   L+   K+ GTLAE+T VEE L+A+K
Sbjct  74   IVPGYDVAGVVVKVGDQVKKFKVGDEVYGDINEKALDHP-KQHGTLAEYTAVEERLLALK  132

Query  600  PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
            PKNL+F  AASLPLAI+TA +G   A F  G+S+ ++GGAGGVG+L +QLAK V+GAS V
Sbjct  133  PKNLSFIEAASLPLAIETAYEGLERARFSPGKSILVLGGAGGVGTLVIQLAKEVFGASRV  192

Query  780  AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG  908
            AAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD +G
Sbjct  193  AATSSTGKLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAVG  235



>ref|XP_007031457.1| Oxidoreductase, zinc-binding dehydrogenase family protein isoform 
2, partial [Theobroma cacao]
 gb|EOY02383.1| Oxidoreductase, zinc-binding dehydrogenase family protein isoform 
2, partial [Theobroma cacao]
Length=254

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 119/250 (48%), Positives = 164/250 (66%), Gaps = 10/250 (4%)
 Frame = +3

Query  237  LQDMQKAWYYEEHG-PKEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPM  410
            L    KAW Y E+G   +VLKLG D  +P    DQ+LV+V AA +NP+DFK R   L+  
Sbjct  7    LPSQMKAWTYAEYGKSSDVLKLGSDVAVPQLNDDQVLVKVVAAGINPVDFK-RMLGLIKA  65

Query  411  N---FPVIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEE  581
                 P++PG D+AG+VV  GS V KF  GDEVYG+I+   L+   K+ GT+AE+T VEE
Sbjct  66   ADSPLPIVPGYDVAGVVVKVGSQVKKFKEGDEVYGDINEKALD-HPKQFGTIAEYTAVEE  124

Query  582  TLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavql---a  752
             L+A KPKNL+F  AA LPLAI+TA +G   + F  G+S+ ++GGAGGVG++ +Q+   +
Sbjct  125  RLLAFKPKNLSFIEAAGLPLAIETAHEGLERSQFSAGKSILVLGGAGGVGTMIIQVNYIS  184

Query  753  KHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVV  932
            K VYGAS VAAT+S  K++ +K LGAD  +DYT   YE +PE +D+VYD +G+   +   
Sbjct  185  KQVYGASKVAATSSTGKLDLLKSLGADLPIDYTKENYEDLPEKFDVVYDAVGECERAVKA  244

Query  933  AKENATIIDI  962
             KE   ++ I
Sbjct  245  VKEGGHVVAI  254



>gb|KDO66210.1| hypothetical protein CISIN_1g021628mg [Citrus sinensis]
Length=255

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/233 (50%), Positives = 159/233 (68%), Gaps = 5/233 (2%)
 Frame = +3

Query  252  KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFK--LRQTSLVPMNFP  419
            KAW Y+E+G  + VLK   +  +P  + DQ+L++V AAALNPIDFK  L   S      P
Sbjct  2    KAWVYKEYGNSQSVLKFETNVEVPSLREDQVLIKVVAAALNPIDFKRMLGAFSATDSPLP  61

Query  420  VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
             IPG D+AG+V   GS V KF +GDEVYG+I+   L+   KR G+LAE+T VEE L+A+K
Sbjct  62   TIPGYDVAGVVEKVGSQVKKFKVGDEVYGDINEKALDHP-KRNGSLAEYTAVEENLLALK  120

Query  600  PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
            PKNL+F  AASLPLA +TA +G   + F  G+S+ ++GGAGGVG++ +QLAKHV+GAS V
Sbjct  121  PKNLSFVEAASLPLATETAYEGLERSAFSAGKSILVLGGAGGVGTMVIQLAKHVFGASKV  180

Query  780  AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSINSFVVAK  938
            AAT+S  K++ ++ LGAD  +DYT    E +PE +D+V+D +G    S V  K
Sbjct  181  AATSSTAKLDLLRSLGADLAIDYTKENIEDLPEKFDVVFDAVGKMCISIVYQK  233



>gb|KCW56043.1| hypothetical protein EUGRSUZ_I01801 [Eucalyptus grandis]
Length=239

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 157/222 (71%), Gaps = 5/222 (2%)
 Frame = +3

Query  252  KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFP--  419
            KAW Y E G P +VLKL  D  +P  + DQ+LV+V AA+LNP+DFK        ++ P  
Sbjct  14   KAWVYAERGNPADVLKLVPDVGVPEIKEDQVLVKVVAASLNPVDFKRALGFFKDIDSPPP  73

Query  420  VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
            ++PG D+AG+VV  G  V KF +GDEVYG+I+   L+   K+ GTLAE+T VEE L+A+K
Sbjct  74   IVPGYDVAGVVVKVGDQVKKFKVGDEVYGDINEKALD-HPKQHGTLAEYTAVEERLLALK  132

Query  600  PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
            PKNL+F  AASLPLAI+TA +G   A F  G+S+ ++GGAGGVG+L +QLAK V+GAS V
Sbjct  133  PKNLSFIEAASLPLAIETAYEGLERARFSPGKSILVLGGAGGVGTLVIQLAKEVFGASRV  192

Query  780  AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTI  905
            AAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD +
Sbjct  193  AATSSTGKLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAV  234



>gb|ABR16968.1| unknown [Picea sitchensis]
Length=222

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 135/220 (61%), Gaps = 34/220 (15%)
 Frame = +3

Query  609   LTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIv--------------------------  710
             ++F+ AAS PLA+QTA +GF    FQ GQSVFIV                          
Sbjct  1     MSFEEAASFPLALQTAQEGFDRVNFQRGQSVFIVGGAGGVGSLAIQVKVNTILLPLKTSR  60

Query  711   --------ggaggvgslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYE  866
                            +  VQLAK+VYGAS +A TTS  KV+FV+ LGAD V+DYT  +Y+
Sbjct  61    NLVPLQNDRVRSFNNTCVVQLAKYVYGASKIATTTSTGKVDFVRQLGADTVIDYTKQSYD  120

Query  867   QIPETYDLVYDTIGDSINSFVVAKENATIIDITWPPSNPRAVHSGLTVSGEILEKLKPFL  1046
             QIP+ +D V+DT+GDS  S+VVAKE A IIDI  P  +PRA    +T SG  LE+L+ ++
Sbjct  121   QIPQKFDFVFDTVGDSHRSYVVAKEKAKIIDIANPSPHPRAEFFIVTASGSNLERLRGYI  180

Query  1047  ESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVISP  1166
             E  K+K VIDP  P+ F NV+EAF +IE+GRARGK+VISP
Sbjct  181   ECEKLKPVIDPISPYSFSNVMEAFKHIESGRARGKIVISP  220



>ref|XP_010251269.1| PREDICTED: 2-methylene-furan-3-one reductase-like isoform X2 
[Nelumbo nucifera]
Length=361

 Score =   187 bits (476),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 152/222 (68%), Gaps = 6/222 (3%)
 Frame = +3

Query  252  KAWYYEEHGPKEVLKLGDFLIPVP--QHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FP  419
            KAW Y E+G  +VLK  D  + VP  + DQ+L++V AAALNP+D K RQ      +   P
Sbjct  91   KAWVYGEYGGVDVLKF-DPKVSVPDVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPLP  149

Query  420  VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
             +PG D+AGIVV  GS V     GDEVYGNI+   LE   K+ G+ AE+T VEE L+A K
Sbjct  150  TVPGYDVAGIVVKAGSQVQSLKEGDEVYGNINEKALENP-KQFGSFAEYTAVEEKLLAPK  208

Query  600  PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
            PKNL F  AASLPLA++TA +G   +GF  G+S+ ++GGAGGVG+L +QLAK V+GAS V
Sbjct  209  PKNLDFAQAASLPLAVETAYEGLERSGFSAGKSILVLGGAGGVGTLVIQLAKQVFGASKV  268

Query  780  AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTI  905
            AAT+S  K+E +K LGAD  +DYT   +E +PE +D+V+D +
Sbjct  269  AATSSTGKLELLKSLGADLAIDYTKENFEDLPEKFDVVFDAV  310



>gb|KCW56049.1| hypothetical protein EUGRSUZ_I01803 [Eucalyptus grandis]
Length=217

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 144/216 (67%), Gaps = 8/216 (4%)
 Frame = +3

Query  540   KRMGTLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvgga  719
             K+ G+LAE+  VEE+ +A+KPK L+F+ AASLP+ IQTA  G   AG   G+S+ ++GGA
Sbjct  5     KKDGSLAEYAAVEESFLALKPKKLSFEEAASLPVVIQTAYGGLERAGLSHGKSLLVLGGA  64

Query  720   ggvgslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYD  899
             GGVG+L +QLAK V+GAS VAAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD
Sbjct  65    GGVGTLVIQLAKEVFGASRVAATSSTGKLELLKSLGADLAIDYTKVNFEDLPEKFDVVYD  124

Query  900   TIGDSINSFVVAKENATIIDI-----TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVK  1064
             T+G S  +    K   +++ I     T PP    A     T     LEKLKPFLESGKVK
Sbjct  125   TVGQSERAAKAVKPGGSMVTIVEHNKTLPPP---AFFFAATSDRLTLEKLKPFLESGKVK  181

Query  1065  AVIDPAGPFHFCNVVEAFGYIETGRARGKVVISPFP  1172
              +IDP  PF F   +EAF Y++TGRA GKVVI P P
Sbjct  182   PLIDPKSPFPFSQAIEAFSYLQTGRATGKVVIHPVP  217



>ref|XP_010029196.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Eucalyptus 
grandis]
 gb|KCW56051.1| hypothetical protein EUGRSUZ_I01805 [Eucalyptus grandis]
Length=217

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 143/216 (66%), Gaps = 8/216 (4%)
 Frame = +3

Query  540   KRMGTLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvgga  719
             K+ GTLAE+  VEE+ +A+KPK L F  AASLP+ IQTA  G   AG   G+S+ ++GGA
Sbjct  5     KKDGTLAEYAAVEESFLALKPKKLRFGEAASLPVVIQTAYGGLERAGLSHGKSLLVLGGA  64

Query  720   ggvgslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYD  899
             GGVG+L +QLAK V+GAS VAAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD
Sbjct  65    GGVGTLIIQLAKEVFGASRVAATSSTGKLELLKSLGADLAIDYTKVNFEDLPEKFDVVYD  124

Query  900   TIGDSINSFVVAKENATIIDI-----TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVK  1064
             T+G+   +    K   +I+ I     T PP    A    +T +   LEKLKPFLESGKVK
Sbjct  125   TVGEIERAAKAVKPGGSIVTIVKQNKTLPPP---AFFFAVTSNRSTLEKLKPFLESGKVK  181

Query  1065  AVIDPAGPFHFCNVVEAFGYIETGRARGKVVISPFP  1172
              VIDP  PF F   +EAF Y++T RA GK+VI P P
Sbjct  182   PVIDPKSPFPFSQAIEAFSYLQTRRATGKLVIHPVP  217



>gb|EYU22492.1| hypothetical protein MIMGU_mgv1a009679mg [Erythranthe guttata]
Length=248

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 115/223 (52%), Positives = 160/223 (72%), Gaps = 8/223 (4%)
 Frame = +3

Query  255  AWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLR----QTSLVPMNFP  419
            AW Y E+G  EVLKL  D  +P P  DQ+L++V AAALNPID+K R    +++  P+  P
Sbjct  26   AWRYSEYGGVEVLKLESDVPLPEPADDQVLIKVFAAALNPIDYKRRLGFFKSTDSPL--P  83

Query  420  VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
            ++PG D+AG+VV  G  V +  +GDEVYG+I     +G  K++GTLAE+TV +E L+A+K
Sbjct  84   IVPGYDVAGVVVKVGGEVKQLKVGDEVYGDIIEKAFDGP-KQIGTLAEYTVADEKLLALK  142

Query  600  PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
            PKNL F  AAS+P+AI+TA +G   A F +G+S+ ++GGAGGVGS  +QLAKHV+GAS V
Sbjct  143  PKNLDFGQAASIPMAIETAYEGLERARFSDGKSILVLGGAGGVGSFVIQLAKHVFGASKV  202

Query  780  AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG  908
            AAT+S  K+E ++ LGAD  +DYT   +E +PE +D+VYD +G
Sbjct  203  AATSSTAKLELLEKLGADLPIDYTKENFEDLPEKFDVVYDAVG  245



>ref|WP_029331573.1| NADPH:quinone reductase [Gillisia marina]
Length=319

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 124/324 (38%), Positives = 183/324 (56%), Gaps = 41/324 (13%)
 Frame = +3

Query  282   KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL---VPMNFPVIPGCDMAGIV  452
             KE L + D   P  +   +LV V+AA+LNPID+KL Q  L   VP+N PV  G D++G+V
Sbjct  2     KEGLAIEDVSKPTYKDKDILVAVKAASLNPIDYKLVQGKLKDMVPLNLPVTIGYDVSGVV  61

Query  453   VAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAAS  632
             V KG+GV+ F+IGDEVY  +         ++MG++AEF  V+  LVA KP+N++F+ A+ 
Sbjct  62    VEKGAGVSDFEIGDEVYARVPQ-------EQMGSVAEFVTVQSDLVAKKPENISFEQASG  114

Query  633   LPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEF  812
             LPL   TA Q       +E   + I  G+GGVGS A+Q AK     + V  TTS   V++
Sbjct  115   LPLTGLTAIQALEKVEIRENDRILIHAGSGGVGSFAIQYAKE--KGAIVYTTTSTKNVDW  172

Query  813   VKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENATIIDITWPPSNPR  986
             VK LGAD+V+DYTN  Y+++    D+V+DT+G   + ++F + K+   I  I  PP    
Sbjct  173   VKALGADRVIDYTNEDYKEVANNLDIVFDTLGGDYTFDAFEIIKDGGRITTIVGPPDGET  232

Query  987   AVHSGLT-------VSGEILEK------------------LKPFLESGKVKAVIDPAGPF  1091
             A   G+T       +S  I EK                  +K  +E G +K ++D   PF
Sbjct  233   AKQMGMTDYKMPEKLSELIKEKSAIYKLTWMQPNAKQLNEIKTMVEDGAIKPIVDLIYPF  292

Query  1092  HFCNVVEAFGYIETGRARGKVVIS  1163
                + ++A+ Y+ TG+A+GKV+IS
Sbjct  293   E--DGIDAYEYLATGKAKGKVIIS  314



>ref|XP_010068096.1| PREDICTED: 2-methylene-furan-3-one reductase-like [Eucalyptus 
grandis]
Length=314

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 153/223 (69%), Gaps = 5/223 (2%)
 Frame = +3

Query  252  KAWYYEEHG-PKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFP--  419
            KAW Y E G P +VLKL  D  +P  + DQ+LV+  AAALN ID K  +  L   + P  
Sbjct  14   KAWVYAELGNPNDVLKLVSDVRVPEIKEDQVLVKDVAAALNIIDAKRARGFLKDDDSPPP  73

Query  420  VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
            ++ G D+AG+VV  G  V KF +GDEVYG+I+  +L    K+ GTLAE+T VEE L+A+K
Sbjct  74   IVLGYDVAGVVVKVGDQVKKFKVGDEVYGDINEISLV-RPKQHGTLAEYTAVEERLLALK  132

Query  600  PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
            PKNL+F  AASLPL I+TA +G     F  G+S+ ++GGAGG+GSL +QLAK V+GAS V
Sbjct  133  PKNLSFAEAASLPLVIETAYEGLERTHFSPGKSILVLGGAGGIGSLVIQLAKQVFGASRV  192

Query  780  AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG  908
            AAT+S  K++ ++ LGAD  +DYT   +E +PE +D+VYD IG
Sbjct  193  AATSSTGKLDLLRNLGADLAIDYTKENFEDLPEKFDVVYDAIG  235



>gb|ACU18144.1| unknown [Glycine max]
Length=295

 Score =   177 bits (450),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 141/204 (69%), Gaps = 4/204 (2%)
 Frame = +3

Query  252  KAWYYEEHGPKEVLKL-GDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPV  422
            KAW Y E+G  +VLKL  +  +P  + DQ+L++V AAALNP+D K RQ      +   P 
Sbjct  90   KAWVYGEYGGVDVLKLDSNVAVPDVKEDQVLIKVVAAALNPVDAKRRQGKFKATDSPLPT  149

Query  423  IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
            +PG D+AG+VV  GS V  F +GDEVYG+++   LEG  K+ G+LAE+T VEE L+A KP
Sbjct  150  VPGYDVAGVVVKVGSQVKDFKVGDEVYGDVNEKALEGP-KQFGSLAEYTAVEEKLLAPKP  208

Query  603  KNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVA  782
            KNL F  AASLPLAI+TA +G    GF  G+S+ ++ G+GGVGSL +QLAK VYGAS VA
Sbjct  209  KNLDFAQAASLPLAIETAYEGLERTGFSPGKSILVLNGSGGVGSLVIQLAKQVYGASRVA  268

Query  783  ATTSAPKVEFVKCLGADKVVDYTN  854
            AT+S   ++ +K LGAD  +DYT 
Sbjct  269  ATSSTRNLDLLKSLGADLAIDYTK  292



>gb|KCW56050.1| hypothetical protein EUGRSUZ_I01805 [Eucalyptus grandis]
Length=212

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 139/210 (66%), Gaps = 8/210 (4%)
 Frame = +3

Query  540   KRMGTLAEFTVVEETLVAMKPKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvgga  719
             K+ GTLAE+  VEE+ +A+KPK L F  AASLP+ IQTA  G   AG   G+S+ ++GGA
Sbjct  5     KKDGTLAEYAAVEESFLALKPKKLRFGEAASLPVVIQTAYGGLERAGLSHGKSLLVLGGA  64

Query  720   ggvgslavqlaKHVYGASSVAATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYD  899
             GGVG+L +QLAK V+GAS VAAT+S  K+E +K LGAD  +DYT   +E +PE +D+VYD
Sbjct  65    GGVGTLIIQLAKEVFGASRVAATSSTGKLELLKSLGADLAIDYTKVNFEDLPEKFDVVYD  124

Query  900   TIGDSINSFVVAKENATIIDI-----TWPPSNPRAVHSGLTVSGEILEKLKPFLESGKVK  1064
             T+G+   +    K   +I+ I     T PP    A    +T +   LEKLKPFLESGKVK
Sbjct  125   TVGEIERAAKAVKPGGSIVTIVKQNKTLPPP---AFFFAVTSNRSTLEKLKPFLESGKVK  181

Query  1065  AVIDPAGPFHFCNVVEAFGYIETGRARGKV  1154
              VIDP  PF F   +EAF Y++T RA GK+
Sbjct  182   PVIDPKSPFPFSQAIEAFSYLQTRRATGKL  211



>ref|WP_017379106.1| NADPH:quinone reductase [Paenisporosarcina sp. TG-14]
Length=312

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 179/316 (57%), Gaps = 22/316 (7%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFPV  422
             KA   +++G KEVL+  +   P+ Q DQ+L+++   ++NPID+KLR      ++P  FP+
Sbjct  2     KAIVIDQYGDKEVLQEREIAQPIIQDDQVLLEIHTTSINPIDWKLRAGYLKEMLPFEFPI  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D AGI+V KG  V+ F++GD V+             R GT AE+  VEE L+A  P
Sbjct  62    ILGWDAAGIIVEKGKNVSNFEVGDRVFARPAT-------TRQGTYAEYVAVEENLLAHMP  114

Query  603   KNLTFKAAASLPLAIQTAAQGFRT-AGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
              +++F  AA++PLA  TA Q     +G ++   V I  GAGGVG+ A+Q+AK  +GA  V
Sbjct  115   ASMSFDEAAAIPLAGLTAWQCLVDFSGIKKDDKVLIHAGAGGVGNFAIQIAKS-FGAY-V  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN--SFVVAKENATI  953
             A T S    EFVK LGAD+V+DY N  + +I   +D+V D++G  I   S+ V K +  +
Sbjct  173   ATTASGKNEEFVKSLGADRVIDYKNEDFSEILHDFDIVLDSMGGEIQTKSYKVLKPHGKL  232

Query  954   IDITWPP----SNPRAVHSG---LTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
             + I  PP    S    V +G   L   GE L+ L    ESGK+KA+I     F+   + E
Sbjct  233   VSIAQPPIEEESKKYQVDAGFVWLEPKGEQLQHLADMYESGKLKAIIGETFDFNEKGLKE  292

Query  1113  AFGYIETGRARGKVVI  1160
             A    ET  ARGK+VI
Sbjct  293   AHALSETHHARGKIVI  308



>ref|XP_007044643.1| Quinone oxidoreductase-like protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY00475.1| Quinone oxidoreductase-like protein isoform 2, partial [Theobroma 
cacao]
Length=287

 Score =   174 bits (440),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/219 (49%), Positives = 143/219 (65%), Gaps = 13/219 (6%)
 Frame = +3

Query  252  KAWYYEEHGPKEVLKLGDFL-IPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMNFPVIP  428
            KAW Y E+G  +VLK  + + +P  + DQ+L++V AAALNP+D K RQ      + P+  
Sbjct  81   KAWVYGEYGGVDVLKFDEKVAVPRVKEDQVLIKVVAAALNPVDGKRRQGKFKATDSPL--  138

Query  429  GCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKN  608
                       GS V +   GDEVYGNI+   LEG  K+ G+LAE+T VEE L+A+KPKN
Sbjct  139  ---------PVGSQVKELKEGDEVYGNINEKALEGP-KQFGSLAEYTAVEEKLLALKPKN  188

Query  609  LTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAAT  788
            L F  AA LPLA +TA +G    GF  G+S+ ++ GAGGVGSL +QLAK V+GAS VAAT
Sbjct  189  LDFAQAAGLPLAFETAYEGLERTGFSAGKSILVLNGAGGVGSLVIQLAKQVFGASKVAAT  248

Query  789  TSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTI  905
            +S  K+E +K LGAD  +DYT   +E +PE +D+VYD I
Sbjct  249  SSTGKLELLKSLGADLAIDYTKENFEDLPEKFDVVYDAI  287



>ref|WP_025728592.1| NADPH:quinone reductase [Bacillus ginsengihumi]
Length=310

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 125/316 (40%), Positives = 182/316 (58%), Gaps = 22/316 (7%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFPV  422
             KA    ++G KE L+   F  P+ +  Q+LV+++A ++NPID+KLR+     ++P  FP+
Sbjct  2     KAVVINQYGGKEHLQEVQFPDPIIKDHQVLVEMKATSINPIDWKLREGYLKEMLPFEFPI  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D AGI+   G  VTKF +GD V+          +  R GT AEF  ++E  +A+KP
Sbjct  62    ILGWDAAGIIKKVGKAVTKFKVGDAVFAR-------PDTTRFGTYAEFVAIDEDKLALKP  114

Query  603   KNLTFKAAASLPLAIQTAAQG-FRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             +N+++  AAS+PLA  TA QG F     + G+ V I  GAGGVGSLA+Q A HV   + V
Sbjct  115   ENISYVEAASIPLAGLTAWQGLFDVLKLKAGEKVLIHAGAGGVGSLAIQFAHHV--GAYV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN--SFVVAKENATI  953
             A T S    +FVK LGAD+V+DY  T +E +   YD VYDT+G  I   S+ V K++  +
Sbjct  173   ATTASKENEDFVKSLGADEVIDYRTTAFEDVLLNYDAVYDTMGGEIQSKSYKVLKKDGRL  232

Query  954   IDITWPPSNPRA----VHSG---LTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
             + I   PS   A    V +G   L  +G+ L ++   L++G VKA++    PF    + +
Sbjct  233   VSIASYPSTEEAELYGVKAGFLWLEPNGKQLAEIGELLKTGDVKAIVGHVFPFSEQGIKD  292

Query  1113  AFGYIETGRARGKVVI  1160
             A    E+  ARGK+VI
Sbjct  293   AHALSESHHARGKIVI  308



>ref|WP_009960443.1| NADPH:quinone oxidoreductase [Verrucomicrobium spinosum]
Length=333

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 182/337 (54%), Gaps = 51/337 (15%)
 Frame = +3

Query  261   YYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL---VPMNFPVIPG  431
             +Y +HG    L+ G+   P  + + ++V++ AA +N +D K+R   L   +P   P++ G
Sbjct  8     HYAKHG---ALRPGESPTPELRDNDVMVEIHAAGVNLLDHKIRSGELKLILPYRLPLVLG  64

Query  432   CDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNL  611
              D+AG+VV  GS V +F +GDEVY             R+GT AE+  ++E  VAMKP NL
Sbjct  65    NDVAGVVVRVGSNVRRFKLGDEVYARPAQ-------DRIGTFAEYIAMDEADVAMKPANL  117

Query  612   TFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAAT  788
             T + AASLPL   TA Q     A  Q+GQ V I  G+GGVG++A+QLA+H+   + VA T
Sbjct  118   TMEEAASLPLVALTAWQVLVERANLQKGQKVLIHAGSGGVGTIAIQLARHL--GAHVATT  175

Query  789   TSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG-DSI-NSFVVAKENATIIDI  962
             TS   V+ VK LGAD VVDY N  +E++ + YD+V +++G D++  S  V K    +I I
Sbjct  176   TSTANVDLVKSLGADVVVDYKNDDFEKVLQGYDVVLNSLGKDTLEKSLAVLKPGGKLISI  235

Query  963   TWPPSNPRAVHSGLT-------------------------------VSGEILEKLKPFLE  1049
             + PP    A   GL                                 +G  L ++   +E
Sbjct  236   SGPPDPDLAREQGLNWIMQKIVSLLSFGIRRKAQSRQISYSFLFMRANGAQLSQITSLIE  295

Query  1050  SGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVI  1160
             +GK++ V+D   PF   N  EA  Y+ETGRA+GKV+I
Sbjct  296   AGKIRPVVDRVFPFESTN--EAMAYVETGRAKGKVII  330



>ref|WP_037195561.1| NADPH:quinone oxidoreductase [Rhizobium sp. OK494]
Length=333

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 186/341 (55%), Gaps = 48/341 (14%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTS---LVPMNFPV  422
             KA+  + +     L+LG+   P  + D++LV++ AA++NP+D K+R      ++P   P+
Sbjct  2     KAFLIDRYAKGAALRLGEVPEPELREDEVLVRIHAASVNPVDAKIRDGEFKLVLPYRLPL  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D AG+VV  GS V KF  GDEVYG            R+GT AEF  + E  VAMKP
Sbjct  62    ILGNDAAGVVVRVGSKVRKFKTGDEVYGRPAK-------DRIGTFAEFIAINEADVAMKP  114

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             KNLT + AAS+PL   TA Q     A  ++GQ + I  G+GGVG++A+QLAKH+   ++V
Sbjct  115   KNLTMEEAASVPLVALTAWQALVDRANLKKGQKILIHAGSGGVGAIAIQLAKHI--GATV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG-DSI-NSFVVAKENATI  953
             A TTS   V+ V+ LGAD VVDY    +E + + YD+V +++G D++  S  V K    +
Sbjct  173   ATTTSTANVDLVRSLGADVVVDYKKDDFENVLQGYDVVLNSLGKDTLEKSLRVLKPGGKL  232

Query  954   IDITWPPSNPRAVHSG-------------------------------LTVSGEILEKLKP  1040
             I I+ PP    A  SG                               +  SG  LE++  
Sbjct  233   ISISGPPDPEFARESGSGWLLRQAMRLLSFSIRRKSKRHRVSYSFLFMKPSGGQLEQIAS  292

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVIS  1163
              +E+G ++ V+D   PF   N  EA  Y+ETGRARGKVVI+
Sbjct  293   LIEAGAIRPVVDRVFPFEKTN--EALAYVETGRARGKVVIA  331



>ref|WP_036262605.1| NADPH:quinone oxidoreductase [Methylocapsa aurea]
Length=333

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 126/342 (37%), Positives = 188/342 (55%), Gaps = 50/342 (15%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTS---LVPMNFPV  422
             K++  + +     L+LG+   P  + + ++V++ AA +NP+D K+R      ++    P+
Sbjct  2     KSFLIDRYKKGGALRLGEMSEPKLRENDVMVEIHAAGVNPVDSKIRDGEFKLILRYRLPL  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D+AG+V   GS VT+F  GDEVY +           R+GT AEF  +++  VA+KP
Sbjct  62    ILGSDLAGVVTRVGSKVTRFSPGDEVYAHPGQ-------DRIGTFAEFIAIDQANVALKP  114

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             KNLT + AAS+PL   TA Q     A  Q+GQ V I  G+GGVG++A+QLAKH+   + V
Sbjct  115   KNLTMEEAASIPLVALTAWQVLVERANLQKGQKVLIHAGSGGVGTIAIQLAKHL--GAYV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG-DSI-NSFVVAKENATI  953
             A TTS   V  VK LGAD VVDY N  +E++ + YD+V +++G D++  S  V K    +
Sbjct  173   ATTTSTANVALVKSLGADVVVDYKNDDFEKVLQGYDVVLNSLGKDTLEKSLGVLKPGGKL  232

Query  954   IDITWPPSNP----------------RAVHSG----------------LTVSGEILEKLK  1037
             I I+ PP +P                R + SG                +T +G  L K+ 
Sbjct  233   ISISGPP-DPDFAKENGSGWLLQQVMRLLSSGIRRKSKRRGINYSFLFMTANGRQLGKIT  291

Query  1038  PFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVIS  1163
               +E+G ++ V+D   PF   N  EA  Y+ETGRA+GKVV++
Sbjct  292   SLIEAGDIRPVMDRVFPFEKTN--EALAYVETGRAKGKVVVT  331



>ref|WP_018663535.1| hypothetical protein [Bacillus acidiproducens]
Length=310

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 177/317 (56%), Gaps = 22/317 (7%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFPV  422
             KA    ++G K+ L+  +  IP  Q  Q+LVQ++A ++NPID+KLR+     ++P +FP+
Sbjct  2     KAVVINQYGGKDRLQEAEVPIPSIQDHQVLVQMKATSVNPIDWKLREGYLKDMLPFDFPI  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D AGI+   G  V  F +GD V+          +  R GT AEF  ++E  +A+KP
Sbjct  62    ILGWDAAGIITETGKSVKNFKVGDAVFARP-------DTTRNGTYAEFVAIDEDKLALKP  114

Query  603   KNLTFKAAASLPLAIQTAAQG-FRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
              N++F+ AAS+PLA  TA QG +   G + G+ + I  GAGGVGSLA+Q A H    + V
Sbjct  115   PNVSFEEAASVPLAGLTAWQGLYDVLGLKAGEKILIHAGAGGVGSLAIQFAHHT--GAYV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN--SFVVAKENATI  953
             A T SA    FVK LGAD  +DY    +E+I + +D VYDT+G  I   S+ + K+   +
Sbjct  173   ATTASAENGAFVKNLGADMAIDYRTEHFEEILKDFDAVYDTLGGRIQSGSYQILKKGGRL  232

Query  954   IDITWPPSNPRAVHSG-------LTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
             + I   P    A   G       L  +G+ L ++   L+SG VKA++    PF    V E
Sbjct  233   VSIAEAPKQEEAEKYGVKADFLWLQPNGKQLAEIGELLQSGTVKAIVGQTFPFSQQGVRE  292

Query  1113  AFGYIETGRARGKVVIS  1163
             A    E+  ARGK+VI+
Sbjct  293   AHALSESHHARGKIVIT  309



>emb|CEG23753.1| Zinc-type alcohol dehydrogenase-like protein [Planomicrobium 
sp. ES2]
Length=311

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 124/317 (39%), Positives = 175/317 (55%), Gaps = 22/317 (7%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFPV  422
             KA   EE+G KE LK  D  +P    +Q+L++V A ++NPID+KLR+     + P  FP+
Sbjct  2     KAIVIEEYGGKEQLKEKDMPMPKMADNQVLLEVHATSINPIDWKLREGYLKEMQPFEFPI  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D AG++V  G  V  F +GD V+       +  EL R GT AEF  VEE L+A  P
Sbjct  62    ILGWDAAGVIVETGKDVKDFKVGDRVF-------VRPELTREGTYAEFIAVEEHLLAKMP  114

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
               +TF+  A++PL   TA +     AG +EG  V +  GAGGVG+ A+Q+AK  +GA  V
Sbjct  115   DAMTFEEGAAIPLVGLTAWECLVEVAGVKEGDKVLVHAGAGGVGTNAIQIAKS-FGAY-V  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN--SFVVAKENATI  953
             AAT S+   E ++ LGAD+V+DY    +E++   +D+V DT+G+ +   SF V K+   +
Sbjct  173   AATASSQNRELLESLGADQVIDYKEEAFEEVINDFDIVLDTMGEDVQEKSFGVLKKGGML  232

Query  954   IDITWPPSNPRAVHSG-------LTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
             + I  PP    A   G       L   GE L KL    E GK+K VI     F   ++ +
Sbjct  233   VSIAQPPDEETAKKHGVKTGYVFLQPEGEKLRKLAKLYEEGKLKPVIGETYGFSAKDLQD  292

Query  1113  AFGYIETGRARGKVVIS  1163
             A    ET  A+GK+VI 
Sbjct  293   AHASSETHHAKGKIVIK  309



>ref|WP_004651427.1| chlorophyll synthesis pathway protein BchC [Acinetobacter bohemicus]
 gb|ENU20059.1| chlorophyll synthesis pathway protein BchC [Acinetobacter bohemicus 
ANC 3994]
Length=332

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 125/340 (37%), Positives = 183/340 (54%), Gaps = 50/340 (15%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFPV  422
             KA Y   +G    ++LG+   PV   + +L+QV AA++NP+D ++ +    +++P+ FP 
Sbjct  2     KAAYINRYGNINDVQLGEQSTPVLTENDVLIQVHAASINPLDLRVLEGEFKAILPVQFPF  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D AG VV  G+ V  F  GDEVY    + N        G  AE+TVV+++ +A+KP
Sbjct  62    ILGNDFAGTVVQVGANVNNFKAGDEVYAKT-DLN--------GAFAEYTVVQQSSLALKP  112

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             KN++ + AASLPL   TA Q     A  + GQ V I  G+GGVGS+A+QLAK  Y  ++V
Sbjct  113   KNISMELAASLPLVSLTAWQALVEIAKVKAGQKVLIHAGSGGVGSVAIQLAK--YLGATV  170

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSI--NSFVVAKENATI  953
             A TTS   + +V  LGAD ++DY  T +EQ+ + YD+V DT G  I   S  + K    I
Sbjct  171   ATTTSGKNIHWVSALGADIIIDYKTTDFEQVLKDYDVVLDTQGGKILEKSLNIVKRGGRI  230

Query  954   IDITWPPSNP------------------------RAVHSGLTVS-------GEILEKLKP  1040
             I I+ PP                           +A   G+T S       G+ L ++  
Sbjct  231   ISISGPPDRAFAEAIKANWLLKGIIPLLSWSIRNKAKKRGITYSFLFMQPNGQQLSEISK  290

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVI  1160
              +ESGK+  V+D    + F  + +AF Y+ TGRA+GKVV+
Sbjct  291   LVESGKINPVVDKT--YEFSEIKDAFQYVNTGRAKGKVVL  328



>ref|WP_016988523.1| zinc-type alcohol dehydrogenase [Flavobacterium sp. ACAM 123]
Length=327

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 116/324 (36%), Positives = 178/324 (55%), Gaps = 41/324 (13%)
 Frame = +3

Query  282   KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKL---RQTSLVPMNFPVIPGCDMAGIV  452
             KE L + +   P  Q + +LV+V+AA+LNPID+K+   +   ++ ++ P+  G D++G+V
Sbjct  13    KESLSINEIEKPSLQPNDILVEVKAASLNPIDYKMVEGKLKDMISLDLPITIGFDVSGVV  72

Query  453   VAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAAS  632
             V K + VT F+IGDEVY  +         ++MGT+AEF  +   LVA+KPKN++F+ AA 
Sbjct  73    VEKSADVTNFEIGDEVYSRVPQ-------EQMGTVAEFVTINSDLVAIKPKNISFEEAAG  125

Query  633   LPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEF  812
             LPL   TA Q   + G +E   + I  G+GGVGS A+Q AK     + V  TTS+  V++
Sbjct  126   LPLIGLTAIQALESVGIKENDRILIHAGSGGVGSFAIQYAKA--KGAIVYTTTSSKNVDW  183

Query  813   VKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENATIIDITWPPSNPR  986
             VK LGAD+V+DY    Y+ I    D+V+DT+G+  + ++F + KE   +  I  PP    
Sbjct  184   VKALGADRVIDYKTENYKDIANNLDIVFDTLGNEYTFDAFEIIKEGGKVTTIVGPPDEET  243

Query  987   AVHSGLTVSG--EILEKL-----------------------KPFLESGKVKAVIDPAGPF  1091
             A H G+      E L KL                          +E   +K V+D    +
Sbjct  244   ATHMGMKDYKLPEKLSKLIEHKSAIYKLTWMQPDVDQLNIITKMIEDADIKTVVDLI--Y  301

Query  1092  HFCNVVEAFGYIETGRARGKVVIS  1163
                + ++A+ Y+ TGRA+GKV+IS
Sbjct  302   SLEDGIDAYLYLATGRAQGKVIIS  325



>ref|WP_004127496.1| putative zinc-binding protein oxidoreductase [Rhizobium freirei]
 gb|ENN84330.1| putative zinc-binding protein oxidoreductase [Rhizobium freirei 
PRF 81]
Length=333

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 127/341 (37%), Positives = 183/341 (54%), Gaps = 48/341 (14%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTS---LVPMNFPV  422
             KA+  + +     ++LG    P  + + ++VQV AA +NP+D K+R      ++P   P+
Sbjct  2     KAFLIDRYAKGGAVRLGQSPEPELRENDVMVQVHAAGVNPLDAKIRDGEFKLILPYRLPL  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D+AG+VV  GS V  F  GDEVY   +         R+GT AEF  ++E  VAMKP
Sbjct  62    ILGNDVAGVVVRVGSKVRSFKPGDEVYARPNK-------DRIGTFAEFIAMDEADVAMKP  114

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             KNLT + AAS+PL   TA Q     A  + GQ V I  G+GGVG++A+QLAKH+   + V
Sbjct  115   KNLTMEEAASMPLVALTAWQVLVGRANLERGQKVLIHAGSGGVGAVAIQLAKHI--GAQV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG-DSI-NSFVVAKENATI  953
             A TTS   V+ VK LGAD VVDY    +E++   YD+V +++G D++  S  V K    +
Sbjct  173   ATTTSTANVDLVKSLGADVVVDYRKDDFEEVLRGYDVVLNSLGKDTLEKSLRVLKPGGKL  232

Query  954   IDITWP--PSNPRAVHSG-----------------------------LTVSGEILEKLKP  1040
             I I+ P  P+  R   SG                             +T +G  L+++  
Sbjct  233   ISISGPPDPAFARQSSSGWLLRQVMRLLSAGIRRKSKRHGVTYSFVFMTANGAQLDQITS  292

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVIS  1163
              +E+G ++ V+D   PF   N  EA  Y+ETGR +GKVVI+
Sbjct  293   LIEAGAIRPVMDKIFPFESTN--EALAYVETGRVKGKVVIT  331



>ref|WP_037319072.1| NADPH:quinone reductase [Salegentibacter sp. Hel_I_6]
Length=327

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 113/324 (35%), Positives = 178/324 (55%), Gaps = 41/324 (13%)
 Frame = +3

Query  282   KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFPVIPGCDMAGIV  452
             K+ L + +   P  + +Q+LV+V+AA+LNPID+K+ Q     L+ ++ PV  G D++G+V
Sbjct  13    KDSLSINEIEKPSVKSNQILVEVKAASLNPIDYKMAQGHLKELLTLDLPVTIGFDVSGVV  72

Query  453   VAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAAS  632
             V KG+ V+ F IGDE+Y  +         + MGT+AEF  +    VA KP+N++F+ A+ 
Sbjct  73    VEKGADVSDFKIGDEIYSRVPQ-------EEMGTVAEFVAISADKVAKKPENISFEEASG  125

Query  633   LPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEF  812
             LPL   TA Q    AG +E   + I  G+GGVGS A+Q AK     + V  TTS+  V++
Sbjct  126   LPLTGITAIQALEKAGIKEDDRILIHAGSGGVGSFAIQYAKA--KGAIVYTTTSSKNVDW  183

Query  813   VKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENATIIDITWPPSNPR  986
             VK LGAD+V+DY    Y+++    D+V+DT+GD  + ++F + KE   +  I  PP    
Sbjct  184   VKALGADRVIDYKEEDYKEVANNLDIVFDTLGDDYTFDAFEIVKEGGVVTSIVGPPDEES  243

Query  987   A-------------------------VHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPF  1091
             A                          H+ +  +   L+ +K  +E G +K  +D    +
Sbjct  244   AKIMGIKDYKLPEELSKLAKEKSVAYKHTWMQPNAAQLKGIKTMVEEGDIKPTVDLI--Y  301

Query  1092  HFCNVVEAFGYIETGRARGKVVIS  1163
              F + ++A+ Y+ TGRA GKV+IS
Sbjct  302   DFKDGIDAYEYLATGRAEGKVIIS  325



>ref|XP_005713109.1| unnamed protein product [Chondrus crispus]
 emb|CDF33306.1| unnamed protein product [Chondrus crispus]
Length=308

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 180/307 (59%), Gaps = 11/307 (4%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN--FPVI  425
             +A + +++G     ++GD  +P P   ++L++V AA LNPID K R     P +  FPV+
Sbjct  5     RALHQKKYGDVSTFEMGDLPVPTPGTSEVLLRVHAAGLNPIDLK-RSYLCNPDDETFPVV  63

Query  426   PGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPK  605
              G D+AG+V + GSGVT F  GD V+G+    +  G  K  GT+AEF V ++ L+A  P+
Sbjct  64    TGYDVAGVVESVGSGVTDFAPGDRVFGDPQEPS--GAAKSTGTVAEFCVGKQHLLARMPE  121

Query  606   NLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAA  785
               +F  AA+LP+A  TA Q    AG +EG  +FI GGAGGVG  A+Q+AK ++GAS VA 
Sbjct  122   GTSFVEAAALPVAACTAVQALEIAGLKEGDKLFISGGAGGVGIHAIQIAKALFGASEVAT  181

Query  786   TTSAPKVEFVKCLGADKVVDYTNTTYEQIPETY-DLVYDTIGDSINSFVVAKENATIIDI  962
             T SA K +FVK  GADKVVDY      ++   + D+  DT  +S     V KE  +++ I
Sbjct  182   TASAVKTDFVKMYGADKVVDYKTEDAGKVLAGWADVALDTTSESEMEKRVLKEGGSLVSI  241

Query  963   T-WPPSNPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYIETGR  1139
               +     RA+   L    ++LE+L   L+ GK+KAV+D    +     V+A  ++  GR
Sbjct  242   AEFGTPGVRAMM--LEPGRKLLEQLAKLLKEGKLKAVVDSV--YELEEGVKAVQHVAGGR  297

Query  1140  ARGKVVI  1160
             A+GKVV+
Sbjct  298   AKGKVVV  304



>ref|WP_026915809.1| NADPH:quinone reductase [Gramella portivictoriae]
Length=333

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 123/335 (37%), Positives = 183/335 (55%), Gaps = 42/335 (13%)
 Frame = +3

Query  252   KAWYYEEHGP-KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFP  419
             KA   +++G  KE L+  +   P    + +LV V+AAALNPID+KL Q     ++ ++ P
Sbjct  2     KALQIKKYGEIKEGLEFAETSKPEISDNDVLVAVKAAALNPIDYKLVQGHLKDMLKLDLP  61

Query  420   VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
                G DM+G +V  G  V  F +GDEVYG +           MGT+AEF  V+  ++A K
Sbjct  62    TGIGYDMSGEIVEIGKKVKNFKVGDEVYGRVPQ-------DYMGTVAEFVAVDANVIAHK  114

Query  600   PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             P+N+TF+ A+SLPLA  TA Q  + A  ++   + I  G+GGVGS A+Q AK +   + V
Sbjct  115   PENVTFEKASSLPLAGLTAMQALQKADIKKDDRILIHAGSGGVGSFAIQYAKSI--GAIV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENATI  953
               TTS   VE+VK LGAD+V+DY N  Y+++    D+V+DT+GD  + ++F + K+   +
Sbjct  173   NTTTSDTNVEWVKALGADRVIDYKNEDYKEVANNLDIVFDTLGDQYTFDAFEIIKDGGKV  232

Query  954   IDITWPPSNPRAVHSGLT-------VSGEILEK------------------LKPFLESGK  1058
               I  PP    A   G+T       +S  I EK                  +K  +E   
Sbjct  233   TSIVGPPDEKTAKQMGMTNYEMPEKLSKLIQEKSAQYTLTWMQPNAAQLQEIKTMVEDRT  292

Query  1059  VKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVIS  1163
             ++ VID    + F   V+AF Y+ TGRA+GKV++S
Sbjct  293   IRPVIDLV--YSFNKAVDAFEYLATGRAQGKVIVS  325



>ref|WP_031365089.1| NADPH:quinone oxidoreductase [Burkholderia sordidicola]
Length=333

 Score =   171 bits (432),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 125/340 (37%), Positives = 174/340 (51%), Gaps = 48/340 (14%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTS---LVPMNFPV  422
             KA+  + +G K  ++ GD  +P P+ D +L+Q+ AA +NP+D K+R      ++P   P+
Sbjct  2     KAFIIDRYGRKNGIRTGDMPMPEPREDDVLIQIHAAGVNPVDSKIRDGEFKLILPYRLPL  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D+AG+VV  GS   +F  GDE+Y      ++       GT AEF  V+E  VA+KP
Sbjct  62    ILGNDLAGVVVRVGSRARRFKPGDEIYARPQKDHI-------GTFAEFIAVKEDAVALKP  114

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAG-FQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
              +LT + AAS+PL   TA Q     G  + GQ V I  G+GGVG+ A+QLAKHV   ++V
Sbjct  115   ASLTMEEAASIPLVGLTAWQALIEKGQLKRGQKVLIHAGSGGVGTFAIQLAKHV--GATV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSI--NSFVVAKENATI  953
             A TTSA  +E VK LGAD V+DY    +  I + YD+V DT G +    S  V K    +
Sbjct  173   ATTTSARNIELVKRLGADIVIDYKKDDFSSILKDYDVVLDTQGGNALEKSLRVLKPGGKL  232

Query  954   IDITWPPSNPRAVHSG-------------------------------LTVSGEILEKLKP  1040
             I I  PP    A   G                               +   G  L ++  
Sbjct  233   IGIAGPPDPDFAKEMGASWFLKTVMRFLSYRIRKAAKRHGVSYSFLFMRADGGQLSQIAK  292

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVI  1160
              +++G +K VID   PF      EA  Y+ETGR +GKVVI
Sbjct  293   LIDAGAIKPVIDQVFPFESTK--EALTYVETGRVKGKVVI  330



>gb|KCW56054.1| hypothetical protein EUGRSUZ_I01807 [Eucalyptus grandis]
Length=231

 Score =   167 bits (424),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 147/223 (66%), Gaps = 10/223 (4%)
 Frame = +3

Query  252  KAWYYEEHGP-KEVLKLG-DFLIPVPQHDQLLVQVQAAALNPIDF-KLRQTSLVP-MNFP  419
            KAW Y EHG   +VL L  +  +P  Q  Q+LV+V AA LNP D  +++    +P  + P
Sbjct  12   KAWVYREHGNVADVLGLDPELEVPKLQEGQVLVKVLAATLNPADAARVKGVFQLPGFSLP  71

Query  420  VIPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMK  599
             +PG D+AG+VV  G  V +  +GDEVYG + +       K+ GTLAE+  VEE+ +A+K
Sbjct  72   AVPGYDLAGVVVKVGREVKELKVGDEVYGFMWH------AKKDGTLAEYAAVEESFLALK  125

Query  600  PKNLTFKAAASLPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
            PK L F  AASLP+ IQTA  G   AG   G+S+ ++GGAGGVG+L +QLAK V+GAS V
Sbjct  126  PKKLRFGEAASLPVVIQTAYGGLERAGLSHGKSLLVLGGAGGVGTLIIQLAKEVFGASRV  185

Query  780  AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIG  908
            AAT+S  K++ +K LGAD  +DYT   +E +PE +D+VYDT+G
Sbjct  186  AATSSTGKLDLLKSLGADLAIDYTKVNFEDLPEKFDVVYDTVG  228



>ref|WP_007805493.1| NADPH:quinone oxidoreductase [Flavobacterium sp. CF136]
 gb|EJL65839.1| Zn-dependent oxidoreductase, NADPH:quinone reductase [Flavobacterium 
sp. CF136]
Length=334

 Score =   170 bits (431),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 123/341 (36%), Positives = 183/341 (54%), Gaps = 49/341 (14%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL---VPMNFPV  422
             KA+  + +G KE L L D+  P    +++LVQ+ AAA+N  D  L+       +P   P 
Sbjct  2     KAFIVKRYGKKEKLHLTDWSEPTVNENEVLVQINAAAINLSDTLLKNGDFKIFLPYKTPF  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             + G DMAG+V+  G+ V KF +GDEVY    +F       ++GT AE+  V E  +A+KP
Sbjct  62    VNGQDMAGVVIKVGAKVAKFKVGDEVYARPSDF-------KIGTFAEYIAVNENDLALKP  114

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             KNL+ + +AS+P+   T+ Q   + A  ++GQ VFI  G+GGVG+ A+QLAKH+   + V
Sbjct  115   KNLSMEESASIPVVGLTSWQVLVKIAKLKKGQKVFIQAGSGGVGTFAIQLAKHI--GAYV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSI---NSFVVAKENAT  950
             A TTS   +E+VK LGAD V+DY    +  I + YD+V  +  D+    NS  + K+  T
Sbjct  173   ATTTSTTNIEWVKSLGADLVIDYKKEDFVNILKDYDVVLHSNKDAKVLENSLKILKQGGT  232

Query  951   IIDITWPPSNPRAVHSGLTVSGEILEKLKPF-----------------------------  1043
             ++ +T PP+   A   GL    ++L  L  F                             
Sbjct  233   LVSLTGPPTAEFAKEIGLGWHLQMLTNLLSFSVRRKAKKLNVNFKFLFMKPEGKQLSEIT  292

Query  1044  --LESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVI  1160
               +E+GK++ +ID   PF   N  EA  Y+ETGRA+GKVV+
Sbjct  293   ALIEAGKIRPIIDKVFPFEQTN--EAMAYVETGRAKGKVVV  331



>ref|WP_026934229.1| NADPH:quinone reductase [Gramella echinicola]
Length=327

 Score =   170 bits (430),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 116/324 (36%), Positives = 179/324 (55%), Gaps = 41/324 (13%)
 Frame = +3

Query  282   KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFPVIPGCDMAGIV  452
             K+ LK  +   P     ++L++V+AAALNPID+K+ Q     L+ ++ PV  G D++G +
Sbjct  13    KDSLKFAEIDKPHISDSEILIEVKAAALNPIDYKIVQGHLKELLQLDLPVTIGYDVSGKI  72

Query  453   VAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAAS  632
                GS V  F +GDEVY  +         + MGT+AEF  V+ ++VA KP+N+TF+ A+S
Sbjct  73    SEVGSKVKNFKVGDEVYARVPQ-------EYMGTVAEFVTVDSSVVAHKPENVTFEKASS  125

Query  633   LPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEF  812
             LPL   TA Q     G ++   + I  G+GGVGS AVQ AK     + V  TTS+  +++
Sbjct  126   LPLTGLTAIQALEKVGLKKDDRILIHAGSGGVGSFAVQYAKA--KGAIVYTTTSSTNLDW  183

Query  813   VKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENATIIDITWPPSNPR  986
             VK LGAD+V+DY N  Y+++ +  D+V+DT+GD  +  +F + KE  +I  I  PP    
Sbjct  184   VKALGADRVIDYKNEDYKEVAQDLDIVFDTLGDDFTFEAFDIIKEGGSITTIVGPPDADS  243

Query  987   A-------------------------VHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPF  1091
             A                          H+ +    E L+++K  +E  K++  ID    +
Sbjct  244   AKQMGIDNYQLPEKLSKLIKEKSANYKHTWMQPDAEQLKEIKEMVEDRKIRPSIDLV--Y  301

Query  1092  HFCNVVEAFGYIETGRARGKVVIS  1163
              F + V+AF Y+ TGRA+GKV++S
Sbjct  302   SFDDAVKAFEYLATGRAQGKVIVS  325



>ref|WP_006987246.1| Alcohol dehydrogenase zinc-binding domain protein [Gillisia limnaea]
 gb|EHQ04354.1| Alcohol dehydrogenase zinc-binding domain protein [Gillisia limnaea 
DSM 15749]
Length=327

 Score =   170 bits (430),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 114/324 (35%), Positives = 179/324 (55%), Gaps = 41/324 (13%)
 Frame = +3

Query  282   KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKL---RQTSLVPMNFPVIPGCDMAGIV  452
             K+ L + +   PV + + LLV+V+AAALNPID+K+   +   ++ +N P   G D++G+V
Sbjct  13    KDSLSINEVEKPVIKPNDLLVEVKAAALNPIDYKMVEGKLKDMISLNLPSTIGFDVSGVV  72

Query  453   VAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAAS  632
             V KG+ V  F+IGDEVY  +         ++MGT+AEF  V   LVA KP+N++F+ A+ 
Sbjct  73    VEKGADVKNFEIGDEVYARVPQ-------EQMGTVAEFVAVNSGLVAKKPENISFEQASG  125

Query  633   LPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEF  812
             LPL   TA Q  +  G +E   + I  G+GGVGS A+Q AK     + V  TTS   V++
Sbjct  126   LPLTGLTAIQALQKVGIKEDDRILIHAGSGGVGSFAIQYAKA--KGAIVYTTTSTKNVDW  183

Query  813   VKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENATIIDITWPPSNPR  986
             VK LGAD+V+DY    Y+++    D+V+DT+GD  + ++F + KE   +  I  PP    
Sbjct  184   VKALGADRVIDYKTEDYKEVANNLDIVFDTLGDDYTFDAFEIIKEGGKVTTIVGPPDEET  243

Query  987   AVHSGLTV-------------------------SGEILEKLKPFLESGKVKAVIDPAGPF  1091
             A   G+T                          + E L+++   +E   +K ++D    +
Sbjct  244   AKQMGMTDYKLPEKLSKLIEKKSAVYKLTWMQPNAEQLKEITTMVEDIAIKPIVDLI--Y  301

Query  1092  HFCNVVEAFGYIETGRARGKVVIS  1163
                + ++A+ Y+ TGRA+GKV+IS
Sbjct  302   SLEDGIDAYEYLATGRAKGKVIIS  325



>ref|WP_036058714.1| NADPH:quinone reductase [Listeria weihenstephanensis]
 gb|EUJ41545.1| alcohol dehydrogenase [Listeria weihenstephanensis FSL R9-0317]
Length=311

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 126/318 (40%), Positives = 180/318 (57%), Gaps = 23/318 (7%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPMN---FPV  422
             KA   E +G K++LK  +   P P+ +Q++V+++A ++NPID+KLR+  L  M    FP+
Sbjct  2     KAVIIENYGGKDMLKEAEVATPKPEANQVVVEMKATSINPIDWKLREGYLKQMMDWPFPI  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D AG++   G GVT + +GD+V+          E  R GT AE+ +V+  L+A  P
Sbjct  62    ILGWDAAGVISEVGEGVTDWKVGDKVFAR-------PETTRFGTYAEYALVDAPLLAKIP  114

Query  603   KNLTFKAAASLPLAIQTAAQG-FRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
              N++F  AAS+PLA  TA Q  F  A  Q G+ V I  GAGGVG+LA+QLAK+    + V
Sbjct  115   DNVSFDEAASIPLAGLTAWQALFDHANLQAGEKVLIHAGAGGVGTLAIQLAKN--AGAHV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSI--NSFVVAKEN-AT  950
               T S    +F+K LGAD+V+DY  T +  +    D+V+DT+G  I  +SF V KEN   
Sbjct  173   ITTASEKNADFLKELGADEVIDYKTTNFADVLTDVDVVFDTMGGDIQKDSFKVLKENTGR  232

Query  951   IIDITWPPS-------NPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVV  1109
             +I I   P        N  A    L  +GE L+     +E+GKVKA++    PF    V 
Sbjct  233   LISIVAEPDQELAKAKNVVAKSIWLEPNGEQLQAFAGLMEAGKVKAIVGATFPFSAQGVY  292

Query  1110  EAFGYIETGRARGKVVIS  1163
             +A    ET  A+GK+VIS
Sbjct  293   DAHALSETHHAKGKIVIS  310



>ref|WP_034852264.1| NADPH:quinone oxidoreductase [Ensifer sojae]
Length=333

 Score =   169 bits (429),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 182/341 (53%), Gaps = 48/341 (14%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPM---NFPV  422
             KA+  +++  K  L+ GD   P  Q D +LV++ AA LNP+DFK+R   L P+     P 
Sbjct  2     KAFILDKYKKKGALRFGDMPEPALQDDDILVEIHAAGLNPLDFKIRDGELKPLLSYRPPF  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D+AG VV  GS V +F  GDEVY    +        R+GT AEF  + E   A+KP
Sbjct  62    ILGHDVAGTVVRVGSKVRQFKPGDEVYARPRD-------GRVGTFAEFIAMNEADAALKP  114

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             KNLT + AAS+PLA  TA Q     AG ++GQ V I  G+GGVG+ A+QLAKH+   ++V
Sbjct  115   KNLTMEEAASVPLAALTAWQVLVERAGLRKGQKVLIHAGSGGVGTFAIQLAKHL--GATV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTI-GDSIN-SFVVAKENATI  953
             A TTS   V+ V+ LGAD V+DY    +E +   YD+V +++ GD++  S  V K    +
Sbjct  173   ATTTSTANVDLVRNLGADVVIDYKKENFEDVLSGYDVVLNSLDGDTLQKSLKVLKPGGNL  232

Query  954   IDITWPPSNPRAVHSGLT-------------------------------VSGEILEKLKP  1040
             I I+ PP    A   GL                                 +GE L ++  
Sbjct  233   ISISGPPDPAFARKQGLNWFMQQVLRIPSFSIRRKAKGRGVGYSFLYMLANGEQLRQIAS  292

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVIS  1163
              +E+G ++ V+D   PF   N  EA  YIETGR++GKVV+ 
Sbjct  293   LIEAGILRPVVDRVFPFEVTN--EALAYIETGRSKGKVVVK  331



>ref|WP_027052265.1| NADPH:quinone oxidoreductase [Mesorhizobium loti]
Length=333

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 132/340 (39%), Positives = 179/340 (53%), Gaps = 48/340 (14%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTS---LVPMNFPV  422
             KA+  +++  K  L+L +   P  + + +LV+V AA +N +D KLR      +VP   P 
Sbjct  2     KAFVVDKYQKKGALRLAEMPEPELRDNDVLVEVHAAGVNLVDSKLRDGEFKLIVPYRTPF  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D+AGIVV  GS V KF  GDEVY    +        R+GT AEF  ++E  VA+KP
Sbjct  62    ILGHDVAGIVVRAGSKVRKFKPGDEVYARPRD-------GRIGTFAEFIAIDEADVALKP  114

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             KNL+ + AAS+PL   TA Q    TAG ++GQ VFI  G+GGVG+ A+QLAKH+   + V
Sbjct  115   KNLSMEEAASIPLVGLTAWQVLVETAGLKKGQKVFIQAGSGGVGTFAIQLAKHL--GAIV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSI--NSFVVAKENATI  953
             A T SA   + +K LGAD VVDY    +E+I + YD+V ++        S  V K    +
Sbjct  173   ATTASAANTDLLKGLGADIVVDYKKDDFEKILKGYDVVLNSQDAKTLEKSLHVLKPGGKL  232

Query  954   IDITWPPSNPRAVHSGLTV-------------------------------SGEILEKLKP  1040
             I I+ PP    A   GL +                                G+ L K+  
Sbjct  233   ISISGPPDPAFASKQGLNMVLKLIMRLLSRGIRGKARRAGVDYSFLFMWAQGDQLGKITS  292

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVI  1160
              +ESG ++ VID   PF   N  EA  Y+ETGRA+GKVVI
Sbjct  293   LIESGVIRPVIDRTFPFEKTN--EALAYVETGRAKGKVVI  330



>ref|WP_039692120.1| NADPH:quinone oxidoreductase [Dickeya solani]
 gb|KHN59771.1| NADPH:quinone oxidoreductase [Dickeya solani]
Length=333

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 123/340 (36%), Positives = 182/340 (54%), Gaps = 48/340 (14%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTS---LVPMNFPV  422
             KA+  + +G +   ++G+   P  Q D +L+QV AA +N +D K+R      ++P   P+
Sbjct  2     KAFIIDRYGRRSSGRIGEMPEPELQGDDVLIQVHAAGVNLLDAKIRNGEFRLILPYRLPL  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
               G D+AG+VV  G  VT+F  GDEVY            +R+GT AEF  V+E  +A+KP
Sbjct  62    ALGNDVAGVVVRVGPKVTRFRPGDEVYARPDQ-------ERIGTFAEFIAVKEDSLALKP  114

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
              NL+ + AAS+PL   TA Q    TA  ++GQ V I  G+GGVG++A+QLAKH+   + V
Sbjct  115   GNLSMEEAASIPLVSLTAWQVLVETAKLKKGQKVLIHAGSGGVGAIAIQLAKHL--GAFV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSI--NSFVVAKENATI  953
             A TT    VE+VK LGAD V+DY    +E +   YD+V +++G+ +   S  V +    +
Sbjct  173   ATTTGTSNVEWVKALGADMVIDYRKQDFETVLHGYDVVLNSLGNDVLEKSLRVLRPGGQL  232

Query  954   IDITWPPSNPRAVHSGLT-------------------------------VSGEILEKLKP  1040
             I I+ PP    A   GL+                                SGE L+++  
Sbjct  233   ISISGPPVPEFAAEQGLSWGLKQVMRLLSYRIRKQARQKGVSYAFVFMRASGEQLDEISA  292

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVI  1160
              +ESG ++ V+D A PF      +A  Y+ETGRA+GKVV+
Sbjct  293   LIESGIIRPVVDRAFPFDAT--ADALSYVETGRAKGKVVV  330



>ref|WP_026716144.1| NADPH:quinone reductase [Flavobacterium gelidilacus]
Length=327

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 112/324 (35%), Positives = 179/324 (55%), Gaps = 41/324 (13%)
 Frame = +3

Query  282   KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKL---RQTSLVPMNFPVIPGCDMAGIV  452
             K+ L + +   P  + + +LV+V+AA+LNPID+K+   +   ++ +N P   G D++G+V
Sbjct  13    KDSLSINEVKKPTLKPNDILVEVKAASLNPIDYKMVEGKLKEMISLNLPSTIGFDVSGVV  72

Query  453   VAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAAS  632
             V K + V  F+IGDEVY  +         ++MGT+AEF  ++  LVA KP N++F+ AA 
Sbjct  73    VDKSADVNNFEIGDEVYSRVPQ-------EQMGTVAEFVSIKSNLVAKKPSNISFEEAAG  125

Query  633   LPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEF  812
             LPLA  TA Q     G +E   + I  G+GGVGS A+Q AK     + V  TTS+  V++
Sbjct  126   LPLAGLTAIQALDRVGIKENDRILIHAGSGGVGSFAIQYAKA--KGAIVYTTTSSKNVDW  183

Query  813   VKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENATIIDITWPPSNPR  986
             VK LGAD+V+DY    Y+++ +  D+V+DT+GD  + ++F + KE   +  I  PP    
Sbjct  184   VKALGADRVIDYKTEDYKEVAQNLDIVFDTLGDDYTFDAFKIIKEGGKVTTIVGPPDEET  243

Query  987   AVHSGLTV-------------------------SGEILEKLKPFLESGKVKAVIDPAGPF  1091
             A   G+                           + E L+ +   +E+G ++ +ID   P 
Sbjct  244   AKQMGMKEYKLSEKLARLIKEKDAIYKLTWMQPNAEQLKTISKMVENGDIQPIIDLIYPL  303

Query  1092  HFCNVVEAFGYIETGRARGKVVIS  1163
                + V+A+ Y+ TG+A+GKV+IS
Sbjct  304   E--DGVDAYLYLATGKAKGKVIIS  325



>ref|WP_026709224.1| NADPH:quinone reductase [Flavobacterium frigidarium]
Length=327

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 115/325 (35%), Positives = 177/325 (54%), Gaps = 43/325 (13%)
 Frame = +3

Query  282   KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFPVIPGCDMAGIV  452
             K+ L + +   P  + + +LV+V+AA+LNPID+K+ +     ++ +NFP   G D++G+V
Sbjct  13    KDSLSINEIEKPSLKPNDILVEVKAASLNPIDYKMVEGHLKDMISLNFPSTIGFDVSGVV  72

Query  453   VAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAAS  632
             V +G  V  F+IGDEVY  +         ++MGT+AEF  +   LVA KPKN +F+ AA 
Sbjct  73    VERGVAVNNFEIGDEVYSRVPQ-------EQMGTVAEFVSINSDLVAKKPKNSSFEEAAG  125

Query  633   LPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEF  812
             LPL   TA Q     G +E   V I  G+GGVGS A+Q AK     + V  TTS+  V++
Sbjct  126   LPLTGLTAIQALENVGIKENDRVLIHAGSGGVGSFAIQYAKA--KGAIVYTTTSSKNVDW  183

Query  813   VKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENATIIDITWPPSNPR  986
             VK LGAD+V+DY    Y+++    D+V+DT+G+  + ++F + KE   +  I  PP    
Sbjct  184   VKALGADRVIDYKTEDYKKVANNLDIVFDTLGNDYTFDAFEIIKEGGKVTTIAGPPDEET  243

Query  987   AVHSGLTVSGEILEKLKPFL--------------------------ESGKVKAVIDPAGP  1088
             A   G+    ++ EKL   +                          E G +K ++D    
Sbjct  244   AKKMGMK-DYKLTEKLATLIEKKSAIYKLTWMQPDAKQLNTISSMVEDGDIKPIVDLI--  300

Query  1089  FHFCNVVEAFGYIETGRARGKVVIS  1163
             + F N ++A+ Y+ TGRA+GKV+IS
Sbjct  301   YSFENGIDAYLYLATGRAKGKVIIS  325



>ref|WP_026839733.1| NADPH:quinone reductase [Gillisia sp. JM1]
Length=327

 Score =   168 bits (425),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 115/324 (35%), Positives = 174/324 (54%), Gaps = 41/324 (13%)
 Frame = +3

Query  282   KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKL---RQTSLVPMNFPVIPGCDMAGIV  452
             KE L L +   P  + + +LV+V+AAALNPID+K+   +   ++ +N P   G D++G+V
Sbjct  13    KESLSLNEIEKPSIKPNDILVEVKAAALNPIDYKMVEGKLKDMISLNLPSTIGFDVSGVV  72

Query  453   VAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAAS  632
             V KG+ V  F+IGDEVY  +         ++MGT+AEF  V   LVA KP+N +F+ AA 
Sbjct  73    VEKGADVKNFEIGDEVYSRVPQ-------EQMGTVAEFVAVNSDLVAKKPENASFEKAAG  125

Query  633   LPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEF  812
             LPL   TA Q     G +E   + I  G+GGVGS A+Q AK     + V  TTS   V++
Sbjct  126   LPLIGLTAIQALERVGIKENDRILIHAGSGGVGSFAIQYAKA--KGAIVYTTTSTKNVDW  183

Query  813   VKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENATIIDITWPPSNPR  986
             VK LGAD+V+DY    Y+++    D+V+DT+GD  + ++F + KE   +  I  PP    
Sbjct  184   VKALGADRVIDYKTEDYKEVANNLDIVFDTLGDDYTFDAFEIIKEGGKVTTIVGPPDEET  243

Query  987   AVHSGLTV-------------------------SGEILEKLKPFLESGKVKAVIDPAGPF  1091
             A   G+T                          + E L+++   +E   +K ++D    +
Sbjct  244   AKQMGMTDYKLPEKLAKLIKEKSAVYKLTWMQPNAEQLKEISTMVEDRTIKPIVDLI--Y  301

Query  1092  HFCNVVEAFGYIETGRARGKVVIS  1163
                +  +A+ Y+ TGRA GKV+IS
Sbjct  302   SLEDGADAYEYLATGRAEGKVIIS  325



>ref|WP_028784204.1| NADPH:quinone reductase [Thalassobacillus devorans]
Length=311

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 119/317 (38%), Positives = 179/317 (56%), Gaps = 22/317 (7%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL---VPMNFPV  422
             KA   + +G K+ LK+ +   P    DQ+LV++ A ++NPID+KLRQ  L      +FP+
Sbjct  2     KAIVIDNYGDKDQLKMREIDKPEITDDQVLVELHATSINPIDWKLRQGYLKEKADFDFPI  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D+AG+V   G  VTKF  GD V+          +L R+GT AE+T V+E L+A  P
Sbjct  62    ILGWDLAGVVTDTGKNVTKFKKGDNVFAR-------PDLTRLGTYAEYTAVDERLLAHMP  114

Query  603   KNLTFKAAASLPLAIQTAAQGFRT-AGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             +N+T++ AAS+PLA  TA Q     +  ++G  V I  G+GGVGS A+QLAKH +GA  V
Sbjct  115   ENITYEEAASVPLAGLTAWQCLVDFSDIKDGDKVLIHAGSGGVGSYAIQLAKH-FGA-YV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN--SFVVAKENATI  953
             A T S    ++V  LG D+ ++Y    + ++ E +D+V DT+G  +   S+ V KE   +
Sbjct  173   ATTASGKNEDWVTELGVDRFINYQEEDFSEVLEDFDIVVDTLGGEVQEKSYEVLKEGGKL  232

Query  954   IDITWPPSNPRAVHSGLTV-------SGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
             + +  PP + +A   G+          GE L K+   +++GKV+AV+     F    + E
Sbjct  233   VSVAQPPEDEKAKERGIKAGFHWLEPDGEQLTKIAELIKTGKVRAVVGHRFDFTEEGLKE  292

Query  1113  AFGYIETGRARGKVVIS  1163
             A    ET  A+GK+ IS
Sbjct  293   AHELSETHHAQGKIAIS  309



>ref|WP_034889969.1| NADPH:quinone reductase [Gillisia sp. Hel_I_29]
Length=330

 Score =   167 bits (424),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 114/324 (35%), Positives = 176/324 (54%), Gaps = 41/324 (13%)
 Frame = +3

Query  282   KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPM---NFPVIPGCDMAGIV  452
             K+ L + +   P    + +LV V+AA+LNPID+KL +  L  M     P   G D++G+V
Sbjct  13    KDSLSIQEVDKPSFNDNDILVAVKAASLNPIDYKLAEGKLKDMLSLKLPATIGYDVSGVV  72

Query  453   VAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAAS  632
             V KGS V  F+IGDE+Y  +         ++MGT+AEF  +   +VA+KP+N++F+ A++
Sbjct  73    VEKGSKVKNFEIGDEIYSRVPQ-------EQMGTVAEFVAINIDMVALKPENISFEQASA  125

Query  633   LPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEF  812
             LPL   TA Q       +EG  + I  G+GGVGS A+Q AK  Y  + V  TTS   V++
Sbjct  126   LPLTGLTAMQALEKVNIKEGDRILIHAGSGGVGSFAIQFAK--YKGAIVYTTTSTKNVDW  183

Query  813   VKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENATIIDITWPPSNPR  986
             VK LGAD+V+DY    Y+++    D+V+DT+GD  + ++F + KE   +  I  PP    
Sbjct  184   VKALGADRVIDYKTEDYKEVANNLDIVFDTLGDDYTFDAFEIIKEGGRVTTIVGPPDEET  243

Query  987   AVHSGL--------------TVSGEI-----------LEKLKPFLESGKVKAVIDPAGPF  1091
             A   G+                S E            LE +K  +E   +K ++D    +
Sbjct  244   AKQMGMQDYSLPEKLAKLKKEKSAEYKLTWMQPNAKQLEDVKILVEDDTIKPIVDLI--Y  301

Query  1092  HFCNVVEAFGYIETGRARGKVVIS  1163
              F + ++A+ Y+ TG+A+GKV+IS
Sbjct  302   SFEDAIDAYEYLATGKAKGKVIIS  325



>ref|WP_015471126.1| hypothetical protein [Bdellovibrio exovorus]
 ref|YP_007646243.1| hypothetical protein A11Q_2420 [Bdellovibrio exovorus JSS]
 gb|AGH96636.1| hypothetical protein A11Q_2420 [Bdellovibrio exovorus JSS]
Length=337

 Score =   168 bits (425),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 127/340 (37%), Positives = 181/340 (53%), Gaps = 48/340 (14%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLR--QTSLV-PMNFPV  422
             +A    ++G  E LK  +  IP      +LV++ AA+LNPIDFK+R  Q   V    FP+
Sbjct  5     RAALISKYGKNEKLKFTNVDIPTCGDTDVLVEIHAASLNPIDFKIRDGQVKFVRSYKFPL  64

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D+AG+VV  GS VT F  GD+VY    N        R+G LA+F  V+E+ +A  P
Sbjct  65    ILGHDIAGVVVDVGSKVTGFKKGDKVYSRPQN-------DRIGGLAQFIAVDESELAHIP  117

Query  603   KNLTFKAAASLPLAIQTAAQG-FRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             KNL+F  AAS+PL   T+ Q  F  AG + G  VFI  GAGG+G+ A+QLAK+ +GA  V
Sbjct  118   KNLSFTEAASIPLVGLTSWQALFDVAGMKRGDRVFIQAGAGGIGTFAIQLAKN-FGAY-V  175

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDS--INSFVVAKENATI  953
               TTS    +FV+ LGAD+++DYT   +E++ +  D+V+DT+G      SF V +    +
Sbjct  176   ITTTSGRNTDFVRSLGADEIIDYTKQNFEEVLKEVDIVFDTLGGEALYKSFQVLRPGGHV  235

Query  954   IDITWPPSNPRAVHSGLTV-------------------------------SGEILEKLKP  1040
             + I+  P    A   GL                                 SG+ L K+  
Sbjct  236   VSISGAPDQRLADDMGLGFIKREILRLVGLKANCMAAKTKGHYRFIFMKPSGDQLAKIAK  295

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVI  1160
              +E GK+K +ID    F F +  +A  ++E GR+RGKVV+
Sbjct  296   LIEDGKIKPIIDK--EFAFDDAQKALDHLELGRSRGKVVV  333



>ref|WP_013316298.1| NADPH:quinone oxidoreductase [Dickeya dadantii]
 gb|ADM96818.1| putative zinc-containing alcohol dehydrogenase [Dickeya dadantii 
3937]
Length=333

 Score =   167 bits (424),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 123/340 (36%), Positives = 182/340 (54%), Gaps = 48/340 (14%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTS---LVPMNFPV  422
             KA+  + +G K   ++G+   P  + D +L+QV AA +N +D K+ +     ++P   P+
Sbjct  2     KAFIIDSYGSKSSGRIGEMPEPELRGDDVLIQVHAAGVNLLDAKISKGEFRLILPYRLPL  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             + G D+AG+VV  G  VT+F  GDEVY            +R+GT AEF  V+E  +A+KP
Sbjct  62    VLGNDVAGVVVRVGPKVTRFRPGDEVYARPDQ-------ERIGTFAEFIAVKEDSLALKP  114

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
              NL+ + AASLPL   TA Q    TA  ++GQ V I  G+GGVG++A+QLAKH+   + V
Sbjct  115   GNLSMEEAASLPLVSLTAWQVLVETATLKKGQKVLIHAGSGGVGAIAIQLAKHL--GAFV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSI--NSFVVAKENATI  953
             A TT    VE+VK LGAD V+DY    +E +   YD+V +++G+ +   S  V K    +
Sbjct  173   ATTTGTSNVEWVKALGADVVIDYRKQDFETVLHGYDVVLNSLGNEVLEKSLRVLKPGGQL  232

Query  954   IDITWPPSNPRAVHSGLT-------------------------------VSGEILEKLKP  1040
             I I+ PP+   A   GL+                                SGE L+ +  
Sbjct  233   ISISGPPAPEFATEQGLSWGLKQVMRFLSRRIRMQAKQKGVSYAFVFMRASGEQLDGISA  292

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVI  1160
              +ESG ++ V+D   PF      +A  Y+ETGRA+GKVV+
Sbjct  293   LIESGVIRPVVDRVFPFDAT--ADALAYVETGRAKGKVVV  330



>dbj|GAM30419.1| putative oxydoreductase protein, zinc-containing (quinone oxidoreductase, 
NADPH dependent) [Acinetobacter calcoaceticus]
Length=334

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 131/341 (38%), Positives = 184/341 (54%), Gaps = 50/341 (15%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL---VPMNFPV  422
             KA Y   +G  + ++L +   P    D +LV+V AA++NP+D K+ +  L   +P+ FP 
Sbjct  2     KAAYISRYGNIDDVQLNEQSQPPLTADAVLVKVHAASINPLDLKVLEGELKAILPLKFPF  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D AG VV  GS VT+F  GDEVY    + N        G  AE+TVV+++ +A+KP
Sbjct  62    ILGNDFAGTVVEVGSNVTQFKAGDEVYAKT-DLN--------GAFAEYTVVQQSSLALKP  112

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             +NL+ + AASLPL   TA Q     A  Q GQ V I  G+GGVGS+A+QLAK +   ++V
Sbjct  113   QNLSMEQAASLPLVTLTAWQALVEMAKVQAGQKVLIHAGSGGVGSIAIQLAKSL--GATV  170

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSI--NSFVVAKENATI  953
             A TTSA    +VK LGAD ++DY    +EQ  + YD+V DT G      S  V K    +
Sbjct  171   ATTTSAKNSGWVKELGADIIIDYKTMNFEQEIKDYDVVLDTQGGKTLEKSLNVLKRGGRL  230

Query  954   IDITWPPS-------NP-----------------RAVHSGLTVS-------GEILEKLKP  1040
             I I+ PP        NP                 +A   G+T S       G+ L K+  
Sbjct  231   ISISGPPDHAFAEAINPNWFLKCVIPLLSWSIRHKAKKRGVTYSFLFMQPNGQHLSKITE  290

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVIS  1163
              +E+GK+K V+D    + F  + EA  Y+ TGRA+GKVV++
Sbjct  291   LVEAGKIKPVVDQT--YDFIQIKEALQYVNTGRAKGKVVLN  329



>ref|WP_038917797.1| NADPH:quinone oxidoreductase [Dickeya sp. MK7]
Length=333

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 121/340 (36%), Positives = 182/340 (54%), Gaps = 48/340 (14%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTS---LVPMNFPV  422
             KA+  + +G +   ++G+   P  + D +L+QV AA +N +D K+R      ++P   P+
Sbjct  2     KAFIIDRYGRRSSGRIGEMPEPELRGDDVLIQVHAAGVNLLDAKIRNGEFRLILPYRLPL  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
               G D+AG+VV  GS VT+F  GDEVY            +R+G  AEF  V+E  +A+KP
Sbjct  62    ALGNDVAGVVVRVGSKVTRFRPGDEVYARPDQ-------ERIGAFAEFIAVKEDSLALKP  114

Query  603   KNLTFKAAASLPLAIQTAAQGF-RTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
              NL+ + AAS+PL   TA Q    TA  ++GQ V I  G+GGVG++A+QLAKH+   + V
Sbjct  115   GNLSMEEAASIPLVSLTAWQVLVETAKLKKGQKVLIHAGSGGVGAIAIQLAKHL--GAFV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSI--NSFVVAKENATI  953
             A TT    VE+VK LGAD V+DY    +E +   YD+V +++G+ +   S  V +    +
Sbjct  173   ATTTGTSNVEWVKALGADVVIDYRKQDFETVLHGYDVVLNSLGNDVLEKSLRVLRPGGQL  232

Query  954   IDITWPPSNPRAVHSGLT-------------------------------VSGEILEKLKP  1040
             I I+ PP+   A   GL+                                SGE L+++  
Sbjct  233   ISISGPPAPEFATEQGLSWGLKQVMRLLSHRIRKQARQKGVSYAFVFMRASGEQLDEISA  292

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVI  1160
              +ESG ++ V+D   PF      +A  Y+ETGRA+GKVV+
Sbjct  293   LIESGIIRPVVDRVFPFDAT--ADALSYVETGRAKGKVVV  330



>ref|WP_018931929.1| NADPH:quinone reductase [Gracilibacillus lacisalsi]
Length=314

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 121/312 (39%), Positives = 177/312 (57%), Gaps = 23/312 (7%)
 Frame = +3

Query  270   EHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSLVPM---NFPVIPGCDM  440
             ++G K+VL+ G   +P     Q+LV+V+A ++NPID+KLR+  L  M    FP+I G D+
Sbjct  10    KYGSKDVLEEGQVTLPELGEHQVLVRVKATSINPIDWKLREGYLKQMFDWEFPIILGWDV  69

Query  441   AGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFK  620
             AG++ A GS VT +  GDEV+          E  R GT AE+TVV++ L+A KP N++F+
Sbjct  70    AGVIEAVGSAVTDWQEGDEVFAR-------PETTRFGTYAEYTVVDDHLLAKKPANISFE  122

Query  621   AAASLPLAIQTAAQG-FRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSA  797
              AA++PLA  TA QG F     +EG+ V +  GAGGVG+ A+QLAK     + V  T S 
Sbjct  123   EAAAVPLAGMTAYQGLFDHGHLKEGEKVLVHAGAGGVGTYAIQLAKE--AGAYVYTTASE  180

Query  798   PKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSI--NSFVVAKENA-TIIDITW  968
                E ++ LGAD+V+DY  T +  + +  DLV DT+G  +  NSF V KEN+  +I +  
Sbjct  181   KNHELLQSLGADEVIDYRTTDFRDVVQEIDLVLDTMGGEVQLNSFDVLKENSGRLITVVG  240

Query  969   PPSNPRAVHSG-------LTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVEAFGYI  1127
              P   +A           L   G+ L KL   L++ K+K+++    P     V +A    
Sbjct  241   APDQEKAKEKNVETIGIWLQPEGKQLSKLADLLQAKKMKSIVGSTFPLTQQGVYDAHALS  300

Query  1128  ETGRARGKVVIS  1163
             ET  A GK+VI+
Sbjct  301   ETHHAVGKIVIT  312



>ref|WP_017186128.1| hypothetical protein [Alkalibacillus haloalkaliphilus]
Length=311

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 126/317 (40%), Positives = 174/317 (55%), Gaps = 22/317 (7%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFPV  422
             KA    E+G KE L+  +   P P   Q+LV+  A ++NPID+KLR+     +VPM FP+
Sbjct  2     KAIVINEYGRKEQLQEQEVTKPTPGDGQVLVKQHATSINPIDWKLREGYLKEMVPMEFPL  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D AG+V   G GVT F +GD V+          +L   GT AE+ V E  ++A  P
Sbjct  62    ILGWDSAGVVEEVGEGVTDFKVGDRVF-------TRPQLTNRGTYAEYIVTEADILAHIP  114

Query  603   KNLTFKAAASLPLAIQTAAQG-FRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             +N++F  AAS+PL   TA Q  F  A  QEGQ V +  GAGGVG +A+QLAK+    + V
Sbjct  115   ENISFNEAASVPLTALTAWQCLFDFADLQEGQKVLVHAGAGGVGVMAIQLAKN--AGAYV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN--SFVVAKENATI  953
             A T S   VEF++ LGAD+V+DY    +  + E YD+V D +G  I   SF V K+  T+
Sbjct  173   ATTASTKNVEFLQSLGADEVIDYKKENFYDVLEDYDVVLDALGGDIQERSFDVLKDGGTL  232

Query  954   IDITWPPSNPRAVHSGLTV-------SGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
             + I  PPS  +     + V        G+ + KL   +E GK+K +I    PF    + E
Sbjct  233   VSIAQPPSEEKGQEHNVKVGFVFIEPDGDQMRKLAQLMEDGKLKPIIGHTFPFSEQGLKE  292

Query  1113  AFGYIETGRARGKVVIS  1163
             A    ET  A+GK+VI 
Sbjct  293   AHELSETHHAKGKIVIE  309



>ref|WP_036816858.1| NADPH:quinone reductase [Pontibacillus yanchengensis]
 gb|KGP73830.1| NADPH:quinone reductase [Pontibacillus yanchengensis Y32]
Length=315

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 124/321 (39%), Positives = 173/321 (54%), Gaps = 22/321 (7%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFPV  422
             KA   E++G KE LK  +  +P    DQ+L+++ + ++NPID+K+R+     ++  NFP+
Sbjct  2     KAVVIEQYGGKEQLKAKEVPVPEINDDQVLIEMHSTSVNPIDWKVREGYMKDVLDWNFPI  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             I G D AG+V   GS VT+F  GD V+          E    GT  E+  VEE LVA  P
Sbjct  62    ILGWDAAGVVSEVGSNVTEFKKGDRVF-------TRPETTPDGTYKEYIAVEEHLVARMP  114

Query  603   KNLTFKAAASLPLAIQTAAQG-FRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
               ++F+ AA+ PLA  TA Q  F TA  +EG+ V I  G+GGVG  A+Q+AK     + V
Sbjct  115   DRVSFEEAAAAPLAGLTAWQCLFETAKLKEGEKVLIHAGSGGVGHYAIQIAK--AAGAYV  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN--SFVVAKENATI  953
             A T S    EF++ LG D  ++Y    +E I E YD+V DTIG  +   SF V K+   +
Sbjct  173   ATTASGKNKEFLETLGVDHFINYQTEQFENILEDYDVVLDTIGGDVQEKSFEVLKKGGRL  232

Query  954   IDITWPPS-------NPRAVHSGLTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
             + IT  PS       N  A    L   GE L KL   +E GKVK+++  A PF    + +
Sbjct  233   VSITQQPSEELANKYNVEATAIFLQPKGEQLRKLADLMEQGKVKSIVSKAFPFSVEGIQK  292

Query  1113  AFGYIETGRARGKVVISPFPS  1175
             A    E+   +GKVVI   PS
Sbjct  293   AHEASESHHVKGKVVIQIQPS  313



>ref|WP_013716602.1| NADPH:quinone oxidoreductase [Pseudomonas mendocina]
 ref|YP_004381293.1| alcohol dehydrogenase zinc-binding domain-containing protein 
[Pseudomonas mendocina NK-01]
 gb|AEB59541.1| alcohol dehydrogenase zinc-binding domain protein [Pseudomonas 
mendocina NK-01]
Length=336

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 121/340 (36%), Positives = 179/340 (53%), Gaps = 48/340 (14%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL---VPMNFPV  422
             KA+  E +  +E L+L D   P      +LVQ+ AA++NP+D K+R  +L   +P+  P+
Sbjct  5     KAFVIERYSKQEPLRLVDVPEPTLGEQDVLVQIHAASINPLDLKIRSGALKRILPLRLPL  64

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             + G D+AG+V   G+ V  F  GDEVY            +R+GT AEF  V E+ +A+KP
Sbjct  65    VLGNDLAGVVTRVGAKVQGFKPGDEVYARTDT-------RRIGTFAEFIAVAESNLALKP  117

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAG-FQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
              +L+ + AAS+PL   TA Q     G  ++GQ VFI  G+GGVG+LA+QLAKH+   + V
Sbjct  118   ASLSMEEAASIPLVGLTAWQALVEKGQLRKGQKVFIHAGSGGVGTLAIQLAKHL--GAYV  175

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDS--INSFVVAKENATI  953
             A TTS+  V  VK LGAD V+DY    + +    YDLV  ++GD     S  V +    +
Sbjct  176   ATTTSSANVALVKSLGADLVIDYRKDDFAKTLRDYDLVLHSLGDEELAQSVSVLRPGGQL  235

Query  954   IDITWPPSNPRAVHSG-------------------------------LTVSGEILEKLKP  1040
             I ++ PP    A  +G                               +  SGE L +L  
Sbjct  236   ITLSGPPDPAFARSAGMPKLLQLIVGLLSRKIRKRAAQRQVSYAFLFMRGSGEQLARLAE  295

Query  1041  FLESGKVKAVIDPAGPFHFCNVVEAFGYIETGRARGKVVI  1160
              ++SG ++ V+D   PF   +  EA  Y+++GRA+GKVV+
Sbjct  296   LIDSGVIRPVVDKVFPFEATD--EALAYVDSGRAKGKVVV  333



>ref|WP_006835167.1| NADPH:quinone reductase [Bacillus sp. SG-1]
 gb|EDL66461.1| zinc-binding oxidoreductase [Bacillus sp. SG-1]
Length=311

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/316 (39%), Positives = 171/316 (54%), Gaps = 22/316 (7%)
 Frame = +3

Query  252   KAWYYEEHGPKEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQ---TSLVPMNFPV  422
             KA   EE+G K+VL   D   P    +Q+LV++ A ++NPID+K+R+     ++P  FP+
Sbjct  2     KAIVIEEYGDKDVLVEKDIEKPSIAENQVLVEMHATSINPIDWKVREGYLKEMLPFEFPI  61

Query  423   IPGCDMAGIVVAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKP  602
             + G D AG++V  GS V  F +GD V+      N        GT AE+  V + L+A  P
Sbjct  62    VLGWDAAGVIVETGSNVKGFKVGDRVFTRPATTN-------RGTYAEYLSVHDNLLAKMP  114

Query  603   KNLTFKAAASLPLAIQTAAQGFRTAG-FQEGQSVFIvggaggvgslavqlaKHVYGASSV  779
             + ++F  AAS+PLA  TA Q     G  QEG  V I  GAGGVG  A+Q+AK  +GA  V
Sbjct  115   EEMSFDEAASIPLAGLTAWQCLVDFGKIQEGDKVLIHAGAGGVGLFAIQIAKS-FGAH-V  172

Query  780   AATTSAPKVEFVKCLGADKVVDYTNTTYEQIPETYDLVYDTIGDSIN--SFVVAKENATI  953
             A T S    EF+K LGAD+V++Y    + ++   +DLV D++G  I   S+ V KEN  +
Sbjct  173   ATTASEKNTEFLKSLGADEVINYKEEDFSEVVNDFDLVLDSMGGEIQSKSYKVLKENGKL  232

Query  954   IDITWPPSNPRAVHSG-------LTVSGEILEKLKPFLESGKVKAVIDPAGPFHFCNVVE  1112
             + I  PPS   A +         L  +GE L+KL      GKVK VI     F    + +
Sbjct  233   VSIVQPPSEEEAANYNAEAGFVWLEPNGEQLQKLADLYVEGKVKPVIGETFDFSEQGLKD  292

Query  1113  AFGYIETGRARGKVVI  1160
             A    ET  ARGK+VI
Sbjct  293   AHALSETHHARGKIVI  308



>ref|WP_003441048.1| alcohol dehydrogenase and quinone reductase-like medium chain 
degydrogenase/reductase [Psychroflexus gondwanensis]
 gb|EMY80920.1| alcohol dehydrogenase and quinone reductase-like medium chain 
degydrogenase/reductase [Psychroflexus gondwanensis ACAM 44]
Length=329

 Score =   166 bits (420),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 115/323 (36%), Positives = 177/323 (55%), Gaps = 39/323 (12%)
 Frame = +3

Query  282   KEVLKLGDFLIPVPQHDQLLVQVQAAALNPIDFKLRQTSL---VPMNFPVIPGCDMAGIV  452
             K+ L + +   P  + + +L++V+AA LNPID+K+ +  L   + +N P   G D++G+V
Sbjct  13    KDSLSIKEIKKPAVKANDILIEVKAAGLNPIDYKIVEGQLKDMIALNLPCTIGFDVSGVV  72

Query  453   VAKGSGVTKFDIGDEVYGNIHNFNLEGELKRMGTLAEFTVVEETLVAMKPKNLTFKAAAS  632
             V KG+ V  F+IGDEVY  +         ++MGT+AEF VV   +VA KP N++F+ AA 
Sbjct  73    VEKGADVNNFEIGDEVYSRVPQ-------EQMGTVAEFVVVNSDMVAKKPDNVSFEKAAG  125

Query  633   LPLAIQTAAQGFRTAGFQEGQSVFIvggaggvgslavqlaKHVYGASSVAATTSAPKVEF  812
             LPL   TA Q     G +E   + I  G+GGVGS A+Q AK     + V  TTS   V++
Sbjct  126   LPLVGLTAIQALERVGLKENDRILIHAGSGGVGSFAIQYAKA--KGAIVYTTTSTKNVDW  183

Query  813   VKCLGADKVVDYTNTTYEQIPETYDLVYDTIGD--SINSFVVAKENATIIDITWPPSNPR  986
             VK LGAD+V+DY    Y+++    D+V+DT+GD  + ++F + KE   +  I  PP    
Sbjct  184   VKALGADRVIDYKTEDYKEVSTNLDIVFDTLGDDYTFDAFQIIKEGGKVTTIVGPPDEET  243

Query  987   AVHSGLTVSGEILEKLKPFLE--------------SGKVKAV--------IDPAGPFHFC  1100
             A   G+T    + EKL   ++              +G++K +        I P   F + 
Sbjct  244   AKQMGMT-DYTLPEKLSKLIDEKSAVYRLTWMQPNAGQLKEIATMVEDRAIKPIVDFIYS  302

Query  1101  --NVVEAFGYIETGRARGKVVIS  1163
               + ++A+ Y+ TGRA GKV+IS
Sbjct  303   LEDGIDAYEYLATGRAEGKVIIS  325



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3583994365200