BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c101090_g1_i1 len=686 path=[1:0-685]

Length=686
                                                                      Score     E

gb|EYU37640.1|  hypothetical protein MIMGU_mgv1a020991mg                161   7e-46   
gb|EPS69551.1|  hypothetical protein M569_05216                         155   1e-43   
gb|EPS57159.1|  hypothetical protein M569_17662                         151   2e-42   
ref|XP_002298664.1|  hypothetical protein POPTR_0001s33000g           67.4    8e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002523932.1|  conserved hypothetical protein                   63.9    1e-09   Ricinus communis



>gb|EYU37640.1| hypothetical protein MIMGU_mgv1a020991mg [Erythranthe guttata]
Length=156

 Score =   161 bits (407),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +3

Query  168  LFPNVEITLANDYDRTIYFMCKHTDKDNTLHPLKATETYRFNFTQVAFPMRWCFLYINSH  347
            LFP +E+TLAND    I+FMC+ TDK N+L  L+   TYRF+F QVAFPMRWC+LYI+  
Sbjct  31   LFPELEVTLANDGTYPIWFMCQMTDKSNSLFQLQPNATYRFSFLQVAFPMRWCYLYISPK  90

Query  348  SFGFLWVYNMRSRCTKCFWSITNYPNLYRTDRVRWERQKLFMPPTFKID  494
            S GF W Y +RSRCTKCFWSI  +P+LYR D+ RWERQKLFMPP FK+D
Sbjct  91   SHGFFWAYTVRSRCTKCFWSINKHPSLYRGDKGRWERQKLFMPPGFKMD  139



>gb|EPS69551.1| hypothetical protein M569_05216 [Genlisea aurea]
Length=153

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +3

Query  162  AKLFPNVEITLANDYDRTIYFMCKHTDKDNTLHPLKATETYRFNFTQVAFPMRWCFLYIN  341
              + P VE+T+AND    + FMC+ TDK ++L+ LK+  TY F+FTQ+AFPMRWCFLYIN
Sbjct  31   VAIMPEVEVTIANDGASPVLFMCQLTDKSDSLYTLKSNVTYIFHFTQIAFPMRWCFLYIN  90

Query  342  SHSFGFLWVYNMRSRCTKCFWSITNYPNLYRTDRVRWERQKLFMPPTFKIDKF  500
             ++ GF W Y +RSRCTKCFWS+T + +LYR D+ RWERQKLFMPP F I  +
Sbjct  91   PNTHGFFWAYTVRSRCTKCFWSVTKHVSLYRGDKGRWERQKLFMPPDFSISDY  143



>gb|EPS57159.1| hypothetical protein M569_17662, partial [Genlisea aurea]
Length=109

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 81/109 (74%), Gaps = 0/109 (0%)
 Frame = +3

Query  168  LFPNVEITLANDYDRTIYFMCKHTDKDNTLHPLKATETYRFNFTQVAFPMRWCFLYINSH  347
            + P VE+TLAND    + FMC+ T K ++L+ L    TYRF+FT +AFPMRWCFLYIN  
Sbjct  1    VMPEVEVTLANDGSSGVLFMCQRTSKSDSLYTLLPNSTYRFSFTHLAFPMRWCFLYINPE  60

Query  348  SFGFLWVYNMRSRCTKCFWSITNYPNLYRTDRVRWERQKLFMPPTFKID  494
            ++GF W Y +RSRCTKCFWSIT + +LYR D+ RWERQKLF PP F ID
Sbjct  61   AYGFFWAYTVRSRCTKCFWSITKHASLYRGDKGRWERQKLFTPPRFYID  109



>ref|XP_002298664.1| hypothetical protein POPTR_0001s33000g [Populus trichocarpa]
 gb|EEE83469.1| hypothetical protein POPTR_0001s33000g [Populus trichocarpa]
Length=149

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 46/101 (46%), Gaps = 1/101 (1%)
 Frame = +3

Query  171  FPNVEITLANDYDRTIYFMCKHTDKDNTLHPLKATETYRFNFTQVAFPMRWCFLYINSHS  350
            FP V + + ND    I +MC     D  LH L+  E+  F    + FP+ WC+  +N   
Sbjct  45   FPRVTVNITNDASHDIPYMCNSPKLDQGLHALRPKESIAFEVVDIMFPLVWCYAQLNDRY  104

Query  351  FGFLWVYNMRSRCTK-CFWSITNYPNLYRTDRVRWERQKLF  470
             G  W +  +  CT  C WS+ +    Y  +  + E  +LF
Sbjct  105  HGVFWAFATKLGCTDICSWSLKDEGAFYLREDGKLEEHRLF  145



>ref|XP_002523932.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38501.1| conserved hypothetical protein [Ricinus communis]
Length=143

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 43/83 (52%), Gaps = 1/83 (1%)
 Frame = +3

Query  168  LFPNVEITLANDYDRTIYFMCKHTDKDNTLHPLKATETYRFNFTQVAFPMRWCFLYINSH  347
            L P V+++LAN+    +  MC   D ++ L  LK  E   +    V FP+ WC+ ++N  
Sbjct  37   LVPTVKVSLANNATHNVDVMCGGKDGED-LIVLKPGERISWQVLDVMFPLAWCYAHVNDT  95

Query  348  SFGFLWVYNMRSRCTKCFWSITN  416
              G  W Y +R +C +C W I N
Sbjct  96   YHGVFWAYQVRLQCIQCNWEIQN  118



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1042394327856