BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10102_g1_i2 len=604 path=[152:0-149 302:150-603]

Length=604
                                                                      Score     E

gb|AAO72616.1|  protein kinase-like protein                           75.9    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001175499.1|  Os08g0285600                                     72.4    4e-13   
dbj|BAJ86178.1|  predicted protein                                    76.3    8e-13   
ref|XP_009589309.1|  PREDICTED: probable receptor-like protein ki...  75.5    1e-12   
ref|XP_006338869.1|  PREDICTED: probable receptor-like protein ki...  74.7    2e-12   
ref|XP_010665786.1|  PREDICTED: probable receptor-like protein ki...  74.7    3e-12   
gb|EAZ42183.1|  hypothetical protein OsJ_26747                        74.3    3e-12   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ06385.1|  hypothetical protein OsI_28614                        74.3    3e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_009764253.1|  PREDICTED: probable receptor-like protein ki...  73.9    4e-12   
gb|AFW76181.1|  putative protein kinase superfamily protein           68.9    6e-12   
ref|XP_004973165.1|  PREDICTED: probable receptor-like protein ki...  73.2    7e-12   
gb|EAY84745.1|  hypothetical protein OsI_06115                        73.6    7e-12   Oryza sativa Indica Group [Indian rice]
gb|EAZ21983.1|  hypothetical protein OsJ_05638                        73.6    8e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010265697.1|  PREDICTED: probable receptor-like protein ki...  72.8    1e-11   
ref|XP_010265695.1|  PREDICTED: probable receptor-like protein ki...  72.8    1e-11   
ref|XP_006659284.1|  PREDICTED: probable receptor-like protein ki...  71.6    1e-11   
ref|XP_010048150.1|  PREDICTED: probable receptor-like protein ki...  72.4    1e-11   
ref|XP_002285386.2|  PREDICTED: probable receptor-like protein ki...  72.4    2e-11   Vitis vinifera
ref|XP_010234548.1|  PREDICTED: probable receptor-like protein ki...  72.4    2e-11   
ref|XP_006483437.1|  PREDICTED: probable receptor-like protein ki...  72.4    2e-11   
ref|XP_006450333.1|  hypothetical protein CICLE_v10008263mg           72.4    2e-11   
ref|XP_009126471.1|  PREDICTED: probable receptor-like protein ki...  72.0    2e-11   
ref|XP_004498775.1|  PREDICTED: probable receptor-like protein ki...  72.0    2e-11   
ref|NP_001137070.1|  uncharacterized LOC100217243                     70.9    2e-11   Zea mays [maize]
ref|XP_006399600.1|  hypothetical protein EUTSA_v10013829mg           71.6    2e-11   
gb|EMT19930.1|  Serine/threonine-protein kinase PBS1                  72.0    2e-11   
ref|XP_003603322.1|  Receptor-like protein kinase                     71.6    2e-11   
ref|XP_007217770.1|  hypothetical protein PRUPE_ppa018107mg           71.6    3e-11   
gb|ABU43071.1|  wilt-resistance protein                               69.7    3e-11   
gb|AES73573.2|  receptor-like kinase                                  71.6    3e-11   
ref|XP_008228758.1|  PREDICTED: probable receptor-like protein ki...  71.6    3e-11   
ref|XP_007023373.1|  Serine/threonine-protein kinase PBS1 isoform 1   71.6    3e-11   
ref|XP_004501365.1|  PREDICTED: probable receptor-like protein ki...  71.2    3e-11   
gb|AAD23669.1|  hypothetical protein                                  69.7    3e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KDP33542.1|  hypothetical protein JCGZ_07113                       71.2    3e-11   
ref|XP_007222630.1|  hypothetical protein PRUPE_ppa008520mg           70.5    3e-11   
ref|XP_003527781.1|  PREDICTED: probable receptor-like protein ki...  71.2    3e-11   
emb|CDX68808.1|  BnaC01g06450D                                        71.2    3e-11   
emb|CDJ26232.1|  hypothetical protein                                 70.9    4e-11   
ref|XP_010105445.1|  putative receptor-like protein kinase            70.9    4e-11   
emb|CDX75212.1|  BnaA01g04900D                                        70.9    4e-11   
ref|XP_006412528.1|  hypothetical protein EUTSA_v100253980mg          68.9    4e-11   
ref|XP_008658206.1|  PREDICTED: uncharacterized LOC100217243 isof...  71.2    4e-11   
ref|XP_006405129.1|  hypothetical protein EUTSA_v10000655mg           70.9    4e-11   
ref|NP_194928.3|  protein kinase family protein                       70.9    4e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190886.1|  protein kinase family protein                    70.9    5e-11   
ref|NP_001148336.1|  phytosulfokine receptor precursor                70.9    5e-11   Zea mays [maize]
emb|CAN76226.1|  hypothetical protein VITISV_000266                   70.1    5e-11   Vitis vinifera
ref|XP_010453137.1|  PREDICTED: probable receptor-like protein ki...  70.5    5e-11   
ref|XP_003604596.1|  Wall-associated receptor kinase-like protein     70.9    5e-11   
ref|XP_010419656.1|  PREDICTED: probable receptor-like protein ki...  70.1    5e-11   
gb|KHG26656.1|  hypothetical protein F383_33408                       70.9    5e-11   
ref|XP_007136974.1|  hypothetical protein PHAVU_009G089500g           70.5    5e-11   
ref|XP_010453136.1|  PREDICTED: probable receptor-like protein ki...  70.5    5e-11   
ref|XP_009362336.1|  PREDICTED: probable receptor-like protein ki...  70.5    6e-11   
ref|XP_007136973.1|  hypothetical protein PHAVU_009G089500g           70.5    6e-11   
gb|ACN34797.1|  unknown                                               70.5    6e-11   Zea mays [maize]
ref|XP_009340218.1|  PREDICTED: probable receptor-like protein ki...  70.5    6e-11   
ref|XP_009340217.1|  PREDICTED: probable receptor-like protein ki...  70.5    6e-11   
ref|XP_006848777.1|  hypothetical protein AMTR_s00026p00089830        70.5    6e-11   
ref|XP_004138848.1|  PREDICTED: probable receptor-like protein ki...  70.5    6e-11   
emb|CDP18793.1|  unnamed protein product                              70.5    6e-11   
ref|XP_002437355.1|  hypothetical protein SORBIDRAFT_10g025460        70.5    7e-11   Sorghum bicolor [broomcorn]
ref|NP_180094.5|  protein kinase family protein                       70.1    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002453413.1|  hypothetical protein SORBIDRAFT_04g005600        70.5    7e-11   Sorghum bicolor [broomcorn]
ref|XP_004965735.1|  PREDICTED: probable receptor-like protein ki...  70.5    7e-11   
ref|XP_009773864.1|  PREDICTED: probable receptor-like protein ki...  70.1    7e-11   
ref|XP_009607949.1|  PREDICTED: probable receptor-like protein ki...  70.1    7e-11   
ref|XP_004305485.1|  PREDICTED: probable receptor-like protein ki...  70.1    7e-11   
ref|NP_001148817.1|  LOC100282434 precursor                           70.1    8e-11   Zea mays [maize]
ref|XP_004951670.1|  PREDICTED: probable receptor-like protein ki...  70.1    8e-11   
ref|XP_010063546.1|  PREDICTED: probable receptor-like protein ki...  70.1    8e-11   
ref|XP_010419655.1|  PREDICTED: probable receptor-like protein ki...  70.1    8e-11   
ref|XP_002880664.1|  kinase family protein                            69.7    8e-11   
ref|XP_010437970.1|  PREDICTED: probable receptor-like protein ki...  70.1    8e-11   
ref|XP_010432787.1|  PREDICTED: probable receptor-like protein ki...  70.1    8e-11   
ref|XP_010491792.1|  PREDICTED: probable receptor-like protein ki...  70.1    8e-11   
ref|XP_010063545.1|  PREDICTED: probable receptor-like protein ki...  70.1    8e-11   
gb|KGN62978.1|  hypothetical protein Csa_2G382510                     70.1    8e-11   
ref|XP_010447455.1|  PREDICTED: probable receptor-like protein ki...  70.1    8e-11   
ref|XP_008445251.1|  PREDICTED: probable receptor-like protein ki...  70.1    8e-11   
ref|NP_001189598.1|  protein kinase family protein                    70.1    9e-11   
ref|XP_009140631.1|  PREDICTED: probable receptor-like protein ki...  70.1    9e-11   
emb|CDY35369.1|  BnaA04g14780D                                        70.1    9e-11   
emb|CDY62504.1|  BnaC04g56350D                                        70.1    9e-11   
ref|XP_006294253.1|  hypothetical protein CARUB_v10023249mg           70.1    9e-11   
ref|XP_010097152.1|  putative receptor-like protein kinase            70.1    9e-11   
ref|XP_006283813.1|  hypothetical protein CARUB_v10004912mg           69.7    9e-11   
ref|XP_008219557.1|  PREDICTED: probable receptor-like protein ki...  70.1    9e-11   
gb|AFW70452.1|  putative protein kinase superfamily protein           70.1    1e-10   
ref|XP_008386501.1|  PREDICTED: probable receptor-like protein ki...  69.7    1e-10   
ref|XP_008386502.1|  PREDICTED: probable receptor-like protein ki...  69.7    1e-10   
ref|XP_007011760.1|  Kinase superfamily protein                       69.7    1e-10   
gb|EPS67710.1|  hypothetical protein M569_07063                       67.4    1e-10   
ref|XP_010245528.1|  PREDICTED: probable receptor-like protein ki...  69.7    1e-10   
emb|CAB96857.1|  ser/thr specific protein kinase-like protein         68.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008352063.1|  PREDICTED: probable receptor-like protein ki...  69.3    1e-10   
ref|XP_008352064.1|  PREDICTED: probable receptor-like protein ki...  69.3    2e-10   
ref|XP_009355816.1|  PREDICTED: probable receptor-like protein ki...  69.3    2e-10   
ref|XP_010932226.1|  PREDICTED: probable receptor-like protein ki...  69.3    2e-10   
emb|CAC03450.1|  ser/thr specific protein kinase-like protein         68.9    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788934.1|  PREDICTED: probable receptor-like protein ki...  69.3    2e-10   
ref|XP_008788933.1|  PREDICTED: probable receptor-like protein ki...  69.3    2e-10   
gb|KHN31890.1|  Putative receptor-like protein kinase                 68.9    2e-10   
ref|XP_003542131.1|  PREDICTED: probable receptor-like protein ki...  68.9    2e-10   
ref|XP_010239937.1|  PREDICTED: probable receptor-like protein ki...  68.9    2e-10   
gb|ACU21242.1|  unknown                                               68.9    2e-10   Glycine max [soybeans]
gb|KHN22414.1|  Putative receptor-like protein kinase                 68.9    2e-10   
ref|XP_003546919.1|  PREDICTED: probable receptor-like protein ki...  68.9    2e-10   
gb|KHN29609.1|  Putative receptor-like protein kinase                 68.6    2e-10   
ref|XP_010541586.1|  PREDICTED: probable receptor-like protein ki...  68.9    2e-10   
gb|AAA98917.1|  Theoretical protein with similarity to GenBank Ac...  68.6    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006597107.1|  PREDICTED: probable receptor-like protein ki...  68.9    2e-10   
ref|NP_850806.2|  protein kinase superfamily protein                  68.9    2e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EYU21700.1|  hypothetical protein MIMGU_mgv1a019541mg              68.6    2e-10   
ref|XP_004290926.1|  PREDICTED: probable receptor-like protein ki...  68.9    2e-10   
ref|XP_002873491.1|  kinase                                           68.6    2e-10   
ref|XP_003570779.2|  PREDICTED: probable receptor-like protein ki...  68.9    2e-10   
ref|XP_011073360.1|  PREDICTED: probable receptor-like protein ki...  68.6    2e-10   
gb|KFK42447.1|  hypothetical protein AALP_AA2G257900                  68.6    2e-10   
ref|XP_010417684.1|  PREDICTED: probable receptor-like protein ki...  68.6    2e-10   
ref|XP_007150792.1|  hypothetical protein PHAVU_005G181000g           68.6    2e-10   
ref|XP_006302288.1|  hypothetical protein CARUB_v10020332mg           68.6    2e-10   
ref|XP_010417683.1|  PREDICTED: probable receptor-like protein ki...  68.6    2e-10   
ref|XP_006302289.1|  hypothetical protein CARUB_v10020332mg           68.6    2e-10   
ref|XP_010654872.1|  PREDICTED: probable receptor-like protein ki...  68.6    3e-10   
gb|KHG06993.1|  hypothetical protein F383_33282                       68.6    3e-10   
ref|XP_006578125.1|  PREDICTED: probable receptor-like protein ki...  68.6    3e-10   
emb|CAN79180.1|  hypothetical protein VITISV_019748                   68.6    3e-10   Vitis vinifera
ref|XP_010429929.1|  PREDICTED: probable receptor-like protein ki...  68.6    3e-10   
ref|XP_003550202.1|  PREDICTED: probable receptor-like protein ki...  68.6    3e-10   
ref|XP_003544601.1|  PREDICTED: probable receptor-like protein ki...  68.6    3e-10   
ref|NP_178179.2|  probable receptor-like protein kinase               68.6    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003523677.2|  PREDICTED: probable receptor-like protein ki...  68.2    3e-10   
ref|XP_010474456.1|  PREDICTED: probable receptor-like protein ki...  67.4    3e-10   
ref|XP_002889281.1|  kinase family protein                            68.2    3e-10   
gb|AAF27131.1|AC018849_19  putative protein kinase; 6651-4392         68.2    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122002.1|  PREDICTED: probable receptor-like protein ki...  68.2    3e-10   
emb|CDX69790.1|  BnaA10g21390D                                        68.2    3e-10   
ref|XP_011073359.1|  PREDICTED: probable receptor-like protein ki...  68.2    3e-10   
ref|XP_006654258.1|  PREDICTED: probable receptor-like protein ki...  67.8    4e-10   
emb|CDX97074.1|  BnaC09g45510D                                        68.2    4e-10   
ref|XP_011039611.1|  PREDICTED: probable receptor-like protein ki...  68.2    4e-10   
gb|KEH39620.1|  receptor-like kinase                                  67.8    4e-10   
gb|KHG11715.1|  hypothetical protein F383_04417                       68.2    4e-10   
ref|XP_010654871.1|  PREDICTED: probable receptor-like protein ki...  68.2    4e-10   
emb|CBI36481.3|  unnamed protein product                              68.2    4e-10   
emb|CDO98204.1|  unnamed protein product                              67.8    4e-10   
ref|XP_002308689.2|  hypothetical protein POPTR_0006s27640g           67.8    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006287772.1|  hypothetical protein CARUB_v10000982mg           67.8    5e-10   
ref|XP_006427538.1|  hypothetical protein CICLE_v10025618mg           67.0    5e-10   
ref|XP_006465261.1|  PREDICTED: probable receptor-like protein ki...  67.4    6e-10   
gb|KDO45590.1|  hypothetical protein CISIN_1g013636mg                 67.4    6e-10   
ref|XP_006427540.1|  hypothetical protein CICLE_v10025618mg           67.4    6e-10   
emb|CDX87329.1|  BnaA07g35440D                                        67.4    6e-10   
emb|CDY39959.1|  BnaC06g40370D                                        67.4    6e-10   
ref|XP_011036641.1|  PREDICTED: probable receptor-like protein ki...  67.4    6e-10   
ref|XP_002324316.2|  hypothetical protein POPTR_0018s02240g           67.4    7e-10   Populus trichocarpa [western balsam poplar]
dbj|BAK01376.1|  predicted protein                                    67.4    7e-10   
ref|XP_006389818.1|  hypothetical protein EUTSA_v10018582mg           67.4    7e-10   
ref|XP_011036640.1|  PREDICTED: probable receptor-like protein ki...  67.4    7e-10   
ref|XP_004235920.1|  PREDICTED: probable receptor-like protein ki...  67.0    8e-10   
ref|XP_011036639.1|  PREDICTED: probable receptor-like protein ki...  67.4    8e-10   
ref|XP_006341377.1|  PREDICTED: probable receptor-like protein ki...  67.0    8e-10   
ref|XP_006341376.1|  PREDICTED: probable receptor-like protein ki...  67.0    8e-10   
ref|XP_006341375.1|  PREDICTED: probable receptor-like protein ki...  67.0    8e-10   
ref|XP_007161155.1|  hypothetical protein PHAVU_001G047100g           67.0    9e-10   
ref|XP_009408035.1|  PREDICTED: probable receptor-like protein ki...  67.0    9e-10   
emb|CDY66126.1|  BnaC02g46490D                                        67.0    9e-10   
ref|XP_009398654.1|  PREDICTED: probable receptor-like protein ki...  66.6    1e-09   
ref|XP_008461169.1|  PREDICTED: probable receptor-like protein ki...  66.6    1e-09   
ref|XP_011085106.1|  PREDICTED: probable receptor-like protein ki...  65.9    1e-09   
ref|XP_011034498.1|  PREDICTED: probable receptor-like protein ki...  66.2    1e-09   
ref|XP_002515456.1|  Serine/threonine-protein kinase PBS1, putative   66.6    1e-09   Ricinus communis
ref|XP_002299270.2|  hypothetical protein POPTR_0001s14680g           66.2    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010537901.1|  PREDICTED: probable receptor-like protein ki...  66.2    1e-09   
ref|XP_004135868.1|  PREDICTED: probable receptor-like protein ki...  66.2    1e-09   
ref|XP_011034496.1|  PREDICTED: probable receptor-like protein ki...  66.2    2e-09   
ref|XP_002527325.1|  Serine/threonine-protein kinase PBS1, putative   66.2    2e-09   Ricinus communis
ref|XP_008784804.1|  PREDICTED: probable receptor-like protein ki...  66.2    2e-09   
gb|KGN45228.1|  hypothetical protein Csa_7G432090                     66.2    2e-09   
ref|XP_011034494.1|  PREDICTED: probable receptor-like protein ki...  66.2    2e-09   
ref|XP_011034495.1|  PREDICTED: probable receptor-like protein ki...  66.2    2e-09   
ref|XP_009106728.1|  PREDICTED: probable receptor-like protein ki...  66.2    2e-09   
ref|XP_009385055.1|  PREDICTED: probable receptor-like protein ki...  66.2    2e-09   
gb|KDP42003.1|  hypothetical protein JCGZ_27021                       66.2    2e-09   
emb|CDY53217.1|  BnaA02g19510D                                        65.9    2e-09   
ref|XP_009128401.1|  PREDICTED: probable receptor-like protein ki...  65.9    2e-09   
gb|KHG30143.1|  hypothetical protein F383_11668                       65.9    2e-09   
ref|XP_011020643.1|  PREDICTED: probable receptor-like protein ki...  65.5    3e-09   
ref|XP_010048917.1|  PREDICTED: probable receptor-like protein ki...  65.1    3e-09   
ref|XP_010048919.1|  PREDICTED: probable receptor-like protein ki...  64.7    3e-09   
gb|EEC78975.1|  hypothetical protein OsI_19455                        65.1    3e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001055185.1|  Os05g0319700                                     65.1    4e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEE63242.1|  hypothetical protein OsJ_18052                        65.1    4e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004486625.1|  PREDICTED: probable receptor-like protein ki...  64.3    6e-09   
ref|XP_011084596.1|  PREDICTED: probable receptor-like protein ki...  64.3    6e-09   
ref|XP_004237563.1|  PREDICTED: probable receptor-like protein ki...  63.5    9e-09   
ref|XP_002964857.1|  hypothetical protein SELMODRAFT_82782            63.2    1e-08   
ref|XP_002961785.1|  hypothetical protein SELMODRAFT_77404            63.2    1e-08   
ref|XP_011015399.1|  PREDICTED: probable receptor-like protein ki...  63.2    1e-08   
ref|XP_011015392.1|  PREDICTED: probable receptor-like protein ki...  63.2    1e-08   
gb|EYU31643.1|  hypothetical protein MIMGU_mgv1a0067151mg             60.5    2e-08   
ref|XP_007023374.1|  Serine/threonine-protein kinase PBS1 isoform 2   62.4    3e-08   
ref|XP_008452878.1|  PREDICTED: probable receptor-like protein ki...  60.5    1e-07   
gb|KGN55454.1|  hypothetical protein Csa_4G652670                     60.1    1e-07   
ref|XP_008452879.1|  PREDICTED: probable receptor-like protein ki...  60.1    1e-07   
ref|XP_002985113.1|  hypothetical protein SELMODRAFT_121956           59.3    2e-07   
ref|XP_004145589.1|  PREDICTED: probable receptor-like protein ki...  59.3    2e-07   
ref|XP_002969784.1|  hypothetical protein SELMODRAFT_92161            59.3    3e-07   
ref|XP_010942289.1|  PREDICTED: probable receptor-like protein ki...  59.3    3e-07   
ref|XP_002994462.1|  hypothetical protein SELMODRAFT_138628           58.9    3e-07   
ref|XP_006385923.1|  hypothetical protein POPTR_0003s17790g           57.0    2e-06   
gb|ADE76438.1|  unknown                                               56.6    3e-06   
ref|XP_001760290.1|  predicted protein                                55.8    4e-06   



>gb|AAO72616.1| protein kinase-like protein [Oryza sativa Japonica Group]
Length=225

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 3/57 (5%)
 Frame = +3

Query  138  HLFv*vaavavLCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS*FCSSR  308
            HL+  VAAVAVLCVQPEPSYRPLITDVLHSLIPLVP+ELGGTLR+  + P   C++R
Sbjct  167  HLYQQVAAVAVLCVQPEPSYRPLITDVLHSLIPLVPMELGGTLRISPESP---CATR  220



>ref|NP_001175499.1| Os08g0285600 [Oryza sativa Japonica Group]
 dbj|BAH94227.1| Os08g0285600, partial [Oryza sativa Japonica Group]
Length=91

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQ  281
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRVV Q
Sbjct  50   LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVVEQ  86



>dbj|BAJ86178.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=471

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 3/60 (5%)
 Frame = +3

Query  132  RDHLFv*vaavavLCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS*FCSSRT  311
            R HL+  VAAVAVLCVQPEPSYRPLITDVLHSLIPLVP++LGGTLR+  + P   C++R 
Sbjct  411  RKHLYQVVAAVAVLCVQPEPSYRPLITDVLHSLIPLVPMDLGGTLRINPESP---CTTRN  467



>ref|XP_009589309.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Nicotiana 
tomentosiformis]
Length=422

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/38 (95%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQ  284
            LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV SQ 
Sbjct  381  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVTSQH  418



>ref|XP_006338869.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
isoform X1 [Solanum tuberosum]
Length=360

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPL+P ELGGTLRV +QQ S
Sbjct  317  LCVQPEPSYRPLITDVLHSLIPLLPTELGGTLRVTTQQLS  356



>ref|XP_010665786.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=446

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS*FCSSRT  311
            LCVQPEPSYRPLITDVLHSL PLVPVELGGTLRV S+  + F   +T
Sbjct  399  LCVQPEPSYRPLITDVLHSLFPLVPVELGGTLRVNSRASTAFVEQQT  445



>gb|EAZ42183.1| hypothetical protein OsJ_26747 [Oryza sativa Japonica Group]
Length=444

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQ  281
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRVV Q
Sbjct  403  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVVEQ  439



>gb|EAZ06385.1| hypothetical protein OsI_28614 [Oryza sativa Indica Group]
Length=444

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQ  281
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRVV Q
Sbjct  403  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVVEQ  439



>ref|XP_009764253.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Nicotiana 
sylvestris]
Length=422

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQ  284
            LCVQPEPSYRPLITDVLHSLIPLVPVELGGT RV +Q+
Sbjct  381  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTFRVTTQR  418



>gb|AFW76181.1| putative protein kinase superfamily protein [Zea mays]
Length=82

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV  
Sbjct  36   LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVAE  71



>ref|XP_004973165.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
isoform X1 [Setaria italica]
Length=446

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQ  281
            LCVQPEPSYRPLITDVLHSL+PLVP+ELGGTLRVV Q
Sbjct  408  LCVQPEPSYRPLITDVLHSLVPLVPLELGGTLRVVEQ  444



>gb|EAY84745.1| hypothetical protein OsI_06115 [Oryza sativa Indica Group]
Length=505

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 3/46 (7%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS*FCSSR  308
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTLR+  + P   C++R
Sbjct  458  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLRISPESP---CATR  500



>gb|EAZ21983.1| hypothetical protein OsJ_05638 [Oryza sativa Japonica Group]
Length=500

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 3/46 (7%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS*FCSSR  308
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTLR+  + P   C++R
Sbjct  453  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLRISPESP---CATR  495



>ref|XP_010265697.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Nelumbo nucifera]
Length=442

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVPVELGG LR+    PS
Sbjct  395  LCVQPEPSYRPLITDVLHSLIPLVPVELGGALRITESAPS  434



>ref|XP_010265695.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Nelumbo nucifera]
Length=444

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVPVELGG LR+    PS
Sbjct  397  LCVQPEPSYRPLITDVLHSLIPLVPVELGGALRITESAPS  436



>ref|XP_006659284.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Oryza brachyantha]
Length=327

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRVV
Sbjct  286  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVV  320



>ref|XP_010048150.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Eucalyptus 
grandis]
 gb|KCW80317.1| hypothetical protein EUGRSUZ_C01681 [Eucalyptus grandis]
Length=450

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQ  281
            LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLR   Q
Sbjct  411  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRAAVQ  447



>ref|XP_002285386.2| PREDICTED: probable receptor-like protein kinase At1g80640 [Vitis 
vinifera]
 emb|CBI21096.3| unnamed protein product [Vitis vinifera]
Length=455

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSLIPLVPVELGG L+V  Q P
Sbjct  406  LCVQPEPSYRPLITDVLHSLIPLVPVELGGMLKVTQQAP  444



>ref|XP_010234548.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Brachypodium 
distachyon]
Length=457

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 1/48 (2%)
 Frame = +3

Query  138  HLFv*vaavavLCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQ  281
            HLF   A    LCVQPEPSYRPLI DVLHSL+PLVPVELGGTLR+V +
Sbjct  406  HLFQVAAVAV-LCVQPEPSYRPLIADVLHSLVPLVPVELGGTLRIVDE  452



>ref|XP_006483437.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Citrus sinensis]
 gb|KDO46785.1| hypothetical protein CISIN_1g012975mg [Citrus sinensis]
Length=452

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV    P
Sbjct  404  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVAPSGP  442



>ref|XP_006450333.1| hypothetical protein CICLE_v10008263mg [Citrus clementina]
 gb|ESR63573.1| hypothetical protein CICLE_v10008263mg [Citrus clementina]
Length=452

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV    P
Sbjct  404  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVAPSGP  442



>ref|XP_009126471.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Brassica 
rapa]
Length=413

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR++S
Sbjct  375  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLIS  410



>ref|XP_004498775.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cicer arietinum]
Length=442

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 2/42 (5%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV--VSQQPS  290
            LCVQPEP YRPLI DVLHSLIPLVPVELGGTLRV  V+QQP+
Sbjct  398  LCVQPEPCYRPLIADVLHSLIPLVPVELGGTLRVSQVTQQPA  439



>ref|NP_001137070.1| uncharacterized LOC100217243 [Zea mays]
 gb|ACF83197.1| unknown [Zea mays]
 gb|AFW87261.1| putative protein kinase superfamily protein [Zea mays]
Length=332

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRVV
Sbjct  286  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVV  320



>ref|XP_006399600.1| hypothetical protein EUTSA_v10013829mg [Eutrema salsugineum]
 gb|ESQ41053.1| hypothetical protein EUTSA_v10013829mg [Eutrema salsugineum]
Length=378

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTL+ +++  S
Sbjct  335  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLKTITRSSS  374



>gb|EMT19930.1| Serine/threonine-protein kinase PBS1 [Aegilops tauschii]
Length=472

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = +3

Query  132  RDHLFv*vaavavLCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS*FCSSRT  311
            R HL+   A    LCVQPEPSYRPLITDVLHSLIPLVP++LGG+LR+  + P   C +R 
Sbjct  413  RKHLYQVAAVAV-LCVQPEPSYRPLITDVLHSLIPLVPMDLGGSLRINPESP---CGARN  468



>ref|XP_003603322.1| Receptor-like protein kinase [Medicago truncatula]
Length=409

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV
Sbjct  362  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRV  395



>ref|XP_007217770.1| hypothetical protein PRUPE_ppa018107mg [Prunus persica]
 gb|EMJ18969.1| hypothetical protein PRUPE_ppa018107mg [Prunus persica]
Length=432

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGG+LR+    PS
Sbjct  392  LCVQPEPSYRPLITDVLHSLIPLVPIELGGSLRIADCVPS  431



>gb|ABU43071.1| wilt-resistance protein [Gossypium barbadense]
Length=260

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTLRV   QP+
Sbjct  221  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLRVT--QPT  258



>gb|AES73573.2| receptor-like kinase [Medicago truncatula]
Length=434

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 37/42 (88%), Gaps = 2/42 (5%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV--SQQPS  290
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV   S  PS
Sbjct  350  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVTQYSTDPS  391



>ref|XP_008228758.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Prunus 
mume]
Length=447

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGG+LR+    PS
Sbjct  407  LCVQPEPSYRPLITDVLHSLIPLVPIELGGSLRIADCVPS  446



>ref|XP_007023373.1| Serine/threonine-protein kinase PBS1 isoform 1 [Theobroma cacao]
 gb|EOY25995.1| Serine/threonine-protein kinase PBS1 isoform 1 [Theobroma cacao]
Length=475

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LC+QPEPSYRPLITDVLHSLIPLVP ELGG+LRV +  P
Sbjct  409  LCIQPEPSYRPLITDVLHSLIPLVPAELGGSLRVATASP  447



>ref|XP_004501365.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cicer arietinum]
Length=431

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/34 (100%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV
Sbjct  398  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  431



>gb|AAD23669.1| hypothetical protein [Arabidopsis thaliana]
Length=260

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ 
Sbjct  225  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLT  259



>gb|KDP33542.1| hypothetical protein JCGZ_07113 [Jatropha curcas]
Length=450

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEP+YRPLITDV+HSL+PL+PVELGGTLRV +Q  +
Sbjct  404  LCVQPEPTYRPLITDVVHSLVPLIPVELGGTLRVATQAAT  443



>ref|XP_007222630.1| hypothetical protein PRUPE_ppa008520mg [Prunus persica]
 gb|EMJ23829.1| hypothetical protein PRUPE_ppa008520mg [Prunus persica]
Length=328

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV   QP+
Sbjct  282  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVT--QPT  319



>ref|XP_003527781.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
isoform X1 [Glycine max]
 ref|XP_006581336.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
isoform X2 [Glycine max]
 gb|KHN07042.1| Putative receptor-like protein kinase [Glycine soja]
Length=412

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTLRV
Sbjct  375  LCVQPEPSYRPLITDVLHSLIPLVPIELGGTLRV  408



>emb|CDX68808.1| BnaC01g06450D [Brassica napus]
Length=415

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ S
Sbjct  377  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLTS  412



>emb|CDJ26232.1| hypothetical protein [Brassica oleracea]
Length=414

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ S
Sbjct  376  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLTS  411



>ref|XP_010105445.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXC04746.1| putative receptor-like protein kinase [Morus notabilis]
Length=382

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ +
Sbjct  347  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRITA  382



>emb|CDX75212.1| BnaA01g04900D [Brassica napus]
Length=413

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/36 (92%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ S
Sbjct  375  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLTS  410



>ref|XP_006412528.1| hypothetical protein EUTSA_v100253980mg, partial [Eutrema salsugineum]
 gb|ESQ53981.1| hypothetical protein EUTSA_v100253980mg, partial [Eutrema salsugineum]
Length=225

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+
Sbjct  187  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRL  220



>ref|XP_008658206.1| PREDICTED: uncharacterized LOC100217243 isoform X1 [Zea mays]
 gb|AFW87264.1| putative protein kinase superfamily protein [Zea mays]
Length=465

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/35 (97%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRVV
Sbjct  419  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVV  453



>ref|XP_006405129.1| hypothetical protein EUTSA_v10000655mg [Eutrema salsugineum]
 gb|ESQ46582.1| hypothetical protein EUTSA_v10000655mg [Eutrema salsugineum]
Length=426

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLR+ 
Sbjct  391  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRLT  425



>ref|NP_194928.3| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE85991.1| protein kinase family protein [Arabidopsis thaliana]
Length=418

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR++
Sbjct  380  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLI  414



>ref|NP_001190886.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE85992.1| protein kinase family protein [Arabidopsis thaliana]
Length=419

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR++
Sbjct  381  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLI  415



>ref|NP_001148336.1| phytosulfokine receptor precursor [Zea mays]
 gb|ACG30844.1| phytosulfokine receptor precursor [Zea mays]
Length=449

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV 
Sbjct  403  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVA  437



>emb|CAN76226.1| hypothetical protein VITISV_000266 [Vitis vinifera]
Length=342

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSLIPLVPVELGG L+   Q P
Sbjct  293  LCVQPEPSYRPLITDVLHSLIPLVPVELGGMLKXTQQAP  331



>ref|XP_010453137.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Camelina sativa]
Length=364

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTL+ +    S
Sbjct  321  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLKTIKSTSS  360



>ref|XP_003604596.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES86793.1| receptor-like kinase [Medicago truncatula]
Length=458

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/41 (88%), Positives = 37/41 (90%), Gaps = 2/41 (5%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV--VSQQP  287
            LCVQPEP YRPLI DVLHSLIPLVPVELGGTLRV  V+QQP
Sbjct  414  LCVQPEPCYRPLIADVLHSLIPLVPVELGGTLRVSQVTQQP  454



>ref|XP_010419656.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Camelina sativa]
Length=364

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTL+ +    S
Sbjct  321  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLKTIKSTSS  360



>gb|KHG26656.1| hypothetical protein F383_33408 [Gossypium arboreum]
Length=444

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTLRV 
Sbjct  405  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLRVT  439



>ref|XP_007136974.1| hypothetical protein PHAVU_009G089500g [Phaseolus vulgaris]
 gb|ESW08968.1| hypothetical protein PHAVU_009G089500g [Phaseolus vulgaris]
Length=418

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTLRV
Sbjct  381  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLRV  414



>ref|XP_010453136.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Camelina sativa]
Length=388

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTL+ +    S
Sbjct  345  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLKTIKSTSS  384



>ref|XP_009362336.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Pyrus 
x bretschneideri]
Length=456

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV    P
Sbjct  408  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVTQPGP  446



>ref|XP_007136973.1| hypothetical protein PHAVU_009G089500g [Phaseolus vulgaris]
 gb|ESW08967.1| hypothetical protein PHAVU_009G089500g [Phaseolus vulgaris]
Length=417

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/34 (97%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTLRV
Sbjct  380  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLRV  413



>gb|ACN34797.1| unknown [Zea mays]
 gb|AFW76182.1| putative protein kinase superfamily protein [Zea mays]
Length=447

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV 
Sbjct  401  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVA  435



>ref|XP_009340218.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009340220.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009341656.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009341658.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009341660.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009341662.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Pyrus x bretschneideri]
Length=456

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV    P
Sbjct  408  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVTQPGP  446



>ref|XP_009340217.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009340219.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341655.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341657.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341659.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341661.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Pyrus x bretschneideri]
Length=459

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/39 (87%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV    P
Sbjct  411  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVTQPGP  449



>ref|XP_006848777.1| hypothetical protein AMTR_s00026p00089830 [Amborella trichopoda]
 gb|ERN10358.1| hypothetical protein AMTR_s00026p00089830 [Amborella trichopoda]
Length=452

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGG LRV   +P+
Sbjct  410  LCVQPEPSYRPLITDVLHSLIPLVPIELGGALRVSEPKPT  449



>ref|XP_004138848.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cucumis sativus]
 ref|XP_004160788.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cucumis sativus]
Length=400

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +3

Query  138  HLFv*vaavavLCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQ  284
            HLF   A    LCVQPEPSYRPLITDVLHSLIPLVPVELGGT R  + Q
Sbjct  347  HLFQVAAVAV-LCVQPEPSYRPLITDVLHSLIPLVPVELGGTHRSSTSQ  394



>emb|CDP18793.1| unnamed protein product [Coffea canephora]
Length=462

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = +3

Query  138  HLFv*vaavavLCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            HLF   A    LCVQPEPSYRPLITDVLHSL+PLVP+ELGGTLRV
Sbjct  405  HLFQVAAVAV-LCVQPEPSYRPLITDVLHSLVPLVPMELGGTLRV  448



>ref|XP_002437355.1| hypothetical protein SORBIDRAFT_10g025460 [Sorghum bicolor]
 gb|EER88722.1| hypothetical protein SORBIDRAFT_10g025460 [Sorghum bicolor]
Length=470

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV 
Sbjct  424  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVA  458



>ref|NP_180094.5| protein kinase family protein [Arabidopsis thaliana]
 gb|AEC07672.1| protein kinase family protein [Arabidopsis thaliana]
Length=414

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ 
Sbjct  379  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLT  413



>ref|XP_002453413.1| hypothetical protein SORBIDRAFT_04g005600 [Sorghum bicolor]
 gb|EES06389.1| hypothetical protein SORBIDRAFT_04g005600 [Sorghum bicolor]
Length=517

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVP+ELGGTLR+  + P
Sbjct  470  LCVQPEPSYRPLITDVLHSLVPLVPMELGGTLRISPESP  508



>ref|XP_004965735.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Setaria italica]
Length=464

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV 
Sbjct  418  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVA  452



>ref|XP_009773864.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Nicotiana 
sylvestris]
Length=446

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHS IPLVP+ELGG+LRVV 
Sbjct  404  LCVQPEPSYRPLITDVLHSFIPLVPIELGGSLRVVD  439



>ref|XP_009607949.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Nicotiana 
tomentosiformis]
Length=447

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHS IPLVP+ELGG+LRVV 
Sbjct  405  LCVQPEPSYRPLITDVLHSFIPLVPIELGGSLRVVD  440



>ref|XP_004305485.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Fragaria vesca subsp. vesca]
Length=458

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPL+TDVLHSLIPLVPV+LGG+LR+    PS
Sbjct  412  LCVQPEPSYRPLMTDVLHSLIPLVPVDLGGSLRIADYIPS  451



>ref|NP_001148817.1| LOC100282434 precursor [Zea mays]
 gb|ACG33002.1| phytosulfokine receptor precursor [Zea mays]
Length=458

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVP ELGGTLR+  + P
Sbjct  416  LCVQPEPSYRPLITDVLHSLVPLVPTELGGTLRIGPESP  454



>ref|XP_004951670.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Setaria italica]
Length=471

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVP+ELGGTLR+  + P
Sbjct  422  LCVQPEPSYRPLITDVLHSLVPLVPMELGGTLRINPESP  460



>ref|XP_010063546.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Eucalyptus grandis]
Length=451

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LC+QPEPSYRPLITDVLHSLIPLVPVELGG+LRV    P+
Sbjct  405  LCIQPEPSYRPLITDVLHSLIPLVPVELGGSLRVTEPVPT  444



>ref|XP_010419655.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Camelina sativa]
Length=427

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTL+ +    S
Sbjct  384  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLKTIKSTSS  423



>ref|XP_002880664.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56923.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=384

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ 
Sbjct  349  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLT  383



>ref|XP_010437970.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Camelina 
sativa]
Length=422

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ 
Sbjct  384  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLT  418



>ref|XP_010432787.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Camelina 
sativa]
Length=422

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ 
Sbjct  384  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLT  418



>ref|XP_010491792.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Camelina 
sativa]
Length=429

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTL+ +    S
Sbjct  386  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLKTIKSTSS  425



>ref|XP_010063545.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Eucalyptus grandis]
 gb|KCW70786.1| hypothetical protein EUGRSUZ_F03945 [Eucalyptus grandis]
Length=455

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LC+QPEPSYRPLITDVLHSLIPLVPVELGG+LRV    P+
Sbjct  409  LCIQPEPSYRPLITDVLHSLIPLVPVELGGSLRVTEPVPT  448



>gb|KGN62978.1| hypothetical protein Csa_2G382510 [Cucumis sativus]
Length=445

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +3

Query  138  HLFv*vaavavLCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQ  284
            HLF   A    LCVQPEPSYRPLITDVLHSLIPLVPVELGGT R  + Q
Sbjct  392  HLFQVAAVAV-LCVQPEPSYRPLITDVLHSLIPLVPVELGGTHRSSTSQ  439



>ref|XP_010447455.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Camelina 
sativa]
Length=422

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ 
Sbjct  384  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLT  418



>ref|XP_008445251.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Cucumis 
melo]
Length=446

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/49 (76%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +3

Query  138  HLFv*vaavavLCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQ  284
            HLF   A    LCVQPEPSYRPLITDVLHSLIPLVPVELGGT R  + Q
Sbjct  393  HLFQVAAVAV-LCVQPEPSYRPLITDVLHSLIPLVPVELGGTHRSSTSQ  440



>ref|NP_001189598.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEC07673.1| protein kinase family protein [Arabidopsis thaliana]
Length=437

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ 
Sbjct  402  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLT  436



>ref|XP_009140631.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Brassica 
rapa]
Length=433

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ 
Sbjct  398  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLT  432



>emb|CDY35369.1| BnaA04g14780D [Brassica napus]
Length=433

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ 
Sbjct  398  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLT  432



>emb|CDY62504.1| BnaC04g56350D [Brassica napus]
Length=433

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ 
Sbjct  398  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLT  432



>ref|XP_006294253.1| hypothetical protein CARUB_v10023249mg [Capsella rubella]
 gb|EOA27151.1| hypothetical protein CARUB_v10023249mg [Capsella rubella]
Length=433

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLR  269
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR
Sbjct  398  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLR  430



>ref|XP_010097152.1| putative receptor-like protein kinase [Morus notabilis]
 gb|EXB67219.1| putative receptor-like protein kinase [Morus notabilis]
Length=446

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPLVP ELGG+LRV+
Sbjct  405  LCVQPEPSYRPLITDVLHSLIPLVPAELGGSLRVM  439



>ref|XP_006283813.1| hypothetical protein CARUB_v10004912mg [Capsella rubella]
 gb|EOA16711.1| hypothetical protein CARUB_v10004912mg [Capsella rubella]
Length=418

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR+ 
Sbjct  380  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRLT  414



>ref|XP_008219557.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Prunus 
mume]
Length=453

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLRV 
Sbjct  407  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLRVT  441



>gb|AFW70452.1| putative protein kinase superfamily protein [Zea mays]
Length=506

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVP ELGGTLR+  + P
Sbjct  464  LCVQPEPSYRPLITDVLHSLVPLVPTELGGTLRIGPESP  502



>ref|XP_008386501.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Malus domestica]
Length=450

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEP+YRPLITDVLHSLIPLVP+ LGG+LR+    PS
Sbjct  410  LCVQPEPTYRPLITDVLHSLIPLVPIHLGGSLRITGNVPS  449



>ref|XP_008386502.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Malus domestica]
Length=449

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEP+YRPLITDVLHSLIPLVP+ LGG+LR+    PS
Sbjct  409  LCVQPEPTYRPLITDVLHSLIPLVPIHLGGSLRITGNVPS  448



>ref|XP_007011760.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY29379.1| Kinase superfamily protein [Theobroma cacao]
Length=435

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/40 (83%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSL+PLVP+ELGGTLR+   QP+
Sbjct  396  LCVQPEPSYRPLITDVLHSLVPLVPMELGGTLRIT--QPA  433



>gb|EPS67710.1| hypothetical protein M569_07063, partial [Genlisea aurea]
Length=200

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLITDVLHS+IPLVPV+LGG+LRV
Sbjct  166  LCVQPEPSYRPLITDVLHSIIPLVPVDLGGSLRV  199



>ref|XP_010245528.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Nelumbo 
nucifera]
Length=449

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/35 (94%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPLVPVELGG LRV 
Sbjct  402  LCVQPEPSYRPLITDVLHSLIPLVPVELGGALRVT  436



>emb|CAB96857.1| ser/thr specific protein kinase-like protein [Arabidopsis thaliana]
Length=356

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTL+ +
Sbjct  314  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLKTI  348



>ref|XP_008352063.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Malus domestica]
Length=458

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVPV+LGGTLRV    P
Sbjct  410  LCVQPEPSYRPLITDVLHSLVPLVPVDLGGTLRVTQPGP  448



>ref|XP_008352064.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Malus domestica]
Length=455

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVPV+LGGTLRV    P
Sbjct  407  LCVQPEPSYRPLITDVLHSLVPLVPVDLGGTLRVTQPGP  445



>ref|XP_009355816.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Pyrus 
x bretschneideri]
Length=457

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVPV+LGGTLRV    P
Sbjct  409  LCVQPEPSYRPLITDVLHSLVPLVPVDLGGTLRVTQPGP  447



>ref|XP_010932226.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Elaeis 
guineensis]
Length=455

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LC+QPEPSYRPLITDVLHSL+PLVP ELGGTLRV    P
Sbjct  408  LCIQPEPSYRPLITDVLHSLVPLVPTELGGTLRVAEPSP  446



>emb|CAC03450.1| ser/thr specific protein kinase-like protein [Arabidopsis thaliana]
Length=402

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTL+ +
Sbjct  360  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLKTI  394



>ref|XP_008788934.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Phoenix dactylifera]
Length=458

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVP ELGGTLR+    P
Sbjct  411  LCVQPEPSYRPLITDVLHSLVPLVPTELGGTLRIAEPSP  449



>ref|XP_008788933.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Phoenix dactylifera]
Length=460

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL+PLVP ELGGTLR+    P
Sbjct  413  LCVQPEPSYRPLITDVLHSLVPLVPTELGGTLRIAEPSP  451



>gb|KHN31890.1| Putative receptor-like protein kinase [Glycine soja]
Length=424

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVPVELGG+LRV 
Sbjct  385  LCVQSEPSYRPLITDVLHSLIPLVPVELGGSLRVT  419



>ref|XP_003542131.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Glycine max]
Length=424

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVPVELGG+LRV 
Sbjct  385  LCVQSEPSYRPLITDVLHSLIPLVPVELGGSLRVT  419



>ref|XP_010239937.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Brachypodium 
distachyon]
Length=461

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVP ELGGTLRV 
Sbjct  413  LCVQPEPSYRPLITDVLHSLVPLVPAELGGTLRVA  447



>gb|ACU21242.1| unknown [Glycine max]
Length=391

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 1/40 (3%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLI DVLHSLIPLVPVELGGTL+ VSQ P 
Sbjct  340  LCVQPEPSYRPLIADVLHSLIPLVPVELGGTLK-VSQLPK  378



>gb|KHN22414.1| Putative receptor-like protein kinase [Glycine soja]
Length=428

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVPVELGG+LRV 
Sbjct  385  LCVQSEPSYRPLITDVLHSLIPLVPVELGGSLRVT  419



>ref|XP_003546919.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
isoform X1 [Glycine max]
Length=428

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVPVELGG+LRV 
Sbjct  385  LCVQSEPSYRPLITDVLHSLIPLVPVELGGSLRVT  419



>gb|KHN29609.1| Putative receptor-like protein kinase, partial [Glycine soja]
Length=387

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLI DVLHSLIPLVP+ELGGTLRV
Sbjct  350  LCVQPEPSYRPLIIDVLHSLIPLVPIELGGTLRV  383



>ref|XP_010541586.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Tarenaya 
hassleriana]
Length=440

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLI DVLHSLIPLVP+ELGGTLR  S
Sbjct  400  LCVQPEPSYRPLIRDVLHSLIPLVPMELGGTLRTAS  435



>gb|AAA98917.1| Theoretical protein with similarity to GenBank Accession Number 
L22302 serine/threonine protein kinase [Arabidopsis thaliana]
Length=346

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR++
Sbjct  312  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIL  346



>ref|XP_006597107.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
isoform X2 [Glycine max]
Length=435

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVPVELGG+LRV 
Sbjct  392  LCVQSEPSYRPLITDVLHSLIPLVPVELGGSLRVT  426



>ref|NP_850806.2| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AED91623.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=433

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTL+ +
Sbjct  391  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLKTI  425



>gb|EYU21700.1| hypothetical protein MIMGU_mgv1a019541mg [Erythranthe guttata]
Length=378

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLITDVLHS IPLVPV+LGG+LRV
Sbjct  345  LCVQPEPSYRPLITDVLHSFIPLVPVDLGGSLRV  378



>ref|XP_004290926.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Fragaria vesca subsp. vesca]
Length=460

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLR  269
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGTLR
Sbjct  412  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTLR  444



>ref|XP_002873491.1| kinase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49750.1| kinase [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTL+ +
Sbjct  394  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLKTI  428



>ref|XP_003570779.2| PREDICTED: probable receptor-like protein kinase At1g80640 [Brachypodium 
distachyon]
Length=478

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLITDVLHSL PLVP+ELGGTLR+  + P
Sbjct  431  LCVQPEPSYRPLITDVLHSLTPLVPLELGGTLRINPESP  469



>ref|XP_011073360.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Sesamum indicum]
Length=398

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHS IPLVPV+LGG+LRV 
Sbjct  356  LCVQPEPSYRPLITDVLHSFIPLVPVDLGGSLRVT  390



>gb|KFK42447.1| hypothetical protein AALP_AA2G257900 [Arabis alpina]
Length=414

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR++
Sbjct  380  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIL  414



>ref|XP_010417684.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Camelina sativa]
Length=429

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR++
Sbjct  395  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIL  429



>ref|XP_007150792.1| hypothetical protein PHAVU_005G181000g [Phaseolus vulgaris]
 gb|ESW22786.1| hypothetical protein PHAVU_005G181000g [Phaseolus vulgaris]
Length=428

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVPVELGG+LR+ 
Sbjct  385  LCVQAEPSYRPLITDVLHSLIPLVPVELGGSLRIT  419



>ref|XP_006302288.1| hypothetical protein CARUB_v10020332mg [Capsella rubella]
 gb|EOA35186.1| hypothetical protein CARUB_v10020332mg [Capsella rubella]
Length=425

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR++
Sbjct  391  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIL  425



>ref|XP_010417683.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Camelina sativa]
Length=433

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR++
Sbjct  399  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIL  433



>ref|XP_006302289.1| hypothetical protein CARUB_v10020332mg [Capsella rubella]
 gb|EOA35187.1| hypothetical protein CARUB_v10020332mg [Capsella rubella]
Length=428

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR++
Sbjct  394  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIL  428



>ref|XP_010654872.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Vitis vinifera]
Length=396

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR+ 
Sbjct  349  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIT  383



>gb|KHG06993.1| hypothetical protein F383_33282 [Gossypium arboreum]
Length=437

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 2/40 (5%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLVP+ELG TLRV   QP+
Sbjct  398  LCVQPEPSYRPLITDVLHSLIPLVPMELGATLRVT--QPT  435



>ref|XP_006578125.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
isoform X2 [Glycine max]
Length=418

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLI DVLHSLIPLVP+ELGGTLRV
Sbjct  381  LCVQPEPSYRPLIIDVLHSLIPLVPIELGGTLRV  414



>emb|CAN79180.1| hypothetical protein VITISV_019748 [Vitis vinifera]
Length=453

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR+ 
Sbjct  406  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIT  440



>ref|XP_010429929.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Camelina 
sativa]
Length=446

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR++
Sbjct  412  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIL  446



>ref|XP_003550202.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Glycine max]
 gb|KHN22517.1| Putative receptor-like protein kinase [Glycine soja]
Length=452

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLI DVLHSLIPLVPVELGGTL+V
Sbjct  401  LCVQPEPSYRPLIADVLHSLIPLVPVELGGTLKV  434



>ref|XP_003544601.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Glycine max]
 gb|KHN04159.1| Putative receptor-like protein kinase [Glycine soja]
Length=440

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 36/39 (92%), Gaps = 1/39 (3%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQP  287
            LCVQPEPSYRPLI DVLHSLIPLVPVELGGTL+ VSQ P
Sbjct  400  LCVQPEPSYRPLIADVLHSLIPLVPVELGGTLK-VSQLP  437



>ref|NP_178179.2| probable receptor-like protein kinase [Arabidopsis thaliana]
 sp|Q0V7T5.1|Y1864_ARATH RecName: Full=Probable receptor-like protein kinase At1g80640; 
Flags: Precursor [Arabidopsis thaliana]
 gb|ABH04592.1| At1g80640 [Arabidopsis thaliana]
 gb|AEE36430.1| probable receptor-like protein kinase [Arabidopsis thaliana]
Length=427

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR++
Sbjct  393  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIL  427



>ref|XP_003523677.2| PREDICTED: probable receptor-like protein kinase At1g80640-like 
isoform X1 [Glycine max]
Length=416

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/34 (94%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPEPSYRPLI DVLHSLIPLVP+ELGGTLRV
Sbjct  379  LCVQPEPSYRPLIIDVLHSLIPLVPIELGGTLRV  412



>ref|XP_010474456.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Camelina 
sativa]
Length=293

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVPVELGGT R+ 
Sbjct  258  LCVQPEPSYRPLITDVLHSLVPLVPVELGGTHRLT  292



>ref|XP_002889281.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65540.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=429

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR++
Sbjct  395  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIL  429



>gb|AAF27131.1|AC018849_19 putative protein kinase; 6651-4392 [Arabidopsis thaliana]
Length=444

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR++
Sbjct  410  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIL  444



>ref|XP_009122002.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Brassica 
rapa]
Length=436

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLV +ELGGTL+ + +  S
Sbjct  393  LCVQPEPSYRPLITDVLHSLIPLVTMELGGTLKTIRRSAS  432



>emb|CDX69790.1| BnaA10g21390D [Brassica napus]
Length=436

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLV +ELGGTL+ + +  S
Sbjct  393  LCVQPEPSYRPLITDVLHSLIPLVTMELGGTLKTIRRSAS  432



>ref|XP_011073359.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Sesamum indicum]
Length=447

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQ  281
            LCVQPEPSYRPLITDVLHS IPLVPV+LGG+LRV   
Sbjct  405  LCVQPEPSYRPLITDVLHSFIPLVPVDLGGSLRVTDS  441



>ref|XP_006654258.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Oryza brachyantha]
Length=393

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVP ELGGTLR  
Sbjct  347  LCVQPEPSYRPLITDVLHSLVPLVPTELGGTLRAA  381



>emb|CDX97074.1| BnaC09g45510D [Brassica napus]
Length=436

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQPEPSYRPLITDVLHSLIPLV +ELGGTL+ + +  S
Sbjct  393  LCVQPEPSYRPLITDVLHSLIPLVTMELGGTLKTIRRSAS  432



>ref|XP_011039611.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Populus 
euphratica]
Length=446

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LC+QPEPSYRPLITDV+HSL+PLVP+ELGGTLRV   QP+
Sbjct  404  LCIQPEPSYRPLITDVVHSLVPLVPLELGGTLRVA--QPT  441



>gb|KEH39620.1| receptor-like kinase [Medicago truncatula]
Length=415

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVP+ELGG+LRV 
Sbjct  372  LCVQAEPSYRPLITDVLHSLIPLVPLELGGSLRVT  406



>gb|KHG11715.1| hypothetical protein F383_04417 [Gossypium arboreum]
Length=441

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LC+QPEPSYRPLITDVLHSLIPLVP+ELGG+LR+
Sbjct  407  LCIQPEPSYRPLITDVLHSLIPLVPIELGGSLRL  440



>ref|XP_010654871.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Vitis vinifera]
Length=456

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR+ 
Sbjct  409  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIT  443



>emb|CBI36481.3| unnamed protein product [Vitis vinifera]
Length=456

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 34/35 (97%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PVELGG+LR+ 
Sbjct  409  LCVQPEPSYRPLITDVLHSLIPLLPVELGGSLRIT  443



>emb|CDO98204.1| unnamed protein product [Coffea canephora]
Length=440

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHS IPLVPVELGG+L+V 
Sbjct  406  LCVQPEPSYRPLITDVLHSFIPLVPVELGGSLKVA  440



>ref|XP_002308689.2| hypothetical protein POPTR_0006s27640g [Populus trichocarpa]
 gb|EEE92212.2| hypothetical protein POPTR_0006s27640g [Populus trichocarpa]
Length=452

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 2/40 (5%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LC+QPEPSYRPLITDV+HSL+PLVP+ELGGTLRV   QP+
Sbjct  407  LCIQPEPSYRPLITDVVHSLVPLVPLELGGTLRVA--QPT  444



>ref|XP_006287772.1| hypothetical protein CARUB_v10000982mg [Capsella rubella]
 gb|EOA20670.1| hypothetical protein CARUB_v10000982mg [Capsella rubella]
Length=438

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLR  269
            LCVQPEPSYRPLITDVLHSLIPLVP+ELGGTL+
Sbjct  395  LCVQPEPSYRPLITDVLHSLIPLVPMELGGTLK  427



>ref|XP_006427538.1| hypothetical protein CICLE_v10025618mg [Citrus clementina]
 gb|ESR40778.1| hypothetical protein CICLE_v10025618mg [Citrus clementina]
Length=334

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LC+QPEPSYRPLITDVLHSLIPLVP +LGG+LRV 
Sbjct  300  LCIQPEPSYRPLITDVLHSLIPLVPTDLGGSLRVT  334



>ref|XP_006465261.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Citrus sinensis]
Length=439

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LC+QPEPSYRPLITDVLHSLIPLVP +LGG+LRV 
Sbjct  405  LCIQPEPSYRPLITDVLHSLIPLVPTDLGGSLRVT  439



>gb|KDO45590.1| hypothetical protein CISIN_1g013636mg [Citrus sinensis]
Length=439

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LC+QPEPSYRPLITDVLHSLIPLVP +LGG+LRV 
Sbjct  405  LCIQPEPSYRPLITDVLHSLIPLVPTDLGGSLRVT  439



>ref|XP_006427540.1| hypothetical protein CICLE_v10025618mg [Citrus clementina]
 gb|ESR40780.1| hypothetical protein CICLE_v10025618mg [Citrus clementina]
Length=439

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LC+QPEPSYRPLITDVLHSLIPLVP +LGG+LRV 
Sbjct  405  LCIQPEPSYRPLITDVLHSLIPLVPTDLGGSLRVT  439



>emb|CDX87329.1| BnaA07g35440D [Brassica napus]
Length=428

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+P+ELGG+LR++
Sbjct  394  LCVQPEPSYRPLITDVLHSLIPLLPLELGGSLRIL  428



>emb|CDY39959.1| BnaC06g40370D [Brassica napus]
Length=427

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+P+ELGG+LR++
Sbjct  393  LCVQPEPSYRPLITDVLHSLIPLLPLELGGSLRIL  427



>ref|XP_011036641.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X3 [Populus euphratica]
Length=406

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LC+QPEPSYRPLITDV+HSL+PLVP+ELGGTLRV
Sbjct  348  LCIQPEPSYRPLITDVVHSLVPLVPLELGGTLRV  381



>ref|XP_002324316.2| hypothetical protein POPTR_0018s02240g [Populus trichocarpa]
 gb|EEF02881.2| hypothetical protein POPTR_0018s02240g [Populus trichocarpa]
Length=464

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LC+QPEPSYRPLITDV+HSL+PLVP+ELGGTLRV
Sbjct  406  LCIQPEPSYRPLITDVVHSLVPLVPLELGGTLRV  439



>dbj|BAK01376.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSL+PLVP +LGGTLRV 
Sbjct  414  LCVQPEPSYRPLITDVLHSLVPLVPADLGGTLRVT  448



>ref|XP_006389818.1| hypothetical protein EUTSA_v10018582mg [Eutrema salsugineum]
 gb|ESQ27104.1| hypothetical protein EUTSA_v10018582mg [Eutrema salsugineum]
Length=434

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+PV+LGG+LR++
Sbjct  400  LCVQPEPSYRPLITDVLHSLIPLLPVDLGGSLRIL  434



>ref|XP_011036640.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Populus euphratica]
Length=445

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LC+QPEPSYRPLITDV+HSL+PLVP+ELGGTLRV
Sbjct  387  LCIQPEPSYRPLITDVVHSLVPLVPLELGGTLRV  420



>ref|XP_004235920.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Solanum 
lycopersicum]
Length=446

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHS IPLVP++LGG+LR+  
Sbjct  404  LCVQPEPSYRPLITDVLHSFIPLVPIDLGGSLRIAD  439



>ref|XP_011036639.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Populus euphratica]
Length=465

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 34/34 (100%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LC+QPEPSYRPLITDV+HSL+PLVP+ELGGTLRV
Sbjct  407  LCIQPEPSYRPLITDVVHSLVPLVPLELGGTLRV  440



>ref|XP_006341377.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
isoform X3 [Solanum tuberosum]
Length=443

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHS IPLVP++LGG+LR+  
Sbjct  401  LCVQPEPSYRPLITDVLHSFIPLVPIDLGGSLRIAD  436



>ref|XP_006341376.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
isoform X2 [Solanum tuberosum]
Length=445

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHS IPLVP++LGG+LR+  
Sbjct  403  LCVQPEPSYRPLITDVLHSFIPLVPIDLGGSLRIAD  438



>ref|XP_006341375.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
isoform X1 [Solanum tuberosum]
Length=446

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEPSYRPLITDVLHS IPLVP++LGG+LR+  
Sbjct  404  LCVQPEPSYRPLITDVLHSFIPLVPIDLGGSLRIAD  439



>ref|XP_007161155.1| hypothetical protein PHAVU_001G047100g [Phaseolus vulgaris]
 gb|ESW33149.1| hypothetical protein PHAVU_001G047100g [Phaseolus vulgaris]
Length=451

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEP+YRPLI DVLHSLIPLVPVELGGTL+V 
Sbjct  400  LCVQPEPTYRPLIADVLHSLIPLVPVELGGTLKVT  434



>ref|XP_009408035.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Musa 
acuminata subsp. malaccensis]
Length=447

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVPVELGG LRV+
Sbjct  404  LCVQQEPSYRPLITDVLHSLIPLVPVELGGMLRVI  438



>emb|CDY66126.1| BnaC02g46490D [Brassica napus]
Length=428

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+P+ELGG+LR++
Sbjct  394  LCVQPEPSYRPLITDVLHSLIPLLPLELGGSLRIL  428



>ref|XP_009398654.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Musa 
acuminata subsp. malaccensis]
Length=460

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LC+Q EPSYRPLITDVLHSLIPLVPVELGG LRVV
Sbjct  413  LCIQQEPSYRPLITDVLHSLIPLVPVELGGMLRVV  447



>ref|XP_008461169.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Cucumis 
melo]
Length=455

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPL+TDVLHSLIPLVPVELGG+LR+ 
Sbjct  409  LCVQSEPSYRPLVTDVLHSLIPLVPVELGGSLRIT  443



>ref|XP_011085106.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Sesamum indicum]
Length=331

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/32 (94%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTL  266
            LCVQPEPSYRPLITD+LHSL+PLVPVELGGTL
Sbjct  300  LCVQPEPSYRPLITDILHSLVPLVPVELGGTL  331



>ref|XP_011034498.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X4 [Populus euphratica]
Length=393

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVP+ELGG+LRV 
Sbjct  349  LCVQQEPSYRPLITDVLHSLIPLVPLELGGSLRVT  383



>ref|XP_002515456.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF46905.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=446

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQPEP+YRPLITDV+HSLIPL+P+ELGGTLR+ +
Sbjct  403  LCVQPEPTYRPLITDVVHSLIPLIPLELGGTLRLAT  438



>ref|XP_002299270.2| hypothetical protein POPTR_0001s14680g [Populus trichocarpa]
 gb|EEE84075.2| hypothetical protein POPTR_0001s14680g [Populus trichocarpa]
Length=391

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQ EPSYRPLITDVLHSLIPLVP+ELGG+LRV
Sbjct  347  LCVQQEPSYRPLITDVLHSLIPLVPLELGGSLRV  380



>ref|XP_010537901.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Tarenaya 
hassleriana]
Length=442

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQ EPSYRPLITDVLHSLIPL+PVELGG+LR+
Sbjct  408  LCVQSEPSYRPLITDVLHSLIPLLPVELGGSLRI  441



>ref|XP_004135868.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cucumis sativus]
 ref|XP_004173587.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cucumis sativus]
Length=441

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPL+TDVLHSLIPLVPVELGG+LR+ 
Sbjct  395  LCVQSEPSYRPLVTDVLHSLIPLVPVELGGSLRMT  429



>ref|XP_011034496.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X3 [Populus euphratica]
Length=452

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/35 (89%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVP+ELGG+LRV 
Sbjct  408  LCVQQEPSYRPLITDVLHSLIPLVPLELGGSLRVT  442



>ref|XP_002527325.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF35077.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=397

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVSQQPS  290
            LCVQ EPSYRPLITDVLHSLIPL+P+ELGG+LR+    PS
Sbjct  357  LCVQQEPSYRPLITDVLHSLIPLLPLELGGSLRITEPVPS  396



>ref|XP_008784804.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Phoenix 
dactylifera]
Length=413

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEP YRPL+TDVLHSLIPLVP+ELGGT RV+
Sbjct  366  LCVQPEPGYRPLMTDVLHSLIPLVPIELGGTTRVM  400



>gb|KGN45228.1| hypothetical protein Csa_7G432090 [Cucumis sativus]
Length=455

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPL+TDVLHSLIPLVPVELGG+LR+ 
Sbjct  409  LCVQSEPSYRPLVTDVLHSLIPLVPVELGGSLRMT  443



>ref|XP_011034494.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Populus euphratica]
Length=455

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQ EPSYRPLITDVLHSLIPLVP+ELGG+LRV
Sbjct  411  LCVQQEPSYRPLITDVLHSLIPLVPLELGGSLRV  444



>ref|XP_011034495.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Populus euphratica]
Length=453

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQ EPSYRPLITDVLHSLIPLVP+ELGG+LRV
Sbjct  409  LCVQQEPSYRPLITDVLHSLIPLVPLELGGSLRV  442



>ref|XP_009106728.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Brassica 
rapa]
Length=424

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+P++LGG+LR++
Sbjct  390  LCVQPEPSYRPLITDVLHSLIPLLPLDLGGSLRIL  424



>ref|XP_009385055.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Musa 
acuminata subsp. malaccensis]
Length=456

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/35 (91%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVP ELGGTLRV 
Sbjct  409  LCVQREPSYRPLITDVLHSLIPLVPTELGGTLRVT  443



>gb|KDP42003.1| hypothetical protein JCGZ_27021 [Jatropha curcas]
Length=456

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LC+Q EPSYRPLITDVLHSLIPLVP+ELGG+LR+ 
Sbjct  411  LCIQQEPSYRPLITDVLHSLIPLVPLELGGSLRIT  445



>emb|CDY53217.1| BnaA02g19510D [Brassica napus]
Length=422

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+P++LGG+LR++
Sbjct  388  LCVQPEPSYRPLITDVLHSLIPLLPLDLGGSLRIL  422



>ref|XP_009128401.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Brassica 
rapa]
Length=430

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 35/35 (100%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQPEPSYRPLITDVLHSLIPL+P++LGG+LR++
Sbjct  396  LCVQPEPSYRPLITDVLHSLIPLLPLDLGGSLRIL  430



>gb|KHG30143.1| hypothetical protein F383_11668 [Gossypium arboreum]
Length=499

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LC+QPEPSYRPLITDVLHSLIPLVP+EL G+LRV 
Sbjct  465  LCIQPEPSYRPLITDVLHSLIPLVPMELRGSLRVT  499



>ref|XP_011020643.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Populus 
euphratica]
 ref|XP_011020644.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Populus 
euphratica]
 ref|XP_011020645.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Populus 
euphratica]
 ref|XP_011020646.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Populus 
euphratica]
 ref|XP_011020647.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Populus 
euphratica]
Length=402

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQ EPSYRPLITDVLHSLIPLVP+ELGG+LR+  
Sbjct  358  LCVQQEPSYRPLITDVLHSLIPLVPLELGGSLRITG  393



>ref|XP_010048917.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010048918.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Eucalyptus grandis]
 gb|KCW81336.1| hypothetical protein EUGRSUZ_C02722 [Eucalyptus grandis]
Length=376

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLR  269
            LC+QPEP YRPLITDVLHSLIPLVPVELGGTL+
Sbjct  343  LCLQPEPIYRPLITDVLHSLIPLVPVELGGTLK  375



>ref|XP_010048919.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Eucalyptus grandis]
Length=345

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLR  269
            LC+QPEP YRPLITDVLHSLIPLVPVELGGTL+
Sbjct  312  LCLQPEPIYRPLITDVLHSLIPLVPVELGGTLK  344



>gb|EEC78975.1| hypothetical protein OsI_19455 [Oryza sativa Indica Group]
Length=463

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQ EPSYRPLITDVLHSL+PLVP ELGGTLR 
Sbjct  417  LCVQAEPSYRPLITDVLHSLVPLVPTELGGTLRA  450



>ref|NP_001055185.1| Os05g0319700 [Oryza sativa Japonica Group]
 gb|AAV44083.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAV44123.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17099.1| Os05g0319700 [Oryza sativa Japonica Group]
 dbj|BAG97991.1| unnamed protein product [Oryza sativa Japonica Group]
Length=478

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQ EPSYRPLITDVLHSL+PLVP ELGGTLR 
Sbjct  432  LCVQAEPSYRPLITDVLHSLVPLVPTELGGTLRA  465



>gb|EEE63242.1| hypothetical protein OsJ_18052 [Oryza sativa Japonica Group]
Length=539

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQ EPSYRPLITDVLHSL+PLVP ELGGTLR 
Sbjct  493  LCVQAEPSYRPLITDVLHSLVPLVPTELGGTLRA  526



>ref|XP_004486625.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cicer arietinum]
Length=420

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVP+ELG +LRV 
Sbjct  377  LCVQAEPSYRPLITDVLHSLIPLVPLELGRSLRVT  411



>ref|XP_011084596.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Sesamum 
indicum]
Length=412

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQPE SYRPLITDVLHS IPLVP ELGG+LR 
Sbjct  368  LCVQPEASYRPLITDVLHSFIPLVPAELGGSLRT  401



>ref|XP_004237563.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Solanum 
lycopersicum]
Length=349

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTL  266
            LCVQPEPSYRPLITDVLHSLIPL+P +LGGTL
Sbjct  313  LCVQPEPSYRPLITDVLHSLIPLLPTQLGGTL  344



>ref|XP_002964857.1| hypothetical protein SELMODRAFT_82782, partial [Selaginella moellendorffii]
 gb|EFJ33695.1| hypothetical protein SELMODRAFT_82782, partial [Selaginella moellendorffii]
Length=334

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLI DV++SLIPLVP+ELGGTLRV 
Sbjct  271  LCVQAEPSYRPLIADVVNSLIPLVPIELGGTLRVA  305



>ref|XP_002961785.1| hypothetical protein SELMODRAFT_77404, partial [Selaginella moellendorffii]
 gb|EFJ37045.1| hypothetical protein SELMODRAFT_77404, partial [Selaginella moellendorffii]
Length=327

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLI DV++SLIPLVP+ELGGTLRV 
Sbjct  264  LCVQAEPSYRPLIADVVNSLIPLVPIELGGTLRVA  298



>ref|XP_011015399.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Populus euphratica]
Length=377

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQ EPSYRPLITDVLHSLIPLVP+ LGG+LR+  
Sbjct  333  LCVQQEPSYRPLITDVLHSLIPLVPLALGGSLRITG  368



>ref|XP_011015392.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Populus euphratica]
 ref|XP_011015393.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Populus euphratica]
 ref|XP_011015394.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Populus euphratica]
 ref|XP_011015395.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Populus euphratica]
 ref|XP_011015396.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Populus euphratica]
Length=402

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVV  275
            LCVQ EPSYRPLITDVLHSLIPLVP+ LGG+LR+ 
Sbjct  358  LCVQQEPSYRPLITDVLHSLIPLVPLALGGSLRIT  392



>gb|EYU31643.1| hypothetical protein MIMGU_mgv1a0067151mg, partial [Erythranthe 
guttata]
Length=183

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQ E SYRPLITD+LHSL+PLVP+ LGGTLR ++
Sbjct  143  LCVQGEASYRPLITDILHSLVPLVPLHLGGTLRDIA  178



>ref|XP_007023374.1| Serine/threonine-protein kinase PBS1 isoform 2 [Theobroma cacao]
 gb|EOY25996.1| Serine/threonine-protein kinase PBS1 isoform 2 [Theobroma cacao]
Length=463

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/30 (93%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGG  260
            LC+QPEPSYRPLITDVLHSLIPLVP ELGG
Sbjct  409  LCIQPEPSYRPLITDVLHSLIPLVPAELGG  438



>ref|XP_008452878.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X1 [Cucumis melo]
Length=367

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQ E SYRPLI DVLHSLI LVP+ELGGTLR+
Sbjct  329  LCVQGESSYRPLIKDVLHSLIALVPIELGGTLRL  362



>gb|KGN55454.1| hypothetical protein Csa_4G652670 [Cucumis sativus]
Length=368

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQ E SYRPLI DVLHSLI LVP+ELGGTLR+
Sbjct  330  LCVQGEASYRPLIKDVLHSLIALVPIELGGTLRL  363



>ref|XP_008452879.1| PREDICTED: probable receptor-like protein kinase At1g80640 isoform 
X2 [Cucumis melo]
Length=318

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQ E SYRPLI DVLHSLI LVP+ELGGTLR+
Sbjct  280  LCVQGESSYRPLIKDVLHSLIALVPIELGGTLRL  313



>ref|XP_002985113.1| hypothetical protein SELMODRAFT_121956, partial [Selaginella 
moellendorffii]
 gb|EFJ13607.1| hypothetical protein SELMODRAFT_121956, partial [Selaginella 
moellendorffii]
Length=314

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQ EPSYRPLI DV++SLIPLVP ELGG LR + 
Sbjct  264  LCVQSEPSYRPLIGDVVNSLIPLVPCELGGALRAID  299



>ref|XP_004145589.1| PREDICTED: probable receptor-like protein kinase At1g80640-like 
[Cucumis sativus]
Length=367

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRV  272
            LCVQ E SYRPLI DVLHSLI LVP+ELGGTLR+
Sbjct  329  LCVQGEASYRPLIKDVLHSLIALVPIELGGTLRL  362



>ref|XP_002969784.1| hypothetical protein SELMODRAFT_92161, partial [Selaginella moellendorffii]
 gb|EFJ28908.1| hypothetical protein SELMODRAFT_92161, partial [Selaginella moellendorffii]
Length=314

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQ EPSYRPLI DV++SLIPLVP ELGG LR + 
Sbjct  264  LCVQSEPSYRPLIGDVVNSLIPLVPCELGGALRAID  299



>ref|XP_010942289.1| PREDICTED: probable receptor-like protein kinase At1g80640 [Elaeis 
guineensis]
Length=381

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGT  263
            LC+QPEP YRPLI DVLHSLIPLVP+ELGG 
Sbjct  350  LCIQPEPGYRPLIADVLHSLIPLVPIELGGA  380



>ref|XP_002994462.1| hypothetical protein SELMODRAFT_138628 [Selaginella moellendorffii]
 gb|EFJ04469.1| hypothetical protein SELMODRAFT_138628 [Selaginella moellendorffii]
Length=269

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLRVVS  278
            LCVQ EPSYRPLI DV++SLIPLVP ELGG LR + 
Sbjct  219  LCVQSEPSYRPLIGDVVNSLIPLVPCELGGALRAID  254



>ref|XP_006385923.1| hypothetical protein POPTR_0003s17790g [Populus trichocarpa]
 gb|ERP63720.1| hypothetical protein POPTR_0003s17790g [Populus trichocarpa]
Length=388

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGG  260
            LCVQ EPSYRPLITDVLHSLIPLVP+EL G
Sbjct  358  LCVQQEPSYRPLITDVLHSLIPLVPLELEG  387



>gb|ADE76438.1| unknown [Picea sitchensis]
Length=587

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLR  269
            LCVQ EP YRPLITDV  SL+PLVPVELGG L+
Sbjct  515  LCVQNEPDYRPLITDVAKSLMPLVPVELGGALK  547



>ref|XP_001760290.1| predicted protein [Physcomitrella patens]
 gb|EDQ75046.1| predicted protein [Physcomitrella patens]
Length=297

 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  171  LCVQPEPSYRPLITDVLHSLIPLVPVELGGTLR  269
            LCVQ EPSYRPLI DV+ SL PLVP ELGG LR
Sbjct  265  LCVQAEPSYRPLIADVVQSLAPLVPQELGGALR  297



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 754980566040