BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10055_g1_i1 len=575 path=[1:0-574]

Length=575
                                                                      Score     E

ref|XP_009617824.1|  PREDICTED: olee1-like protein                      158   5e-45   
ref|XP_009773994.1|  PREDICTED: olee1-like protein                      154   2e-43   
ref|XP_007025385.1|  Olee1-like protein                                 137   5e-37   
ref|XP_011085997.1|  PREDICTED: olee1-like protein                      134   7e-36   
ref|XP_010103032.1|  hypothetical protein L484_005787                   133   2e-35   
gb|EYU43331.1|  hypothetical protein MIMGU_mgv1a014984mg                131   9e-35   
ref|XP_007212169.1|  hypothetical protein PRUPE_ppa012463mg             130   2e-34   
sp|O49813.1|OLEE1_BETPN  RecName: Full=Olee1-like protein; Flags:...    130   3e-34   Betula pendula [white birch]
ref|XP_010057097.1|  PREDICTED: olee1-like protein                      130   4e-34   
ref|XP_011080816.1|  PREDICTED: major pollen allergen Ole e 1-like      128   1e-33   
ref|XP_002522577.1|  Pollen allergen Che a 1 precursor, putative        128   2e-33   Ricinus communis
gb|ADK22842.1|  Sal k 5                                                 125   8e-33   
ref|XP_008371469.1|  PREDICTED: olee1-like protein                      126   1e-32   
gb|EPS70684.1|  hypothetical protein M569_04073                         126   1e-32   
ref|XP_002273294.1|  PREDICTED: olee1-like protein                      126   1e-32   Vitis vinifera
ref|XP_009348994.1|  PREDICTED: olee1-like protein                      126   1e-32   
ref|XP_009759546.1|  PREDICTED: olee1-like protein                      125   2e-32   
ref|XP_010686203.1|  PREDICTED: pollen allergen Che a 1                 125   2e-32   
pir||S43242  allergen-like protein Syr v I isoform 1 - Syringa vu...    124   3e-32
ref|XP_009608960.1|  PREDICTED: olee1-like protein                      124   5e-32   
ref|XP_009352776.1|  PREDICTED: olee1-like protein                      124   8e-32   
ref|XP_008225283.1|  PREDICTED: olee1-like protein                      123   1e-31   
ref|XP_010441660.1|  PREDICTED: pollen-specific protein-like At4g...    123   1e-31   
ref|XP_010481521.1|  PREDICTED: pollen-specific protein-like At4g...    123   1e-31   
ref|XP_008383629.1|  PREDICTED: olee1-like protein                      124   1e-31   
ref|XP_004233077.1|  PREDICTED: major pollen allergen Lig v 1-like      123   1e-31   
ref|XP_011075462.1|  PREDICTED: olee1-like protein                      122   2e-31   
sp|Q8LGR0.1|CHE1_CHEAL  RecName: Full=Pollen allergen Che a 1; Al...    122   3e-31   Chenopodium album [lamb's-quarters]
gb|ABP58635.1|  major pollen allergen Ole e 1                           121   3e-31   Olea europaea
sp|O82015.2|LIGV1_LIGVU  RecName: Full=Major pollen allergen Lig ...    121   3e-31   Ligustrum vulgare [prim]
ref|XP_010529196.1|  PREDICTED: pollen-specific protein-like At4g...    122   4e-31   
ref|XP_010518802.1|  PREDICTED: pollen-specific protein-like At4g...    122   4e-31   
ref|XP_002523378.1|  Anther-specific protein LAT52 precursor, put...    122   5e-31   Ricinus communis
ref|XP_004134662.1|  PREDICTED: olee1-like protein-like                 122   5e-31   
gb|KGN49303.1|  hypothetical protein Csa_6G519560                       122   5e-31   
gb|AAX93750.1|  pollen allergen Cro s 1                                 121   6e-31   Crocus sativus [saffron crocus]
ref|XP_010494740.1|  PREDICTED: pollen-specific protein-like At4g...    121   7e-31   
pir||S43244  allergen-like protein Syr v I isoform 3 - Syringa vu...    120   7e-31
pir||S43243  allergen-like protein Syr v I isoform 2 - Syringa vu...    120   9e-31
ref|NP_567562.1|  pollen Ole e 1 allergen and extensin family pro...    121   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004485892.1|  PREDICTED: olee1-like protein-like                 120   1e-30   
pir||B53806  major allergen OLE5c - common olive                        120   1e-30
emb|CDX77620.1|  BnaC07g18740D                                          120   2e-30   
ref|XP_006398273.1|  hypothetical protein EUTSA_v10001051mg             120   2e-30   
ref|XP_011079002.1|  PREDICTED: olee1-like protein                      120   2e-30   
ref|XP_011006522.1|  PREDICTED: olee1-like protein                      120   2e-30   
emb|CDX99452.1|  BnaC01g11000D                                          120   3e-30   
gb|AFK46977.1|  unknown                                                 120   3e-30   
ref|XP_006370166.1|  pollen Ole e 1 allergen and extensin family ...    119   3e-30   
emb|CAA73037.1|  Ole e 1.0103 protein                                   119   3e-30   Olea europaea
emb|CAA73038.1|  Ole e 1.0102 protein                                   119   4e-30   Olea europaea
ref|XP_006281481.1|  hypothetical protein CARUB_v10027565mg             119   4e-30   
ref|XP_006414083.1|  hypothetical protein EUTSA_v10026398mg             119   4e-30   
emb|CAA54819.1|  major allergen                                         118   4e-30   Ligustrum vulgare [prim]
ref|XP_006284941.1|  hypothetical protein CARUB_v10006240mg             119   5e-30   
ref|XP_009132011.1|  PREDICTED: pollen-specific protein-like At4g...    119   5e-30   
sp|P19963.2|ALL1_OLEEU  RecName: Full=Major pollen allergen Ole e...    118   6e-30   Olea europaea
ref|XP_010434511.1|  PREDICTED: pollen-specific protein-like At4g...    119   7e-30   
ref|XP_010496255.1|  PREDICTED: pollen-specific protein-like At4g...    119   7e-30   
emb|CDX87759.1|  BnaC02g31900D                                          119   8e-30   
ref|XP_002863445.1|  hypothetical protein ARALYDRAFT_494394             119   9e-30   
gb|ABP58633.1|  major pollen allergen Ole e 1                           117   9e-30   Olea europaea
ref|XP_009128814.1|  PREDICTED: pollen-specific protein-like At4g...    119   9e-30   
emb|CAA73036.1|  Ole e 1 protein                                        117   1e-29   Olea europaea
gb|ABP58636.1|  major pollen allergen Ole e 1                           117   1e-29   Olea europaea
gb|ABP58632.1|  major pollen allergen Ole e 1                           117   1e-29   Olea europaea
ref|XP_002870034.1|  pollen ole e 1 allergen and extensin family ...    118   1e-29   
ref|XP_009101556.1|  PREDICTED: pollen-specific protein-like At4g...    118   1e-29   
gb|KFK28529.1|  hypothetical protein AALP_AA7G008600                    118   1e-29   
ref|XP_010439832.1|  PREDICTED: pollen-specific protein-like At4g...    118   1e-29   
ref|XP_011075627.1|  PREDICTED: olee1-like protein                      117   1e-29   
gb|AEK85660.1|  major pollen allergen Ole e1                            117   2e-29   
pir||C53806  major allergen OLE1c - common olive (fragment)             117   2e-29
gb|AFK47865.1|  unknown                                                 117   2e-29   
gb|AEK85661.1|  major pollen allergen Ole e1                            117   2e-29   
ref|XP_003546028.1|  PREDICTED: olee1-like protein-like                 117   2e-29   
ref|XP_009108374.1|  PREDICTED: pollen-specific protein-like At4g...    117   2e-29   
gb|ABP58634.1|  major pollen allergen Ole e 1                           116   2e-29   Olea europaea
emb|CDX99789.1|  BnaC05g22110D                                          117   2e-29   
emb|CDY65576.1|  BnaC09g52000D                                          117   2e-29   
pir||E53806  major allergen OLE17 - common olive (fragment)             116   2e-29
ref|XP_004134927.1|  PREDICTED: olee1-like protein-like                 117   2e-29   
gb|AEK85663.1|  major pollen allergen Ole e1                            116   3e-29   
pir||I53806  major allergen OLE16 - common olive (fragment)             116   3e-29
gb|ACU23617.1|  unknown                                                 117   3e-29   Glycine max [soybeans]
ref|XP_009114385.1|  PREDICTED: pollen-specific protein-like At4g...    117   3e-29   
emb|CDY52214.1|  BnaAnng11370D                                          117   4e-29   
gb|KFK31513.1|  hypothetical protein AALP_AA6G122400                    117   4e-29   
gb|AAN18042.1|  major pollen allergen Ole e 1                           115   4e-29   Olea europaea
pir||H53806  major allergen OLE6 - common olive (fragment)              115   4e-29
ref|XP_009604804.1|  PREDICTED: anther-specific protein LAT52           116   5e-29   
gb|AAQ07442.1|  major pollen allergen Ole e 1                           115   6e-29   Olea europaea
pir||G53806  major allergen OLE26 - common olive (fragment)             115   6e-29
ref|NP_568650.1|  pollen_Ole_e_I-domain containing protein              116   7e-29   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB09316.1|  Ole e I (main olive allergen)-like protein             116   7e-29   Arabidopsis thaliana [mouse-ear cress]
pir||F53806  major allergen OLE19 - common olive (fragment)             115   7e-29
gb|AAQ10267.1|  major pollen allergen Ole e 1                           115   8e-29   Olea europaea
ref|XP_009115274.1|  PREDICTED: pollen-specific protein-like At4g...    116   9e-29   
gb|AEK85659.1|  major pollen allergen Ole e1                            115   9e-29   
gb|AFB73932.1|  LAT52-like protein                                      115   1e-28   
gb|AAQ10269.1|  major pollen allergen Ole e 1                           114   1e-28   Olea europaea
gb|AFB73931.1|  LAT52-like protein                                      115   1e-28   
ref|XP_010540511.1|  PREDICTED: pollen-specific protein-like At4g...    115   1e-28   
emb|CDY01556.1|  BnaC07g35460D                                          115   1e-28   
ref|XP_010549400.1|  PREDICTED: pollen-specific protein-like At4g...    115   2e-28   
ref|XP_011029563.1|  PREDICTED: olee1-like protein                      115   2e-28   
gb|KHG25858.1|  Olee1-like protein                                      115   2e-28   
ref|XP_010538209.1|  PREDICTED: pollen-specific protein-like At4g...    115   2e-28   
ref|XP_009794171.1|  PREDICTED: anther-specific protein LAT52           114   3e-28   
ref|XP_007148052.1|  hypothetical protein PHAVU_006G176500g             114   3e-28   
ref|XP_008439742.1|  PREDICTED: olee1-like protein isoform X1           114   3e-28   
pir||A38968  major allergen OLE20 - common olive (fragment)             113   4e-28
ref|XP_009136942.1|  PREDICTED: pollen-specific protein-like At4g...    114   4e-28   
gb|AAQ83588.1|  allergen Fra e 1                                        113   4e-28   Fraxinus excelsior
gb|AAQ08188.1|  major pollen allergen Ole e 1                           113   4e-28   Olea europaea
ref|XP_009602640.1|  PREDICTED: anther-specific protein LAT52-like      114   4e-28   
ref|XP_007021723.1|  Pollen Ole e 1 allergen and extensin family ...    114   5e-28   
ref|XP_008439743.1|  PREDICTED: olee1-like protein isoform X2           113   7e-28   
gb|AAB32652.2|  main olive allergen                                     112   8e-28   Olea europaea
ref|XP_003541705.1|  PREDICTED: olee1-like protein-like                 113   8e-28   
gb|AAQ08947.1|  allergen Fra e 1.0101                                   112   9e-28   Fraxinus excelsior
gb|KFK44745.1|  hypothetical protein AALP_AA1G297400                    113   1e-27   
ref|XP_008450951.1|  PREDICTED: olee1-like protein                      113   1e-27   
ref|XP_010277041.1|  PREDICTED: anther-specific protein LAT52           113   1e-27   
gb|AAV74343.1|  Fra e 1.0102 major allergen                             112   1e-27   Fraxinus excelsior
gb|AAM65838.1|  Ole e I (main olive allergen)-like protein              113   1e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CAA16739.1|  pollen-specific protein - like                         120   1e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010499433.1|  PREDICTED: pollen-specific protein-like At4g...    112   2e-27   
ref|XP_002316866.1|  pollen Ole e 1 allergen and extensin family ...    112   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_010460686.1|  PREDICTED: pollen-specific protein-like At4g...    112   2e-27   
ref|XP_006360048.1|  PREDICTED: anther-specific protein LAT52-like      112   2e-27   
gb|AEK85658.1|  major pollen allergen Ole e1                            111   2e-27   
ref|XP_009778120.1|  PREDICTED: anther-specific protein LAT52-like      112   2e-27   
ref|XP_004144129.1|  PREDICTED: olee1-like protein-like                 112   2e-27   
gb|AAQ10274.1|  major pollen allergen Ole e 1                           111   2e-27   Olea europaea
gb|AAQ10277.1|  major pollen allergen Ole e 1                           111   2e-27   Olea europaea
ref|XP_010478273.1|  PREDICTED: pollen-specific protein-like At4g...    112   3e-27   
gb|AEK85662.1|  major pollen allergen Ole e1                            110   3e-27   
ref|NP_174209.1|  pollen Ole e 1 allergen and extensin family pro...    111   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109686.1|  PREDICTED: pollen-specific protein-like At4g...    111   4e-27   
ref|XP_004248244.1|  PREDICTED: anther-specific protein LAT52           111   5e-27   
ref|XP_006304746.1|  hypothetical protein CARUB_v10012122mg             111   5e-27   
emb|CDY43319.1|  BnaC03g58910D                                          111   6e-27   
emb|CDY69202.1|  BnaCnng62360D                                          111   6e-27   
ref|XP_009102877.1|  PREDICTED: pollen-specific protein-like At4g...    111   7e-27   
gb|KCW69946.1|  hypothetical protein EUGRSUZ_F03264                     110   8e-27   
gb|AAO22132.1|  major pollen allergen Ole e 1                           109   1e-26   Olea europaea
gb|AAQ10272.1|  major pollen allergen Ole e 1                           109   1e-26   Olea europaea
gb|ACJ83911.1|  unknown                                                 110   1e-26   Medicago truncatula
ref|XP_004251892.1|  PREDICTED: anther-specific protein LAT52-like      110   1e-26   
ref|XP_006415610.1|  hypothetical protein EUTSA_v10008921mg             110   1e-26   
ref|XP_010062811.1|  PREDICTED: olee1-like protein                      110   2e-26   
gb|KDP32532.1|  hypothetical protein JCGZ_14735                         109   3e-26   
gb|ACF82695.1|  unknown                                                 108   7e-26   Zea mays [maize]
gb|ACG33223.1|  pollen-specific protein C13 precursor                   108   9e-26   Zea mays [maize]
ref|XP_006358942.1|  PREDICTED: anther-specific protein LAT52-like      107   1e-25   
gb|ABP58637.1|  major pollen allergen Ole e 1                           107   1e-25   Olea europaea
ref|XP_010941451.1|  PREDICTED: pollen-specific protein C13-like        107   1e-25   
ref|XP_008467237.1|  PREDICTED: olee1-like protein                      107   2e-25   
ref|XP_010317514.1|  PREDICTED: olee1-like protein                      105   3e-25   
gb|AAQ10273.1|  major pollen allergen Ole e 1                           105   4e-25   Olea europaea
ref|XP_011078225.1|  PREDICTED: pollen allergen Che a 1-like            106   4e-25   
gb|AAQ10280.1|  major pollen allergen Ole e 1                           105   5e-25   Olea europaea
ref|NP_001148343.1|  LOC100281953 precursor                             106   5e-25   Zea mays [maize]
ref|XP_004143635.1|  PREDICTED: olee1-like protein-like                 105   5e-25   
ref|XP_011101379.1|  PREDICTED: olee1-like protein                      106   6e-25   
ref|XP_010261236.1|  PREDICTED: pollen-specific protein C13-like        105   1e-24   
ref|XP_004293940.1|  PREDICTED: olee1-like protein-like                 104   2e-24   
ref|XP_011101449.1|  PREDICTED: olee1-like protein                      104   2e-24   
ref|XP_009761932.1|  PREDICTED: anther-specific protein LAT52-like      104   2e-24   
gb|AAQ10281.1|  major pollen allergen Ole e 1                           103   3e-24   Olea europaea
ref|XP_006348395.1|  PREDICTED: anther-specific protein LAT52-like      103   3e-24   
gb|AAQ10279.1|  major pollen allergen Ole e 1                           102   4e-24   Olea europaea
ref|NP_001105351.1|  pollen-specific protein C13 precursor              103   5e-24   Zea mays [maize]
gb|AAO22133.1|  major pollen allergen Ole e 1                           101   1e-23   Olea europaea
ref|XP_010321468.1|  PREDICTED: LOW QUALITY PROTEIN: major pollen...    102   1e-23   
ref|XP_002447728.1|  hypothetical protein SORBIDRAFT_06g014740          102   1e-23   Sorghum bicolor [broomcorn]
ref|XP_004244268.1|  PREDICTED: anther-specific protein LAT52-like      102   2e-23   
gb|EYU45018.1|  hypothetical protein MIMGU_mgv1a015317mg                102   2e-23   
gb|EYU26327.1|  hypothetical protein MIMGU_mgv1a015422mg                101   2e-23   
ref|XP_006366520.1|  PREDICTED: olee1-like protein-like                 100   4e-23   
ref|XP_010269200.1|  PREDICTED: pollen-specific protein C13-like        100   5e-23   
ref|XP_009598969.1|  PREDICTED: anther-specific protein LAT52-like      100   5e-23   
gb|KDP21093.1|  hypothetical protein JCGZ_21564                         101   1e-22   
ref|XP_002268073.1|  PREDICTED: pollen-specific protein C13           99.8    1e-22   Vitis vinifera
ref|XP_006857531.1|  hypothetical protein AMTR_s00061p00032820        99.0    2e-22   
gb|AAN76546.1|AF393475_1  LLP-B3 protein                              99.0    2e-22   Lilium longiflorum [Easter lily]
ref|XP_006652233.1|  PREDICTED: pollen-specific protein C13-like      98.6    4e-22   
ref|XP_010942360.1|  PREDICTED: pollen allergen Phl p 11-like         98.6    5e-22   
ref|XP_006464247.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        98.2    5e-22   
ref|XP_011070069.1|  PREDICTED: anther-specific protein LAT52-like    97.8    6e-22   
emb|CDP16229.1|  unnamed protein product                              97.8    6e-22   
gb|KDO80906.1|  hypothetical protein CISIN_1g031458mg                 97.4    8e-22   
ref|XP_006472638.1|  PREDICTED: pollen-specific protein C13-like      97.4    9e-22   
emb|CDO96791.1|  unnamed protein product                              96.3    1e-21   
ref|XP_009342278.1|  PREDICTED: olee1-like protein                    97.1    1e-21   
ref|XP_006428158.1|  hypothetical protein CICLE_v10027141mg           99.0    1e-21   
ref|XP_006434027.1|  hypothetical protein CICLE_v10002743mg           97.1    1e-21   
ref|XP_008359333.1|  PREDICTED: olee1-like protein                    97.1    1e-21   
ref|XP_008234009.1|  PREDICTED: pollen-specific protein C13           96.7    1e-21   
ref|XP_009408781.1|  PREDICTED: pollen-specific protein C13-like      97.1    1e-21   
gb|KHG10520.1|  Olee1-like protein                                    97.1    2e-21   
emb|CDP06002.1|  unnamed protein product                              96.7    2e-21   
ref|XP_004975466.1|  PREDICTED: pollen-specific protein C13-like      96.7    2e-21   
ref|XP_010942359.1|  PREDICTED: major pollen allergen Lol p 11-like   96.7    2e-21   
ref|XP_008226528.1|  PREDICTED: olee1-like protein                    96.3    2e-21   
gb|EPS72638.1|  hypothetical protein M569_02120                       96.3    3e-21   
ref|XP_009340070.1|  PREDICTED: olee1-like protein                    96.3    3e-21   
ref|XP_008775180.1|  PREDICTED: pollen-specific protein C13-like      95.9    3e-21   
ref|XP_007225977.1|  hypothetical protein PRUPE_ppa012675mg           95.5    4e-21   
ref|XP_011101376.1|  PREDICTED: pollen allergen Che a 1-like isof...  95.9    5e-21   
ref|XP_002307393.1|  pollen Ole e 1 allergen and extensin family ...  95.1    5e-21   Populus trichocarpa [western balsam poplar]
gb|EAY93952.1|  hypothetical protein OsI_15725                        95.5    6e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_002890794.1|  hypothetical protein ARALYDRAFT_336019             100   6e-21   
ref|XP_009334049.1|  PREDICTED: olee1-like protein                    95.1    7e-21   
emb|CAH66537.1|  H0209H04.4                                           95.1    7e-21   Oryza sativa [red rice]
ref|XP_011102257.1|  PREDICTED: olee1-like protein                    95.1    7e-21   
ref|XP_008376286.1|  PREDICTED: pollen-specific protein C13-like      94.7    8e-21   
ref|XP_002513885.1|  Pollen-specific protein C13 precursor, putative  94.7    9e-21   Ricinus communis
ref|NP_001052674.1|  Os04g0398700                                     94.7    9e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008378536.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        95.9    1e-20   
ref|XP_003566418.1|  PREDICTED: major pollen allergen Lol p 11-like   94.7    1e-20   
ref|XP_011101377.1|  PREDICTED: olee1-like protein isoform X2         94.7    1e-20   
ref|XP_011006159.1|  PREDICTED: pollen-specific protein C13-like      94.4    1e-20   
gb|KDP46869.1|  hypothetical protein JCGZ_24078                       94.4    1e-20   
ref|XP_008348540.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        94.4    1e-20   
ref|XP_008797140.1|  PREDICTED: major pollen allergen Lol p 11-like   94.4    2e-20   
ref|XP_007018845.1|  Pollen-specific protein C13, putative            93.6    2e-20   
gb|ADI55168.1|  AS1                                                   94.0    3e-20   
ref|XP_007213539.1|  hypothetical protein PRUPE_ppa019680mg           93.6    3e-20   
ref|XP_011016068.1|  PREDICTED: pollen-specific protein C13-like      93.2    3e-20   
ref|XP_009396935.1|  PREDICTED: pollen-specific protein C13-like      93.2    3e-20   
ref|XP_007206364.1|  hypothetical protein PRUPE_ppa017800mg           93.2    4e-20   
gb|EYU31033.1|  hypothetical protein MIMGU_mgv1a015328mg              93.2    4e-20   
ref|XP_009764546.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        93.2    4e-20   
gb|ABC86745.1|  pollen-specific protein                               93.2    4e-20   Vitis pseudoreticulata
ref|XP_011090511.1|  PREDICTED: major pollen allergen Lol p 11-like   92.8    4e-20   
ref|XP_011098227.1|  PREDICTED: anther-specific protein LAT52-like    92.8    4e-20   
dbj|BAK06698.1|  predicted protein                                    92.8    5e-20   
ref|XP_008234688.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        92.8    6e-20   
ref|XP_010538956.1|  PREDICTED: major pollen allergen Lol p 11        92.4    6e-20   
gb|KHG13789.1|  Anther-specific LAT52                                 93.2    6e-20   
ref|XP_010436385.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        92.4    7e-20   
ref|XP_009134109.1|  PREDICTED: pollen-specific protein C13           92.4    7e-20   
ref|XP_009600627.1|  PREDICTED: major pollen allergen Lol p 11-like   92.0    8e-20   
gb|AEW90946.1|  pollen-specific protein F8-4                          92.0    9e-20   
ref|NP_001057857.1|  Os06g0556600                                     92.4    9e-20   Oryza sativa Japonica Group [Japonica rice]
emb|CDY05022.1|  BnaC03g28200D                                        92.0    1e-19   
emb|CDY12288.1|  BnaA09g24880D                                        92.0    1e-19   
ref|NP_001150330.1|  pollen allergen Phl p 11 precursor               92.0    1e-19   Zea mays [maize]
ref|XP_004489034.1|  PREDICTED: olee1-like protein-like               91.7    1e-19   
ref|XP_009403224.1|  PREDICTED: pollen-specific protein C13-like      91.7    1e-19   
ref|XP_008245042.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        91.3    2e-19   
ref|XP_010535648.1|  PREDICTED: major pollen allergen Lol p 11-like   91.3    2e-19   
ref|XP_002310579.1|  hypothetical protein POPTR_0007s05750g           90.9    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_008782123.1|  PREDICTED: pollen-specific protein C13-like      91.3    2e-19   
gb|ABK92993.1|  unknown                                               90.9    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_002301038.1|  pollen Ole e 1 allergen and extensin family ...  90.9    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_008363638.1|  PREDICTED: olee1-like protein                    90.9    2e-19   
gb|AEW90948.1|  pollen-specific protein F8-6                          90.9    2e-19   
gb|ABK94215.1|  unknown                                               90.9    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010455288.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        90.5    3e-19   
gb|AEW90941.1|  group 11 grass pollen allergen F7-4                   90.9    3e-19   
ref|XP_009402012.1|  PREDICTED: pollen-specific protein C13-like      90.5    3e-19   
gb|AFW77548.1|  pollen allergen Phl p 11                              90.5    4e-19   
ref|XP_009366359.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        90.1    5e-19   
dbj|BAK07321.1|  predicted protein                                    90.1    5e-19   
ref|XP_003634471.1|  PREDICTED: pollen-specific protein C13           89.7    5e-19   
ref|XP_002392460.1|  hypothetical protein MPER_07958                  89.7    6e-19   Moniliophthora perniciosa FA553
ref|XP_009797814.1|  PREDICTED: major pollen allergen Lol p 11-like   89.7    7e-19   
ref|XP_006289520.1|  hypothetical protein CARUB_v10003061mg           89.7    8e-19   
ref|XP_010060161.1|  PREDICTED: protein DOWNSTREAM OF FLC             89.4    9e-19   
gb|KHG12773.1|  Olee1-like protein                                    89.7    9e-19   
gb|KDP32694.1|  hypothetical protein JCGZ_11986                       89.4    1e-18   
gb|AEW90942.1|  group 11 grass pollen allergen F7-6                   89.4    1e-18   
gb|EMT13715.1|  Pollen allergen Phl p 11                              89.4    1e-18   
gb|AAT08700.1|  pollen-specific protein                               89.4    1e-18   Hyacinthus orientalis [common hyacinth]
ref|XP_002533139.1|  Pollen-specific protein C13 precursor, putative  88.6    1e-18   Ricinus communis
gb|AEW90943.1|  group 11 grass pollen allergen F8-6                   89.0    2e-18   
ref|NP_001131377.1|  uncharacterized protein LOC100192702 precursor   88.6    2e-18   
emb|CAA78897.1|  pollen specific gene                                 88.6    2e-18   
sp|P82242.2|PLAL1_PLALA  RecName: Full=Major pollen allergen Pla ...  87.4    3e-18   
ref|XP_006838264.1|  hypothetical protein AMTR_s00103p00069180        87.4    3e-18   
gb|AFK42345.1|  unknown                                               88.2    3e-18   
emb|CDP16230.1|  unnamed protein product                              87.8    3e-18   
ref|XP_003581152.1|  PREDICTED: pollen-specific protein C13-like      87.8    4e-18   
ref|XP_006344595.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        87.4    4e-18   
gb|KFK32118.1|  hypothetical protein AALP_AA6G200700                  87.4    4e-18   
ref|XP_006645671.1|  PREDICTED: pollen allergen Phl p 11-like         87.0    5e-18   
ref|XP_004960638.1|  PREDICTED: pollen allergen Phl p 11-like         87.8    5e-18   
gb|AEW90940.1|  group 11 grass pollen allergen F7-1                   87.4    5e-18   
ref|XP_010527375.1|  PREDICTED: major pollen allergen Lol p 11-like   87.4    6e-18   
ref|XP_009409254.1|  PREDICTED: major pollen allergen Lol p 11-like   87.4    6e-18   
gb|EPS62385.1|  hypothetical protein M569_12405                       86.7    7e-18   
ref|XP_004237415.1|  PREDICTED: pollen-specific protein C13           87.0    7e-18   
ref|XP_010911793.1|  PREDICTED: pollen-specific protein C13-like      87.0    7e-18   
ref|XP_009760524.1|  PREDICTED: pollen-specific protein C13-like      86.7    1e-17   
ref|XP_003573867.1|  PREDICTED: pollen-specific protein C13           86.7    1e-17   
ref|XP_004971474.1|  PREDICTED: pollen allergen Phl p 11-like         86.3    1e-17   
ref|XP_009147847.1|  PREDICTED: pollen-specific protein-like At4g...  85.5    1e-17   
ref|XP_006397273.1|  hypothetical protein EUTSA_v10029031mg           85.9    2e-17   
ref|XP_011097595.1|  PREDICTED: major pollen allergen Lol p 11-like   85.5    2e-17   
ref|XP_010424432.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        87.0    3e-17   
ref|XP_002440811.1|  hypothetical protein SORBIDRAFT_09g007260        85.5    3e-17   
emb|CAC41634.1|  plantain pollen major allergen, Pla l 1.0102         84.3    3e-17   
dbj|BAJ86956.1|  predicted protein                                    85.5    3e-17   
gb|AAM08621.1|AC107314_12  Putative Pollen specific protein C13 p...  85.5    3e-17   
ref|XP_009421183.1|  PREDICTED: pollen-specific protein C13-like      85.1    3e-17   
gb|EYU24008.1|  hypothetical protein MIMGU_mgv1a015363mg              85.1    3e-17   
ref|NP_001064462.2|  Os10g0371000                                     85.5    4e-17   
sp|Q8H6L7.1|PHLB_PHLPR  RecName: Full=Pollen allergen Phl p 11; A...  84.3    4e-17   
ref|XP_003565925.1|  PREDICTED: pollen allergen Phl p 11              85.1    4e-17   
ref|XP_009386950.1|  PREDICTED: pollen-specific protein C13-like      84.7    5e-17   
ref|XP_006468202.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  83.6    6e-17   
ref|XP_010025486.1|  PREDICTED: protein DOWNSTREAM OF FLC             84.3    7e-17   
ref|XP_006661725.1|  PREDICTED: pollen-specific protein C13-like      84.3    7e-17   
ref|XP_009383585.1|  PREDICTED: pollen-specific protein C13-like      84.3    8e-17   
ref|XP_008343344.1|  PREDICTED: LOW QUALITY PROTEIN: olee1-like p...  83.2    8e-17   
gb|EMS52933.1|  hypothetical protein TRIUR3_31283                     84.0    9e-17   
sp|Q7M1X5.1|LOLB_LOLPR  RecName: Full=Major pollen allergen Lol p...  83.2    9e-17   
ref|XP_004150698.1|  PREDICTED: pollen-specific protein C13-like      83.6    1e-16   
ref|XP_009622218.1|  PREDICTED: pollen-specific protein C13-like      83.6    1e-16   
emb|CAC41635.1|  plantain pollen major allergen, Pla l 1.0103         82.8    1e-16   
ref|XP_011030966.1|  PREDICTED: protein DOWNSTREAM OF FLC             83.2    1e-16   
ref|XP_008445353.1|  PREDICTED: protein DOWNSTREAM OF FLC             83.2    1e-16   
ref|XP_010521200.1|  PREDICTED: major pollen allergen Lol p 11        83.2    2e-16   
gb|AAO41983.1|  unknown protein                                       82.0    2e-16   
ref|NP_567338.1|  protein SAH7                                        83.2    2e-16   
gb|AAF16869.1|AF109693_1  allergen-like protein BRSn20                83.2    2e-16   
ref|XP_006355373.1|  PREDICTED: pollen-specific protein C13-like      83.2    2e-16   
ref|XP_006664913.1|  PREDICTED: pollen allergen Phl p 11-like         83.2    2e-16   
gb|AEW90945.1|  group 11 grass pollen allergen R1-2                   82.8    2e-16   
ref|XP_002454899.1|  hypothetical protein SORBIDRAFT_03g001020        82.4    4e-16   
ref|XP_004983223.1|  PREDICTED: pollen-specific protein C13-like      82.4    4e-16   
gb|EPS69662.1|  hypothetical protein M569_05103                       82.0    4e-16   
ref|XP_010916905.1|  PREDICTED: pollen-specific protein C13-like      82.0    5e-16   
ref|XP_004289324.1|  PREDICTED: pollen-specific protein C13-like      81.6    7e-16   
ref|XP_002307104.1|  hypothetical protein POPTR_0005s08000g           81.3    7e-16   
ref|XP_006442530.1|  hypothetical protein CICLE_v10024378mg           81.3    1e-15   
ref|XP_004500607.1|  PREDICTED: pollen-specific protein C13-like      80.9    1e-15   
ref|NP_001146979.1|  LOC100280588 precursor                           80.9    1e-15   
ref|XP_007048005.1|  Pollen-specific protein C13, putative            80.5    2e-15   
ref|XP_010680579.1|  PREDICTED: major pollen allergen Lol p 11-like   80.5    2e-15   
ref|XP_008803750.1|  PREDICTED: pollen-specific protein C13           80.1    2e-15   
ref|XP_002872410.1|  hypothetical protein ARALYDRAFT_489767           79.7    3e-15   
gb|KHG30321.1|  Anther-specific LAT52                                 79.7    3e-15   
gb|KHN36879.1|  Olee1-like protein                                    79.7    3e-15   
ref|XP_002489221.1|  hypothetical protein SORBIDRAFT_0012s014630      79.3    5e-15   
ref|NP_001148443.1|  pollen allergen Phl p 11 precursor               79.3    5e-15   
ref|XP_004146873.1|  PREDICTED: pollen allergen Che a 1-like          79.0    5e-15   
gb|KEH38613.1|  pollen Ole e I family allergen                        79.0    5e-15   
gb|ACG32277.1|  pollen-specific protein C13 precursor                 79.3    5e-15   
ref|XP_006661014.1|  PREDICTED: pollen-specific protein C13-like      79.0    6e-15   
ref|XP_008453801.1|  PREDICTED: major pollen allergen Lol p 11-like   79.0    7e-15   
ref|XP_010547621.1|  PREDICTED: protein DOWNSTREAM OF FLC             78.6    7e-15   
gb|EAZ45758.1|  hypothetical protein OsJ_30442                        78.6    7e-15   
ref|XP_007136225.1|  hypothetical protein PHAVU_009G028900g           78.6    8e-15   
ref|XP_007141147.1|  hypothetical protein PHAVU_008G171500g           78.6    8e-15   
ref|XP_003638771.1|  Pollen allergen Phl p                            78.2    9e-15   
gb|ACJ86286.1|  unknown                                               78.2    1e-14   
gb|AAM78186.1|  putative SAH7 protein                                 77.0    1e-14   
dbj|BAD46623.1|  putative Pollen specific protein C13 precursor       78.2    1e-14   
gb|EEC85106.1|  hypothetical protein OsI_32490                        78.2    1e-14   
ref|NP_001064001.1|  Os09g0572800                                     78.2    1e-14   
ref|NP_001238723.1|  uncharacterized protein LOC100499710 precursor   77.8    1e-14   
emb|CDP01424.1|  unnamed protein product                              77.8    1e-14   
ref|NP_001235303.1|  uncharacterized protein LOC100306199 precursor   77.8    1e-14   
ref|XP_007149397.1|  hypothetical protein PHAVU_005G066800g           77.8    2e-14   
gb|KHN19737.1|  Pollen-specific protein C13                           77.8    2e-14   
ref|XP_010090546.1|  hypothetical protein L484_016596                 77.8    2e-14   
ref|XP_007149396.1|  hypothetical protein PHAVU_005G066700g           77.0    2e-14   
ref|XP_006601773.1|  PREDICTED: uncharacterized protein LOC100527...  76.6    3e-14   
ref|XP_007153183.1|  hypothetical protein PHAVU_003G013900g           76.6    4e-14   
gb|KDO56621.1|  hypothetical protein CISIN_1g041753mg                 75.1    6e-14   
gb|EMS61378.1|  Pollen-specific protein C13                           75.5    7e-14   
ref|XP_004502439.1|  PREDICTED: pollen-specific protein C13-like      75.5    9e-14   
gb|AFK37732.1|  unknown                                               75.1    1e-13   
gb|AFK47744.1|  unknown                                               75.1    1e-13   
ref|XP_003543768.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        75.1    1e-13   
ref|XP_002459879.1|  hypothetical protein SORBIDRAFT_02g012930        74.7    3e-13   
gb|AAM78189.1|  putative SAH7 protein                                 72.8    4e-13   
ref|XP_004299638.1|  PREDICTED: pollen allergen Phl p 11-like         72.8    4e-13   
ref|XP_010676978.1|  PREDICTED: major pollen allergen Lol p 11-like   73.6    5e-13   
ref|XP_008343324.1|  PREDICTED: olee1-like protein                    72.0    7e-13   
ref|XP_007153182.1|  hypothetical protein PHAVU_003G013800g           73.2    7e-13   
gb|AAM78185.1|  putative SAH7 protein                                 72.0    9e-13   
gb|AAM78188.1|  putative SAH7 protein                                 71.6    1e-12   
gb|AAM78187.1|  putative SAH7 protein                                 71.6    1e-12   
ref|NP_001237189.1|  uncharacterized protein LOC100305566 precursor   72.0    1e-12   
gb|AFO38383.1|  putative pollen-specific protein C13                  72.4    2e-12   
ref|XP_009789881.1|  PREDICTED: olee1-like protein                    72.0    2e-12   
gb|ADM76665.1|  extensin-like protein                                 71.6    2e-12   
emb|CDX88408.1|  BnaC06g38520D                                        71.2    3e-12   
emb|CDX87484.1|  BnaA07g33890D                                        71.2    4e-12   
gb|KEH38612.1|  pollen Ole e I family allergen                        71.2    4e-12   
gb|ABK22573.1|  unknown                                               70.9    4e-12   
gb|ABK21930.1|  unknown                                               70.9    4e-12   
ref|XP_009106450.1|  PREDICTED: protein DOWNSTREAM OF FLC             70.9    4e-12   
gb|ADM76653.1|  extensin-like protein                                 70.9    4e-12   
gb|KHG18492.1|  Anther-specific LAT52                                 70.9    5e-12   
ref|XP_010906302.1|  PREDICTED: pollen-specific protein C13-like      69.7    5e-12   
gb|AFK44177.1|  unknown                                               70.5    5e-12   
ref|XP_006302909.1|  hypothetical protein CARUB_v10021044mg           70.1    8e-12   
ref|XP_010105888.1|  hypothetical protein L484_021545                 69.7    1e-11   
ref|XP_004959259.1|  PREDICTED: pollen-specific protein C13-like      68.9    2e-11   
ref|NP_177927.1|  pollen Ole e 1 allergen and extensin family pro...  68.9    2e-11   
ref|XP_006390031.1|  hypothetical protein EUTSA_v10019236mg           68.9    2e-11   
gb|ADM76637.1|  extensin-like protein                                 68.6    2e-11   
ref|XP_003601984.1|  Pollen-specific protein C13                      67.8    4e-11   
gb|ACQ44229.1|  putative pollen Ole e 1 allergen and extensin fam...  67.4    6e-11   
gb|KFK42186.1|  hypothetical protein AALP_AA2G222600                  67.0    9e-11   
ref|XP_010472003.1|  PREDICTED: major pollen allergen Lol p 11-like   66.6    1e-10   
ref|XP_010416770.1|  PREDICTED: major pollen allergen Lol p 11-like   66.6    1e-10   
gb|KHN44330.1|  Pollen-specific protein C13                           65.9    1e-10   
ref|XP_006399503.1|  hypothetical protein EUTSA_v10014875mg           66.2    2e-10   
gb|ACJ86288.1|  unknown                                               66.2    2e-10   
ref|XP_002889170.1|  pollen ole e 1 allergen and extensin family ...  66.2    2e-10   
gb|EAZ04544.1|  hypothetical protein OsI_26693                        65.9    2e-10   
ref|XP_009794836.1|  PREDICTED: pollen-specific protein C13-like      63.9    4e-10   
ref|XP_008381078.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        64.7    5e-10   
ref|XP_002887714.1|  pollen ole e 1 allergen and extensin family ...  64.3    6e-10   
ref|XP_010428908.1|  PREDICTED: major pollen allergen Lol p 11-like   64.3    8e-10   
gb|EAZ40496.1|  hypothetical protein OsJ_24951                        63.2    1e-09   
gb|AAN60344.1|  unknown                                               63.2    2e-09   
gb|ACK44512.1|  AT5G10130-like protein                                63.5    2e-09   
ref|NP_001175282.1|  Os07g0590500                                     63.2    2e-09   
gb|AAF17689.1|AC009243_16  F28K19.26                                  65.5    3e-09   
emb|CDY40079.1|  BnaC02g00510D                                        62.4    3e-09   
ref|NP_196575.1|  pollen_Ole_e_I-domain containing protein            61.6    6e-09   
gb|EMT21854.1|  hypothetical protein F775_27590                       61.2    7e-09   
ref|XP_008391140.1|  PREDICTED: olee1-like protein                    60.5    7e-09   
ref|XP_002873440.1|  pollen ole e 1 allergen and extensin family ...  61.2    7e-09   
emb|CDX85777.1|  BnaA02g00360D                                        60.5    2e-08   
ref|XP_009125327.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        60.5    2e-08   
ref|XP_003596420.1|  Pollen allergen Che a                            60.1    2e-08   
ref|XP_010453035.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        59.7    3e-08   
ref|XP_010422886.1|  PREDICTED: protein DOWNSTREAM OF FLC             59.7    3e-08   
ref|XP_006288804.1|  hypothetical protein CARUB_v10002136mg           59.3    3e-08   
gb|EMS67079.1|  hypothetical protein TRIUR3_25214                     58.5    4e-08   
ref|XP_010491667.1|  PREDICTED: protein DOWNSTREAM OF FLC             59.3    4e-08   
gb|AFW82075.1|  hypothetical protein ZEAMMB73_949741                  57.8    6e-08   
ref|XP_003596434.1|  Major pollen allergen Lol p                      58.5    7e-08   
ref|XP_008357485.1|  PREDICTED: uncharacterized protein LOC103421237  59.7    9e-08   
gb|AAZ67595.1|  80A08_10                                              58.2    9e-08   
ref|XP_009122085.1|  PREDICTED: protein DOWNSTREAM OF FLC-like        58.2    1e-07   
gb|KDO44647.1|  hypothetical protein CISIN_1g045131mg                 57.0    1e-07   
ref|XP_008240860.1|  PREDICTED: olee1-like protein                    58.2    2e-07   
ref|XP_003596443.1|  Major pollen allergen Lol p                      58.5    2e-07   
ref|XP_003596438.1|  Major pollen allergen Lol p                      57.4    2e-07   
emb|CDY14639.1|  BnaC02g24740D                                        56.2    3e-07   
ref|XP_009413179.1|  PREDICTED: pollen-specific protein C13-like      54.7    9e-07   
emb|CDY21640.1|  BnaC09g46520D                                        55.1    1e-06   
gb|KEH15235.1|  pollen protein Ole E I-like protein                   54.7    2e-06   
ref|XP_008238496.1|  PREDICTED: olee1-like protein                    53.9    3e-06   
ref|XP_003596436.1|  Major pollen allergen Lol p                      52.8    7e-06   
ref|XP_008225290.1|  PREDICTED: olee1-like protein                    52.4    1e-05   
ref|XP_007210061.1|  hypothetical protein PRUPE_ppa018487mg           51.6    3e-05   
ref|XP_007208803.1|  hypothetical protein PRUPE_ppa024703mg           51.6    3e-05   
ref|XP_007208811.1|  hypothetical protein PRUPE_ppa024778mg           51.2    4e-05   
ref|XP_010064896.1|  PREDICTED: pollen-specific protein-like At4g...  48.9    8e-05   
emb|CDY21637.1|  BnaC09g46550D                                        50.4    8e-05   
ref|NP_001237949.1|  uncharacterized protein LOC100527053             46.6    6e-04   
gb|ABN50034.1|  putative Ole e 1-like protein                         46.2    6e-04   



>ref|XP_009617824.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=171

 Score =   158 bits (399),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 95/135 (70%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA F  R+++ MPGA+VRL+C N TD   T +V+G+TD NGVY +  E
Sbjct  31   FHVEGKVYCDFCRALFENRLSKPMPGAEVRLQCRNSTDDSVTLTVEGQTDKNGVYSLLVE  90

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHEDE C +  +KSSKEDCSEI  +G AKE  RIT+T+ NGM +  R+ NP+ ++K + 
Sbjct  91   RDHEDEICEMILMKSSKEDCSEIPNEGHAKESARITITSNNGMAETIRHANPLFFVKKEA  150

Query  45   SAVCAEVFKELHYIP  1
            +  CAEVFKEL  +P
Sbjct  151  APECAEVFKELELLP  165



>ref|XP_009773994.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=173

 Score =   154 bits (389),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 94/135 (70%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA F  R+++ M GA+VRL+C N TD   T +V+G+TD NGVY +  E
Sbjct  33   FHVEGKVYCDFCRALFENRLSKPMAGAEVRLQCRNNTDDSVTLTVEGQTDKNGVYSLLVE  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHEDE C +  +KSS EDCSEI  +G AKE  RIT+T+ NGM + TR+ NP+ ++K + 
Sbjct  93   RDHEDEICEMILMKSSMEDCSEIPNEGHAKESARITITSNNGMAETTRHANPLFFVKKQA  152

Query  45   SAVCAEVFKELHYIP  1
            +  CAEVFKEL  +P
Sbjct  153  APECAEVFKELELLP  167



>ref|XP_007025385.1| Olee1-like protein [Theobroma cacao]
 gb|EOY28007.1| Olee1-like protein [Theobroma cacao]
Length=170

 Score =   137 bits (346),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA+FVT++++ M GA+VRLEC +   G  TYSVDGETD +G YHI  E
Sbjct  32   FFVEGKVYCDNCRAQFVTKISKYMAGAQVRLECRDREGGDITYSVDGETDESGTYHIKVE  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  V+SS  +CSEI K+ + ++  RI+LT  +G+   +R  NP+ ++  KP
Sbjct  92   GDHEEEICEVSLVQSSDPECSEIDKENFLRKSARISLTKYSGITSDSRLANPLGFMVKKP  151

Query  45   SAVCAEVFKEL  13
               C EV +EL
Sbjct  152  LPECTEVLREL  162



>ref|XP_011085997.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=170

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYC+VCR  F+ +++E MPGAKV+LEC     G  TY+ +GET+  G Y +  E
Sbjct  32   FFVVGEVYCEVCRLNFINKLSEPMPGAKVKLECKGEEAGNITYTQEGETNEGGQYRLKVE  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWA-KEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            GDHE+E CGI  VKSS+ DC+EI  +GWA K  + ITLT  NG    +R  NP+ + K K
Sbjct  92   GDHEEEECGITLVKSSRADCNEIPDEGWASKPSSLITLTKNNGFHGSSRYANPLGFTKKK  151

Query  48   PSAVCAEVFKELHYIP  1
             +  CAE+ KEL   P
Sbjct  152  ANPECAELIKELEINP  167



>ref|XP_010103032.1| hypothetical protein L484_005787 [Morus notabilis]
 gb|EXB94630.1| hypothetical protein L484_005787 [Morus notabilis]
Length=166

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/133 (50%), Positives = 82/133 (62%), Gaps = 0/133 (0%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCD CRA+FVT+V+  + GAKVRLEC     G  TYS DG TD +G Y I  +GD
Sbjct  30   VEGRVYCDTCRAQFVTKVSNYIKGAKVRLECRESEGGSVTYSNDGVTDESGTYRIAVDGD  89

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
            HE+E C +K VKSS  DCSEI  D + K   R++LT+ NG+    R  NP+ +LK     
Sbjct  90   HEEEVCEVKLVKSSVPDCSEISNDPYNKLNARVSLTSNNGITSPVRQANPLGFLKKNSLP  149

Query  39   VCAEVFKELHYIP  1
             C EV +EL   P
Sbjct  150  ECPEVLRELGITP  162



>gb|EYU43331.1| hypothetical protein MIMGU_mgv1a014984mg [Erythranthe guttata]
Length=171

 Score =   131 bits (330),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYC+VCR  F+ ++++ M GA VRL+C   T+G  TYS++G TD  G YH+T E
Sbjct  33   FSVEGDVYCEVCRTNFINKLSQPMAGATVRLQCKGETEGNITYSLEGITDDKGQYHLTVE  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWA-KEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            GDH ++ C I  V+SS+ DC+ +  +GWA K  +RITLT  +G    TR  NP+ + K K
Sbjct  93   GDHGEDECEITLVRSSRPDCNVVPDEGWATKPTSRITLTKNSGFHDNTRKANPLGFTKKK  152

Query  48   PSAVCAEVFKELHYIP  1
                CA++FKEL   P
Sbjct  153  ADPQCAQLFKELEINP  168



>ref|XP_007212169.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
 gb|EMJ13368.1| hypothetical protein PRUPE_ppa012463mg [Prunus persica]
Length=168

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 84/135 (62%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
              V G VYCD CR +F+TR++E + GA V+LEC +   G  T S + +TD  G Y I  E
Sbjct  29   LSVDGLVYCDNCRIQFMTRISEPLQGATVKLECRDREGGTVTLSSETDTDEQGRYQIPVE  88

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  VKS ++DCSE+  D  AK   RI+LT  NG+    R  NP+ +LK++P
Sbjct  89   GDHEEEVCEVLLVKSPRDDCSEVSTDSHAKLSARISLTNNNGIAGPHRIPNPLGFLKTEP  148

Query  45   SAVCAEVFKELHYIP  1
             A CAEV KEL   P
Sbjct  149  DAKCAEVLKELGLTP  163



>sp|O49813.1|OLEE1_BETPN RecName: Full=Olee1-like protein; Flags: Precursor [Betula pendula]
 emb|CAA74365.1| putative Ole e 1 protein [Betula pendula]
Length=166

 Score =   130 bits (326),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 82/135 (61%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +FVT+++  M GAKV LEC N   G   YS D ETD +G Y I  +
Sbjct  27   FFVEGKVYCDNCRTQFVTKLSTYMKGAKVSLECRNREGGTLIYSSDSETDKSGTYRIPVD  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C I   KSS  DCSE+ KD + K+  RI+LT  NG+    R  NP+ ++K KP
Sbjct  87   GDHEEEICEIALKKSSDPDCSEVSKDPFLKKSARISLTKNNGISTPVRLANPLGFMKKKP  146

Query  45   SAVCAEVFKELHYIP  1
               CA+  +EL   P
Sbjct  147  LPECAKALRELGMNP  161



>ref|XP_010057097.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
 gb|KCW74109.1| hypothetical protein EUGRSUZ_E02748 [Eucalyptus grandis]
Length=168

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 85/131 (65%), Gaps = 0/131 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F+T+V++ MP AKVRLEC +   G  TYS++G TD  G+Y +  +
Sbjct  30   FFVEGKVYCDTCRTQFITKVSKDMPDAKVRLECKDREGGSVTYSIEGVTDNTGMYRLPVD  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            G+HE+E C I  VKSS+  C E+  D + ++  RI+LT  NGM    R  NP+ Y+K++ 
Sbjct  90   GEHEEEICEIVLVKSSQPGCEEVSNDPFLRKTARISLTKNNGMATPVRQANPLGYMKNES  149

Query  45   SAVCAEVFKEL  13
               CA+V +EL
Sbjct  150  LPECADVLREL  160



>ref|XP_011080816.1| PREDICTED: major pollen allergen Ole e 1-like [Sesamum indicum]
Length=166

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 84/136 (62%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYC+VCR  F+ +++E MPGAKV+LEC     G  TY+ +G T+  G Y +  E
Sbjct  28   FFVVGEVYCEVCRINFINKLSEPMPGAKVKLECRGEETGNITYTQEGVTNEAGQYRLKVE  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWA-KEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            GDHE+E CGI  VKS + DC EI  +GWA K  + ITLT  NG    +R  NP+ + K K
Sbjct  88   GDHEEEECGITLVKSGRADCDEIPNEGWASKPSSLITLTKNNGFHGSSRYANPLGFTKKK  147

Query  48   PSAVCAEVFKELHYIP  1
             +  CAE+ KEL   P
Sbjct  148  ANHECAELIKELEIDP  163



>ref|XP_002522577.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
 gb|EEF39877.1| Pollen allergen Che a 1 precursor, putative [Ricinus communis]
Length=171

 Score =   128 bits (321),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKS-TYSVDGETDANGVYHITA  229
            F V G VYCD CR +F+T+    + GA+VRLEC +   G + T+S + ETDA G YHI  
Sbjct  31   FTVEGKVYCDTCRVQFITKATSYIKGARVRLECKDREGGGAITFSAEAETDATGTYHIPV  90

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
             G+HE+E C I P+KS   DC+EI +D + K+  +ITLT  NG+   TR+ NPI +LK +
Sbjct  91   NGEHEEELCEIIPLKSPDPDCNEINQDPFVKKAAQITLTNHNGIASPTRSANPIGFLKQQ  150

Query  48   PSAVCAEVFKELHYIP  1
                C+ + +E+   P
Sbjct  151  AVPECSGILREMGITP  166



>gb|ADK22842.1| Sal k 5, partial [Salsola kali]
Length=151

 Score =   125 bits (315),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 81/131 (62%), Gaps = 0/131 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + V G VYCD CR +F+TRV+  M GA V L+C N+T G  T+  +  TD  G+Y I  +
Sbjct  9    YHVKGMVYCDTCRIQFITRVSTMMEGATVSLQCRNLTAGTETFKAEAVTDKLGMYTIKVD  68

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHED+ C I  VKS  ++CSEI  D ++++  ++TLT+ NG     RN N + +LK  P
Sbjct  69   GDHEDDICQIVLVKSPGQECSEIPNDVYSEQAAKVTLTSNNGEASDVRNANALGFLKKAP  128

Query  45   SAVCAEVFKEL  13
               C EV KEL
Sbjct  129  LPECPEVLKEL  139



>ref|XP_008371469.1| PREDICTED: olee1-like protein [Malus domestica]
Length=172

 Score =   126 bits (317),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
              V G VYCD CR +FVTR++E + GAKVRLEC     GK T S + +TD  G Y I  E
Sbjct  28   LNVHGIVYCDNCRIQFVTRISETLKGAKVRLECRENEGGKITLSKEADTDDLGTYSIPVE  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  VKS KEDCSEI  +   K   RI+LT  NG+    R  NP+ ++K + 
Sbjct  88   GDHEEEVCEVILVKSPKEDCSEISNELHVKLSARISLTNHNGITGPHRMANPLGFMKKEV  147

Query  45   SAVCAEVFKELHYIP  1
               CAEV KEL   P
Sbjct  148  DPKCAEVLKELGLTP  162



>gb|EPS70684.1| hypothetical protein M569_04073 [Genlisea aurea]
Length=170

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 82/136 (60%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G V+C+VCR  F+ R++E M GA VRLEC     G  T+ ++G TDA G Y + A 
Sbjct  31   FFVQGQVFCEVCRTNFINRLSEPMEGATVRLECRGDNVGNITFGIEGVTDAGGNYKLKAT  90

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKE-FTRITLTTKNGMVKKTRNVNPILYLKSK  49
            GDHEDE C +  VKSS+ DC E   +GWA +  ++IT+T  NG     R+ NP+ + K +
Sbjct  91   GDHEDEDCQVTLVKSSRLDCQETPSEGWAMQPSSKITITKNNGFHDDIRHANPLGFTKKE  150

Query  48   PSAVCAEVFKELHYIP  1
                C E+FKEL   P
Sbjct  151  RDPACQELFKELQINP  166



>ref|XP_002273294.1| PREDICTED: olee1-like protein [Vitis vinifera]
 emb|CBI30683.3| unnamed protein product [Vitis vinifera]
Length=168

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 90/135 (67%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F+TRV+E +PGAKVRLEC +   G  TYS+DGETD  G Y +  E
Sbjct  30   FFVKGQVYCDTCRIQFITRVSEYVPGAKVRLECRDREGGSVTYSIDGETDETGSYRLPVE  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            G+HE+E C ++ +KSSK +CSEI +  +A+   RI+L + NGM    R  NP+ +LK + 
Sbjct  90   GEHEEEVCEVQLIKSSKPECSEISRGVFARRSARISLASNNGMASSDRLANPLGFLKQES  149

Query  45   SAVCAEVFKELHYIP  1
             + C EV KEL  +P
Sbjct  150  LSECPEVLKELGILP  164



>ref|XP_009348994.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=172

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
              V G VYCD CR +FVTR++E + GAKVRLEC     GK T S + +TD  G Y I  E
Sbjct  28   LNVHGIVYCDNCRIQFVTRISETLKGAKVRLECRENEGGKITLSKEADTDDLGTYSIPVE  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  VKS KEDCSEI  +   K   RI+LT  NG+    R  NP+ ++K + 
Sbjct  88   GDHEEEVCEVILVKSPKEDCSEISNELHVKLSARISLTNHNGITGPHRMANPLGFMKKEV  147

Query  45   SAVCAEVFKELHYIP  1
               CAEV KEL   P
Sbjct  148  DPKCAEVLKELGLTP  162



>ref|XP_009759546.1| PREDICTED: olee1-like protein [Nicotiana sylvestris]
Length=172

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 83/135 (61%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR+ F T +++ + GA VRL+C +    + T ++  +T++ G YH+  E
Sbjct  30   FIVEGIVYCDPCRSAFKTNLSQPLAGAGVRLQCRHPETEEVTITIASQTNSTGYYHLLVE  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C     KS KEDCSEI  +   KE +R+TLT  NGM    R  N + +L  K 
Sbjct  90   GDHENEICETYLTKSPKEDCSEIPDEVHTKESSRVTLTNNNGMAGNLREANALFFLAKKS  149

Query  45   SAVCAEVFKELHYIP  1
            S+ CA+ FK++ YIP
Sbjct  150  SSECAQEFKDMQYIP  164



>ref|XP_010686203.1| PREDICTED: pollen allergen Che a 1 [Beta vulgaris subsp. vulgaris]
Length=169

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G VYCD CR +F+TRV+  M GA VRLEC NIT G  T+  +  TD  G+Y I  +
Sbjct  30   FKVQGMVYCDTCRIQFITRVSTMMEGATVRLECRNITAGTETFKSEAITDKLGMYSINVD  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GD+ED+ C I   KSS  +C++I  D +AK+  +++LT+ NG     R+ N + +++  P
Sbjct  90   GDYEDDICEIVLAKSSNNECTDISHDVYAKQAAKVSLTSNNGESSDVRSANALGFMRKTP  149

Query  45   SAVCAEVFKEL  13
               C EV KEL
Sbjct  150  LPECPEVLKEL  160



>pir||S43242 allergen-like protein Syr v I isoform 1 - Syringa vulgaris
Length=145

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 84/135 (62%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA+F+T ++E +PGA +RL+C +  +GK T++  G T A G+Y +  E
Sbjct  11   FHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDRENGKITFTEIGYTRAEGLYSMLVE  70

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDH++E+C I  + S +EDC EI  +GWAK   +  L T NG    TR +NPI + K + 
Sbjct  71   GDHKNEFCEITLISSGREDCDEIPVEGWAKPSLKFKLNTVNGT---TRTINPIGFFKKEA  127

Query  45   SAVCAEVFKELHYIP  1
               C +V+ +L   P
Sbjct  128  LPKCTQVYNKLGMYP  142



>ref|XP_009608960.1| PREDICTED: olee1-like protein [Nicotiana tomentosiformis]
Length=172

 Score =   124 bits (312),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 82/135 (61%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR+ F T +++ + GA VRL+C +    + T ++  ET+  G YH+  E
Sbjct  30   FIVEGIVYCDPCRSAFKTNLSQPLAGAGVRLQCRHPETEEVTITIASETNTTGYYHLLVE  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C     KSSKEDCSEI  +   KE +R+TLT  NG+    R  N + +L    
Sbjct  90   GDHENEICETYLTKSSKEDCSEIPDEVHTKESSRVTLTNNNGIAGNLREANALFFLAKNA  149

Query  45   SAVCAEVFKELHYIP  1
            S+ CA+ FK++ YIP
Sbjct  150  SSECAQEFKDMQYIP  164



>ref|XP_009352776.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=180

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
              V G VYCD CR +F TR++E + GAKVRLEC     GK T + + +T+  G Y I  E
Sbjct  28   LNVHGIVYCDNCRTQFFTRISEPLTGAKVRLECRESEGGKVTLTKEADTEELGTYSIPVE  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  VKS KEDCSEI  +  AK   RI+LT  NG+    R  NP+ ++K + 
Sbjct  88   GDHEEEVCEVILVKSPKEDCSEISNELHAKLSARISLTNHNGITGPHRMANPLGFMKKEV  147

Query  45   SAVCAEVFKELHYIP  1
               CAEV KEL   P
Sbjct  148  DPRCAEVLKELGLTP  162



>ref|XP_008225283.1| PREDICTED: olee1-like protein [Prunus mume]
Length=168

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 84/135 (62%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
              V G VYCD CR +F+TR++E + GAKV+LEC +   G  T S + ETD  G Y I  E
Sbjct  29   LSVDGLVYCDSCRIQFMTRISEALQGAKVKLECRDREGGTITLSSETETDEQGRYQIPVE  88

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  VKS ++DCSEI  D  AK   RI+LT  NG+    R  NP+ +LK +P
Sbjct  89   GDHEEEVCEVVLVKSPRDDCSEISTDSHAKLSARISLTNNNGIAGPHRIPNPLGFLKKEP  148

Query  45   SAVCAEVFKELHYIP  1
             A CAEV KEL   P
Sbjct  149  DAQCAEVLKELGLTP  163



>ref|XP_010441660.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 89/136 (65%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC N T+G  T + +  TD +G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRNRTNGTVTLTKEAVTDKSGSYKMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  154

Query  48   PSAVCAEVFKELHYIP  1
            PSA CA  FKE+  +P
Sbjct  155  PSADCAAAFKEIGIVP  170



>ref|XP_010481521.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 89/136 (65%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC N T+G  T + +  TD +G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRNRTNGTVTLTKEAVTDKSGSYKMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  154

Query  48   PSAVCAEVFKELHYIP  1
            PSA CA  FKE+  +P
Sbjct  155  PSADCAAAFKEIGIVP  170



>ref|XP_008383629.1| PREDICTED: olee1-like protein [Malus domestica]
Length=184

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
              V G VYCD CR +F TR++E + GAKVRLEC     GK T + + +T+  G Y I  E
Sbjct  28   LNVHGIVYCDNCRTQFFTRISEPLTGAKVRLECRESEGGKVTLTKEXDTEELGTYSIPVE  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  VKS KEDCSEI  +  AK   RI+LT  NG+    R  NP+ ++K + 
Sbjct  88   GDHEEEVCEVILVKSPKEDCSEISNELHAKLSARISLTNHNGITGPHRMANPLGFMKKEV  147

Query  45   SAVCAEVFKELHYIP  1
               CAEV KEL   P
Sbjct  148  DPRCAEVLKELGLTP  162



>ref|XP_004233077.1| PREDICTED: major pollen allergen Lig v 1-like [Solanum lycopersicum]
Length=175

 Score =   123 bits (309),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 85/135 (63%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CR+ F T ++E +  A+V ++C +    + T +V   T++ G YH+  E
Sbjct  33   FILEGMVYCDPCRSIFKTNLSEPVVDARVGMQCRHPETERVTITVTASTNSTGYYHMLIE  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C    +KS KEDCSEI  +G  +E +R+TLT+KNG+  K R  NP+ +L  K 
Sbjct  93   GDHENEICETYLIKSPKEDCSEIPTEGHTRELSRVTLTSKNGIAGKNRESNPLFFLTKKV  152

Query  45   SAVCAEVFKELHYIP  1
            +  C + FKE+ Y+P
Sbjct  153  APECQQEFKEMEYLP  167



>ref|XP_011075462.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score =   122 bits (307),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 85/132 (64%), Gaps = 4/132 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYC+VCRA F  R +E MPGAKV+LEC N    K TY+++GET+  GVY +TAE
Sbjct  28   FVVDGKVYCEVCRANFTNRYSEPMPGAKVKLECKNEVTEKVTYTLEGETNDKGVYTLTAE  87

Query  225  GDH-EDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            GDH  ++ C +  VKSS  DC+EI  +  A E   +TLT  NG   + R+ NP+ + + +
Sbjct  88   GDHGSEDLCAVTLVKSSMADCAEIPDEKPAAE---VTLTLNNGFHDEFRHANPLAFTRKE  144

Query  48   PSAVCAEVFKEL  13
                CAE+FKEL
Sbjct  145  ALPECAELFKEL  156



>sp|Q8LGR0.1|CHE1_CHEAL RecName: Full=Pollen allergen Che a 1; AltName: Allergen=Che 
a 1; Flags: Precursor [Chenopodium album]
 gb|AAL07319.1| Che a 1 allergen precursor [Chenopodium album]
Length=168

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 0/131 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G VYCD CR +F+TR++  M GA V+LEC NIT G  T+  +  TD  G Y I   
Sbjct  30   FKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVN  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GD ED+ C I+ VKS   +CSE+  D +AK+  +++LT+ NG     R+ N + +++ +P
Sbjct  90   GDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP  149

Query  45   SAVCAEVFKEL  13
               C EV KEL
Sbjct  150  LKECPEVLKEL  160



>gb|ABP58635.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA+F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E
Sbjct  6    FHIQGQVYCDTCRARFITELSEFIPGASVRLQCRDGENGSITFTEVGSTRAEGLYSMLIE  65

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH+DE+C I  + SS++DC EI  +GW K   +  L T NG    TR VNP+ + K + 
Sbjct  66   RDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNG---TTRTVNPLGFFKKEA  122

Query  45   SAVCAEVFKELHYIP  1
               C +VF +L   P
Sbjct  123  LPKCPQVFNKLGMYP  137



>sp|O82015.2|LIGV1_LIGVU RecName: Full=Major pollen allergen Lig v 1; AltName: Allergen=Lig 
v 1 [Ligustrum vulgare]
 emb|CAA54818.1| major allergen [Ligustrum vulgare]
Length=145

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 85/135 (63%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA+F+T ++E +PGA VRL+C +  +GK T++  G T A G+Y++  E
Sbjct  11   FYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKVTFTEVGYTKAEGLYNMLIE  70

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + SS++DC EI  +GW K   +  L T NG    TR +NP+ +LK + 
Sbjct  71   RDHKNEFCEITLISSSRKDCDEIPTEGWVKPSLKFVLNTVNGT---TRTINPLGFLKKEV  127

Query  45   SAVCAEVFKELHYIP  1
               C +VF +L   P
Sbjct  128  LPKCPQVFNKLGMYP  142



>ref|XP_010529196.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=173

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +F+TR+++ + GAKVRLEC N  +G  T S +  TD +G + +   
Sbjct  34   FQIQGSVYCDTCRVQFITRLSKFLQGAKVRLECKNRVNGTLTVSKEAVTDESGSFLMEVT  93

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C I  V+S  +DCSE+ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  94   GDHEEEVCEIVLVESPDKDCSEVSKEAFLRNAAKISLTANDGIVSNETRIVNPLGFMVKT  153

Query  48   PSAVCAEVFKELHYIP  1
            PS  C   FKEL   P
Sbjct  154  PSTECPAAFKELGIKP  169



>ref|XP_010518802.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=172

 Score =   122 bits (305),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +F+TR+++ + GAKVRLEC N   G  T S +  TD  G + +   
Sbjct  33   FQIQGSVYCDTCRVQFITRLSKFLQGAKVRLECKNRVTGALTVSKEAVTDDTGSFLMQVT  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C I  V+S  ++CS++ KD + +   +++LT  +G+V  +TR VNP+ ++   
Sbjct  93   GDHEEEVCEIMLVESPDQECSDVSKDAYLRNAAKVSLTANDGIVSNETRIVNPLGFMVKT  152

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   F+EL   P
Sbjct  153  PSADCPAAFQELGITP  168



>ref|XP_002523378.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
 gb|EEF38957.1| Anther-specific protein LAT52 precursor, putative [Ricinus communis]
Length=166

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 88/133 (66%), Gaps = 3/133 (2%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCD CR +F T+++E +PG +V+LEC N  +   TY+V+G TDA+G+Y +  EG+
Sbjct  32   VEGKVYCDTCRVEFETKLSEVIPGTRVKLECKNRENNTLTYAVEGVTDASGIYRLPVEGE  91

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
            HE++ C +K +KS K DC+E  K   + +  R+ LT   G+V+ TR  NP+ ++K K S 
Sbjct  92   HEEDLCEVKLIKSGKPDCAEAFK---SVDHARVLLTHNVGVVQPTRYTNPLGFMKQKASP  148

Query  39   VCAEVFKELHYIP  1
             C +V +++ ++P
Sbjct  149  ECGKVLQDMGFVP  161



>ref|XP_004134662.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172168.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
Length=168

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITD-GKSTYSVDGETDANGVYHITA  229
            F + G VYCD CR +F TRV++ +PGAKV+L C    + G  T++ +G TD NGVY I  
Sbjct  29   FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEANAGNETFTGEGVTDKNGVYKIEV  88

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            +GDHE+E C +  ++S+ E+CS+I  DG+   F R+++T  NG++   R  NP+ +LK  
Sbjct  89   DGDHEEEICEVSLLESADEECSDIPTDGYG-HFARVSITGNNGIINPVRQANPLGFLKKD  147

Query  48   PSAVCAEVFKELHY  7
                C EV +EL +
Sbjct  148  ALPQCKEVLRELGF  161



>gb|KGN49303.1| hypothetical protein Csa_6G519560 [Cucumis sativus]
Length=168

 Score =   122 bits (305),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 85/134 (63%), Gaps = 2/134 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITD-GKSTYSVDGETDANGVYHITA  229
            F + G VYCD CR +F TRV++ +PGAKV+L C    + G  T++ +G TD NGVY I  
Sbjct  29   FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEANAGNETFTGEGVTDKNGVYKIEV  88

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            +GDHE+E C +  ++S+ E+CS+I  DG+   F R+++T  NG++   R  NP+ +LK  
Sbjct  89   DGDHEEEICEVSVLESADEECSDIPTDGYG-HFARVSITGNNGIINPVRQANPLGFLKKD  147

Query  48   PSAVCAEVFKELHY  7
                C EV +EL +
Sbjct  148  ALPQCKEVLRELGF  161



>gb|AAX93750.1| pollen allergen Cro s 1 [Crocus sativus]
Length=168

 Score =   121 bits (304),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 0/131 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G VYCD CR +F+TRV+  M GA V+LEC NIT G  T+  +  TD  G Y I   
Sbjct  30   FKVQGMVYCDTCRIQFMTRVSTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVH  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GD +D+ C I+ VKS   +CSE+  D +AK+  +++LT+ NG     R+ N + +++ +P
Sbjct  90   GDFQDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEP  149

Query  45   SAVCAEVFKEL  13
               C EV KEL
Sbjct  150  LKECPEVLKEL  160



>ref|XP_010494740.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=174

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 89/136 (65%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD +G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKSGSYKMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  154

Query  48   PSAVCAEVFKELHYIP  1
            PSA CA  FKE+  +P
Sbjct  155  PSADCAAAFKEIGIVP  170



>pir||S43244 allergen-like protein Syr v I isoform 3 - Syringa vulgaris
Length=145

 Score =   120 bits (302),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 83/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA+F+T ++E +PGA +RL+C +  +GK T++  G T A G+Y +  E
Sbjct  11   FHIQGQVYCDTCRARFITELSEFIPGASIRLQCKDGENGKITFTEIGYTRAEGLYSMLVE  70

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDH++E+C I  + S ++DC EI  +GW K   +  L T NG    TR +NPI + K + 
Sbjct  71   GDHKNEFCEITLISSGRKDCDEIPVEGWVKPSLKFKLNTVNGT---TRTINPIGFFKKEA  127

Query  45   SAVCAEVFKELHYIP  1
               C +V+ +L   P
Sbjct  128  LPKCTQVYNKLGMYP  142



>pir||S43243 allergen-like protein Syr v I isoform 2 - Syringa vulgaris
Length=145

 Score =   120 bits (301),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 83/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA+F+T ++E +PGA +RL+C +   GK T++  G T A G+Y +  E
Sbjct  11   FHIQGQVYCDTCRARFITELSEFIPGAGIRLQCKDGEHGKITFTEIGYTRAEGLYSMLVE  70

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDH++E+C I  + SS++DC EI  +GW K   +  L T NG    TR +NP+ + K + 
Sbjct  71   GDHKNEFCEITLLSSSRKDCEEIPIEGWVKPSLKFILNTVNGT---TRTINPLGFFKKEV  127

Query  45   SAVCAEVFKELHYIP  1
               C +VF +L   P
Sbjct  128  LPKCPQVFNKLGMYP  142



>ref|NP_567562.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 sp|Q6NMJ2.1|OLE96_ARATH RecName: Full=Pollen-specific protein-like At4g18596; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAS47674.1| At4g18596 [Arabidopsis thaliana]
 dbj|BAD94719.1| pollen-specific protein - like [Arabidopsis thaliana]
 gb|AEE84066.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=172

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD  G Y +   
Sbjct  33   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKTGSYRMEVT  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  93   GDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVQT  152

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKEL  +P
Sbjct  153  PSAECPAAFKELGIVP  168



>ref|XP_004485892.1| PREDICTED: olee1-like protein-like [Cicer arietinum]
Length=165

 Score =   120 bits (302),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 82/131 (63%), Gaps = 1/131 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F+T++ E M GA VR+EC    +G  T+S +  TDA+G Y +  +
Sbjct  27   FFVEGVVYCDTCRTQFITKLTEFMEGATVRMECKE-DNGTVTFSKEAVTDASGTYRVEVD  85

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHEDE C I   KS ++DCSE+  D   ++  RI++T  NG+V   R  NP+ +LK + 
Sbjct  86   GDHEDEVCEITLAKSPRKDCSEVDSDSHLEQAARISITNNNGIVSPLRTANPLGFLKKER  145

Query  45   SAVCAEVFKEL  13
               CA+V K+L
Sbjct  146  LPGCADVLKDL  156



>pir||B53806 major allergen OLE5c - common olive
Length=145

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA+F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E
Sbjct  11   FHIQGQVYCDTCRARFITELSEFIPGASVRLQCKDGENGSITFTEVGYTRAEGLYSMLIE  70

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH+DE+C I  + SS++DC EI  +GW K   +  L T NG    TR +NP+ + K + 
Sbjct  71   RDHKDEFCEITLISSSRKDCDEIPVEGWVKPSLKFMLNTVNG---TTRTINPLGFFKKEA  127

Query  45   SAVCAEVFKELHYIP  1
               C +VF +L   P
Sbjct  128  LPKCPQVFNKLGMYP  142



>emb|CDX77620.1| BnaC07g18740D [Brassica napus]
Length=174

 Score =   120 bits (302),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD +G Y I   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRTNGTLTLTKEAVTDKSGSYKIEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  154

Query  48   PSAVCAEVFKELHYIP  1
            P A C   FKEL  +P
Sbjct  155  PLADCPAAFKELGIVP  170



>ref|XP_006398273.1| hypothetical protein EUTSA_v10001051mg [Eutrema salsugineum]
 gb|ESQ39726.1| hypothetical protein EUTSA_v10001051mg [Eutrema salsugineum]
Length=174

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD +G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLTLTKEAVTDKSGSYKMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS + K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVQSPDSGCSNVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  154

Query  48   PSAVCAEVFKELHYIP  1
            P A CA  FKEL  +P
Sbjct  155  PLADCAAAFKELGIVP  170



>ref|XP_011079002.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=165

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 83/131 (63%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYC+VCRA F  R +E M GAKV+LEC N      TY+++GET+  GVY +TAE
Sbjct  31   FIVDGKVYCEVCRANFTNRYSEPMAGAKVKLECKNEVTESVTYTLEGETNEKGVYTLTAE  90

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDH ++ C +  +KSS  DC+E+  +  A E   +TLT  NG   + R+ NP+ + + + 
Sbjct  91   GDHGEDLCAVTLLKSSMADCAEVPDEKPAAE---VTLTLNNGFHDEFRHANPLTFTRKEA  147

Query  45   SAVCAEVFKEL  13
               CAE+FKEL
Sbjct  148  LPECAELFKEL  158



>ref|XP_011006522.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=161

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
              V G VYCD CR +F T+++E +P AKV+L C+N  +G  TY+V+G TD++G Y ++  
Sbjct  27   LNVEGKVYCDPCRVEFQTKISEGIPAAKVKLVCNNRDNGTETYTVEGATDSSGTYRLSVA  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHED+ C I+ V+SS+ DC+E  +   + +  +I LT   G+V KTR  N + Y+K + 
Sbjct  87   GDHEDDICEIRLVESSRPDCNEPFR---SIDSAKILLTKNAGVVDKTRYPNALGYMKKEA  143

Query  45   SAVCAEVFKELHYIP  1
               CA V KE+ ++P
Sbjct  144  QPECANVLKEMGFLP  158



>emb|CDX99452.1| BnaC01g11000D [Brassica napus]
Length=172

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 88/136 (65%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD +G Y +   
Sbjct  33   FQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRTNGTVTLTKEAVTDKSGSYKMEVT  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  ++S    CS++ K+ + +   +++LT  +G+V  +TR VNP+ ++   
Sbjct  93   GDHEEEVCELVLLQSPDSGCSDVSKEAYLRNAAKVSLTANDGIVSHETRIVNPLGFMVKT  152

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKEL  +P
Sbjct  153  PSADCPAAFKELGIVP  168



>gb|AFK46977.1| unknown [Lotus japonicus]
Length=168

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDG-KSTYSVDGETDANGVYHITA  229
            F + GTVYCD CR +F+TRV+E M GA V + C     G K T+S +  TDANG+Y +  
Sbjct  27   FFIEGTVYCDTCRTQFLTRVSEFMSGATVGVVCRERDAGAKVTFSKEAVTDANGMYSVAV  86

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            +GDHEDE C +K +KSS+ DCSE+  +   ++ +RI++T  NG+V   R  NP+ +LK++
Sbjct  87   DGDHEDEVCEVKLLKSSRADCSEVDTESHLEQASRISITNNNGIVSPVRTANPLGFLKTE  146

Query  48   PSAVCAEVFKEL  13
                C  +  +L
Sbjct  147  RLPECGHILLQL  158



>ref|XP_006370166.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ERP66735.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=161

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
             +V G VYCD CR +F T+++E +P AKV+L C+N  +G  TY+V+G TD +G Y +   
Sbjct  27   LDVEGKVYCDPCRVEFQTKISEGIPAAKVKLVCNNRDNGTETYTVEGATDNSGTYRLPVA  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHED+ C ++ V+SS+ DC+E  +   + +  RI LT   G+V KTR  N + Y+K + 
Sbjct  87   GDHEDDICEVRLVESSRPDCNEPFR---SIDSARILLTKNVGVVDKTRYPNALGYMKKEA  143

Query  45   SAVCAEVFKELHYIP  1
               CA+V KE+ ++P
Sbjct  144  QPECADVLKEMGFLP  158



>emb|CAA73037.1| Ole e 1.0103 protein [Olea europaea]
Length=146

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 84/135 (62%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E
Sbjct  12   FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVE  71

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC+EI  +GWAK   +  L+T NG    TR VNP+ + K + 
Sbjct  72   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILSTVNGT---TRTVNPLGFYKKEA  128

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  129  LPKCAQVYNKLGMYP  143



>emb|CAA73038.1| Ole e 1.0102 protein [Olea europaea]
Length=146

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 83/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E
Sbjct  12   FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDVTFTEIGYTRAEGLYSMLVE  71

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC+EI  +GWAK   +  L T NG    TR VNP+ + K + 
Sbjct  72   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGT---TRTVNPLRFYKKEA  128

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  129  LPKCAQVYNKLGMYP  143



>ref|XP_006281481.1| hypothetical protein CARUB_v10027565mg [Capsella rubella]
 gb|EOA14379.1| hypothetical protein CARUB_v10027565mg [Capsella rubella]
Length=174

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +F+TR+++ + GAKV+LEC + T+G  T + +  TD  G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFITRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKTGSYMMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVMT  154

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKEL  +P
Sbjct  155  PSADCPAAFKELGIVP  170



>ref|XP_006414083.1| hypothetical protein EUTSA_v10026398mg [Eutrema salsugineum]
 gb|ESQ55536.1| hypothetical protein EUTSA_v10026398mg [Eutrema salsugineum]
Length=172

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC +  +G  T + +  TD +G Y +   
Sbjct  33   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRANGTVTLTKEAVTDKSGSYRMEVT  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  93   GDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  152

Query  48   PSAVCAEVFKELHYIP  1
            P A CA  FKEL  +P
Sbjct  153  PLADCAAAFKELGIVP  168



>emb|CAA54819.1| major allergen [Ligustrum vulgare]
Length=145

 Score =   118 bits (296),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 83/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA+F+T ++E +PGA VRL+C +  +GK T++  G T A G+Y +  E
Sbjct  11   FYIQGQVYCDTCRARFITELSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIE  70

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + SS++DC EI  +GW K   +  L T NG    TR +NP+ + K + 
Sbjct  71   RDHKNEFCEITLLSSSRKDCDEIPIEGWVKPSLKFMLNTVNG---TTRTINPLGFFKKEA  127

Query  45   SAVCAEVFKELHYIP  1
               C +VF +L   P
Sbjct  128  LPKCPQVFNKLGMYP  142



>ref|XP_006284941.1| hypothetical protein CARUB_v10006240mg [Capsella rubella]
 gb|EOA17839.1| hypothetical protein CARUB_v10006240mg [Capsella rubella]
Length=172

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC +  +G  T + +  TD +G Y +   
Sbjct  33   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRVNGTVTLTEEAVTDKSGSYKMEVA  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  ++S   DCS++ K+ +     +I+LT  +G+V  +TR VNP+ ++   
Sbjct  93   GDHEEEVCELVLLESPDSDCSDVSKEAYLHNAAKISLTANDGIVSHETRIVNPLGFMVKT  152

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKEL  +P
Sbjct  153  PSAECPAAFKELGIVP  168



>ref|XP_009132011.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX78874.1| BnaA01g09410D [Brassica napus]
Length=172

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 88/136 (65%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD +G Y +   
Sbjct  33   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKSGSYKMEVT  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  ++S    CS++ K+ + +   +++LT  +G+V  +TR VNP+ ++   
Sbjct  93   GDHEEEVCELVLLQSPDSGCSDVSKEAYLRNAAKVSLTANDGIVSHETRIVNPLGFMVKT  152

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKEL  +P
Sbjct  153  PSADCPAAFKELGIVP  168



>sp|P19963.2|ALL1_OLEEU RecName: Full=Major pollen allergen Ole e 1; AltName: Full=Allergen 
Ole e I; AltName: Allergen=Ole e 1 [Olea europaea]
Length=145

 Score =   118 bits (295),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 83/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F+T ++E +PGA +RL+C +  +G  T++  G T A G+Y +  E
Sbjct  11   FHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE  70

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC+EI  +GWAK   +  L T NG    TR VNP+ + K + 
Sbjct  71   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFKLNTVNGT---TRTVNPLGFFKKEA  127

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  128  LPKCAQVYNKLGMYP  142



>ref|XP_010434511.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 88/136 (65%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC +  +G  T + +  TD +G Y +   
Sbjct  33   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRVNGTVTLTKEAVTDKSGSYKMEVT  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S   +CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  93   GDHEEEVCELVLVESPNSECSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  152

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKE+  +P
Sbjct  153  PSAECPAAFKEIGIVP  168



>ref|XP_010496255.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 88/136 (65%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC +  +G  T + +  TD +G Y +   
Sbjct  33   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRVNGTVTLTKEAVTDKSGSYKMEVT  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S   +CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  93   GDHEEEVCELVLVESPDSECSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  152

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKE+  +P
Sbjct  153  PSAECPAAFKEIGIVP  168



>emb|CDX87759.1| BnaC02g31900D [Brassica napus]
Length=174

 Score =   119 bits (297),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD +G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLTLTKEAVTDKSGSYKMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  154

Query  48   PSAVCAEVFKELHYIP  1
            P A C   FKEL  +P
Sbjct  155  PLADCPAAFKELGIVP  170



>ref|XP_002863445.1| hypothetical protein ARALYDRAFT_494394 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39704.1| hypothetical protein ARALYDRAFT_494394 [Arabidopsis lyrata subsp. 
lyrata]
Length=174

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD  G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKTGSYKMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVQT  154

Query  48   PSAVCAEVFKELHYIP  1
            P A C   FKEL  +P
Sbjct  155  PLADCPAAFKELGIVP  170



>gb|ABP58633.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   117 bits (294),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F+T ++E +PGA VRL+C    +G  T++  G T A G+Y +  E
Sbjct  6    FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCREKKNGDITFTEVGYTRAEGLYSMLVE  65

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC+EI  +GWAK   +  L T NG    TR +NP+ + K + 
Sbjct  66   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGT---TRTINPLGFYKKEA  122

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  123  LPKCAQVYNKLDMYP  137



>ref|XP_009128814.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY06029.1| BnaA09g37510D [Brassica napus]
Length=174

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD +G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLTLTKEAVTDKSGSYKMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  154

Query  48   PSAVCAEVFKELHYIP  1
            P A C   FKEL  +P
Sbjct  155  PLADCPAAFKELGIVP  170



>emb|CAA73036.1| Ole e 1 protein [Olea europaea]
Length=146

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CR++F+T ++E +PGA VRL+C    +G  T++  G T A G+Y +  E
Sbjct  12   FHIQGQVYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLYSMLVE  71

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC EI  +GWAK   +  L T NG    TR VNP+ + K + 
Sbjct  72   RDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNG---TTRTVNPLGFFKKEA  128

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  129  LPKCAQVYNKLGMYP  143



>gb|ABP58636.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F+T ++E +PGA VRL+C    +G  T++  G T A G+Y +  E
Sbjct  6    FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCREKKNGDITFTEVGYTRAEGLYSMLVE  65

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC+EI  +GWAK   +  L T NG    TR +NP+ + K + 
Sbjct  66   RDHKNEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGT---TRTINPLGFYKKEA  122

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  123  LPKCAQVYNKLGMYP  137



>gb|ABP58632.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G +YCD CR++F+T ++E +PGA VRL+C    +G  T++  G T A G+Y +  E
Sbjct  6    FHIQGQIYCDTCRSRFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLYSMLVE  65

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC EI  +GWAK   +  L T NG    TR VNP+ + K + 
Sbjct  66   RDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEA  122

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  123  LPKCAQVYNKLGMYP  137



>ref|XP_002870034.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH46293.1| pollen ole e 1 allergen and extensin family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=173

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD  G Y +   
Sbjct  34   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKTGSYRMEVT  93

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  94   GDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  153

Query  48   PSAVCAEVFKELHYIP  1
            PS  C   FKEL  +P
Sbjct  154  PSPECPAAFKELGIVP  169



>ref|XP_009101556.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=174

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD +G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRTNGTLTLTKEAVTDKSGSYKMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVQSPDIGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  154

Query  48   PSAVCAEVFKELHYIP  1
            P A C   FKEL  +P
Sbjct  155  PLADCPAAFKELGIVP  170



>gb|KFK28529.1| hypothetical protein AALP_AA7G008600 [Arabis alpina]
Length=173

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD  G Y +   
Sbjct  34   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEVT  93

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  94   GDHEEEVCELVLVQSPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVQT  153

Query  48   PSAVCAEVFKELHYIP  1
            P A C   FKEL  +P
Sbjct  154  PLADCPAAFKELGIVP  169



>ref|XP_010439832.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=172

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 88/136 (65%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +F+TR+++ + GAKV+LEC +  +G  T + +  TD +G Y +   
Sbjct  33   FQIQGSVYCDTCRVQFITRLSKFLEGAKVKLECRSRVNGTVTLTKEAVTDKSGSYKMEVT  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S   +CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  93   GDHEEEVCELVLVESPDSECSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  152

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKE+  +P
Sbjct  153  PSAECPAAFKEIGIVP  168



>ref|XP_011075627.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=163

 Score =   117 bits (294),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 84/133 (63%), Gaps = 4/133 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYC+VCRA F  R ++ M GAKV+LEC N    K TY+++GET+  GVY +TAE
Sbjct  28   FVVDGKVYCEVCRANFTNRYSKPMAGAKVKLECKNEVTEKVTYTLEGETNDKGVYTLTAE  87

Query  225  GDH-EDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            GDH  ++ C +  VKSS  DC+EI  +  A E   +TLT  NG   + R+ NP+ + + +
Sbjct  88   GDHGSEDLCAVTLVKSSMADCAEIPDEKPAAE---VTLTLNNGFHDEFRHANPLAFTRKE  144

Query  48   PSAVCAEVFKELH  10
                CAE+FKEL 
Sbjct  145  ALPECAELFKELE  157



>gb|AEK85660.1| major pollen allergen Ole e1 [Olea europaea]
Length=140

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + + G VYCD CRA F+T ++E +PGA +RL+C +  DG  T++  G T A G+Y +  E
Sbjct  6    YHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKEDGDVTFTEVGYTRAEGLYSMLVE  65

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC+EI  +GW K   +  L T NG    TR VNP+ + K + 
Sbjct  66   RDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTLNGT---TRTVNPLGFFKKEA  122

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  123  LPKCAQVYNKLGMYP  137



>pir||C53806 major allergen OLE1c - common olive (fragment)
Length=145

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F+T  +E +PGA VRL+C +  +GK T++  G T A G+Y +  E
Sbjct  11   FYVQGQVYCDTCRTRFITEFSEFIPGAGVRLQCKDGENGKITFTEVGYTRAEGLYSMLIE  70

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + SS++DC EI  +GW K   +  L T NG    TR +NP+ + K + 
Sbjct  71   RDHKNEFCEITLLSSSRKDCDEIPTEGWVKPSVKFILNTVNGT---TRTINPLGFFKKEA  127

Query  45   SAVCAEVFKELHYIP  1
               C +VF +L   P
Sbjct  128  LPKCPQVFNKLGMYP  142



>gb|AFK47865.1| unknown [Lotus japonicus]
Length=168

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 82/131 (63%), Gaps = 0/131 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F+T+++E + GA VR+EC    +G  T++ +  TDA G Y +  +
Sbjct  28   FFVEGVVYCDTCRTQFITKLSEFLEGATVRVECKEEGNGSVTFTKEVVTDAKGSYKVEVD  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  VKS + DCSEI  D   ++  +I++T  NG+V   R  NP+ +LK + 
Sbjct  88   GDHEEELCQVVLVKSPRSDCSEIDSDSHLEQAAKISITKNNGIVSPVRAANPLGFLKKER  147

Query  45   SAVCAEVFKEL  13
               CA+V KEL
Sbjct  148  LPGCADVLKEL  158



>gb|AEK85661.1| major pollen allergen Ole e1 [Olea europaea]
Length=140

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F+T ++E +PGA +RL+C +  +G  T++  G T A G+Y +  E
Sbjct  6    FHIQGLVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE  65

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC+EI  +GW K   +  L T NG    TR VNP+ + K + 
Sbjct  66   RDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTLNG---TTRTVNPLGFFKKEA  122

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  123  LPKCAQVYNKLGMYP  137



>ref|XP_003546028.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN18912.1| Olee1-like protein [Glycine soja]
Length=169

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKS-TYSVDGETDANGVYHITA  229
            F V GTVYCD CR +F+T+++E + GA VR+ C  + + K+ T+S +  TDA+G Y +  
Sbjct  28   FMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQVDNAKNVTFSKEAVTDASGSYKVEV  87

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            EGDHE++ C +  +KS + DCSEI ++   ++  RI++T  NG+V   R  NP+ +LK  
Sbjct  88   EGDHEEDTCEVTLLKSPRPDCSEIDRESHLQQAARISITKNNGIVSPLRQANPLGFLKKD  147

Query  48   PSAVCAEVFKEL  13
                CA++ KEL
Sbjct  148  RLPGCADLLKEL  159



>ref|XP_009108374.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY34057.1| BnaC03g62750D [Brassica napus]
 emb|CDX76511.1| BnaA08g08890D [Brassica napus]
Length=171

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G    + +  TD +G Y +   
Sbjct  32   FKIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVALTKEAVTDKSGSYTMEVT  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  ++S    CS++ +D + +   +++LT  +G+V  +TR VNP+ ++   
Sbjct  92   GDHEEEVCELVLLQSPDSACSDVSQDAYLRNAAKVSLTANDGIVSHETRIVNPLGFMVKT  151

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKEL  +P
Sbjct  152  PSAECPAAFKELGIVP  167



>gb|ABP58634.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F+T ++E +PGA +RL+C +  +G  T++  G T A G+Y +  E
Sbjct  6    FHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE  65

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC+EI  +GW K   +  L T NG    TR VNP+ + K + 
Sbjct  66   RDHKNEFCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGT---TRTVNPLGFFKKEA  122

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  123  LPKCAQVYNKLGMYP  137



>emb|CDX99789.1| BnaC05g22110D [Brassica napus]
Length=171

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F +TG+VYCD CR +FVTR+++ + GAKV+LEC +  +   T + +  TD +G Y +   
Sbjct  32   FNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKSRVNQTVTLTKEAVTDKDGKYQMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V+S   +C E+  + + +   RI+LT  +G+V  + R +NP+ +++  
Sbjct  92   GDHEEELCEIILVQSPDAECGEVNNEEFLRNAARISLTANDGIVSNEIRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C +VFKEL  +P
Sbjct  152  PLADCPQVFKELGIVP  167



>emb|CDY65576.1| BnaC09g52000D [Brassica napus]
Length=174

 Score =   117 bits (294),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G    + +  TD  G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLALTKEAVTDKTGSYMMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ ++ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCQLVLVQSPDSGCSDVSEEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  154

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKEL  +P
Sbjct  155  PSADCPAAFKELGIVP  170



>pir||E53806 major allergen OLE17 - common olive (fragment)
Length=136

 Score =   116 bits (291),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD C A+F+T ++E +PGA VRL+C    +G  T++  G T A G+Y +  E
Sbjct  2    FHIQGQVYCDTCHARFITELSEFIPGASVRLQCREKENGDITFTEIGYTRAEGLYSMLVE  61

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC EI  +GWAK   +  L T NG    TR VNP+ + K + 
Sbjct  62   RDHKNEFCEITLISSGRKDCDEIPIEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEA  118

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  119  LPKCAQVYNKLGMYP  133



>ref|XP_004134927.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004172170.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN49302.1| hypothetical protein Csa_6G519550 [Cucumis sativus]
Length=168

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 82/134 (61%), Gaps = 2/134 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITD-GKSTYSVDGETDANGVYHITA  229
            F + G VYCD CR +F TRV++ +PGAKV+L C    + G  T++ +G TD NGVY I  
Sbjct  29   FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEANAGNETFTGEGVTDKNGVYKIEV  88

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            +GDHE+E C +  ++S+   C EI  DG+   F R+++T  NG++   R  NP+ ++K  
Sbjct  89   DGDHEEEICEVSLLESADTGCGEIPTDGYG-HFARVSITGNNGIINPVRQANPLGFMKKD  147

Query  48   PSAVCAEVFKELHY  7
                C EV +EL +
Sbjct  148  ALPQCKEVLRELGF  161



>gb|AEK85663.1| major pollen allergen Ole e1 [Olea europaea]
Length=141

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F+T ++E +PGA +RL+C +  +G  T++  G T A G+Y +  E
Sbjct  7    FHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE  66

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I P+ S ++D +EI  +GW K   +  L T NG    TR VNP+ + K + 
Sbjct  67   RDHKNEFCEITPISSGRKDRNEIPTEGWVKPSLKFILNTLNGT---TRTVNPLGFFKKEA  123

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  124  LPKCAQVYNKLGMYP  138



>pir||I53806 major allergen OLE16 - common olive (fragment)
Length=137

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 80/135 (59%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA+F+T ++E +PGA VRLEC +   G  T++  G T A G+Y +  E
Sbjct  3    FHIQGQVYCDTCRARFITELSEFIPGAGVRLECRDGEKGSITFTEVGYTRAEGLYSMLIE  62

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I    SS++DC EI  +GW K   +  L T NG    TR +NP+ + K + 
Sbjct  63   RDHKNEFCEITLASSSRKDCDEIPVEGWVKPSLKFKLNTVNGT---TRTINPLGFFKKEV  119

Query  45   SAVCAEVFKELHYIP  1
               C +VF +L   P
Sbjct  120  LPKCPQVFNKLGMYP  134



>gb|ACU23617.1| unknown [Glycine max]
Length=169

 Score =   117 bits (292),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 85/132 (64%), Gaps = 1/132 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKS-TYSVDGETDANGVYHITA  229
            F V GTVYCD CR +F+T+++E + GA VR+ C  + + K+ T+S +  TDA+G Y +  
Sbjct  28   FMVEGTVYCDTCRVQFLTKLSEILEGATVRVTCSQVDNAKNVTFSKEAVTDASGSYKVEV  87

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            EGDHE++ C +  +KS + DCSEI ++   ++  RI++T  NG+V   R  NP+ +LK  
Sbjct  88   EGDHEEDTCEVTLLKSPRPDCSEIDRESHLQQAARISITKNNGIVSPFRQANPLGFLKKD  147

Query  48   PSAVCAEVFKEL  13
                CA++ KEL
Sbjct  148  RLPGCADLLKEL  159



>ref|XP_009114385.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=174

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G    + +  TD  G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLALTKEAVTDKTGSYMMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ ++ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVQSPDSGCSDVSEEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  154

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKEL  +P
Sbjct  155  PSADCPAAFKELGIVP  170



>emb|CDY52214.1| BnaAnng11370D [Brassica napus]
Length=174

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G    + +  TD  G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTLALTKEAVTDKTGSYMMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ ++ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVQSPDSGCSDVSEEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  154

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKEL  +P
Sbjct  155  PSADCPAAFKELGIVP  170



>gb|KFK31513.1| hypothetical protein AALP_AA6G122400 [Arabis alpina]
Length=173

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD  G Y +   
Sbjct  34   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEVT  93

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ ++ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  94   GDHEEEVCELVLVQSPDSGCSDVSQEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVKT  153

Query  48   PSAVCAEVFKELHYIP  1
            P A C   FKEL  +P
Sbjct  154  PLADCPAAFKELGIVP  169



>gb|AAN18042.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAN18043.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAN18044.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 81/131 (62%), Gaps = 3/131 (2%)
 Frame = -3

Query  393  GTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHE  214
            G VYCD CRA F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH+
Sbjct  2    GQVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHK  61

Query  213  DEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVC  34
            +E+C I  + S ++DC+EI  +GWAK   +  L T NG    TR VNP+ + K +    C
Sbjct  62   NEFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKC  118

Query  33   AEVFKELHYIP  1
            A+V+ +L   P
Sbjct  119  AQVYNKLGMYP  129



>pir||H53806 major allergen OLE6 - common olive (fragment)
Length=136

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 80/135 (59%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA+F+T ++E +PGA VRLEC +   G  T++  G T A G+Y +  E
Sbjct  2    FHIQGQVYCDTCRARFITELSEFIPGAGVRLECKDGGKGSITFTEVGYTRAEGLYSMLIE  61

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I    SS++DC EI  +GW K   +  L T NG    TR +NP+ + K + 
Sbjct  62   RDHKNEFCEITLASSSRKDCDEIPVEGWVKPSLKFKLNTVNGT---TRTINPLGFFKKEV  118

Query  45   SAVCAEVFKELHYIP  1
               C +VF +L   P
Sbjct  119  LPKCPQVFNKLGMYP  133



>ref|XP_009604804.1| PREDICTED: anther-specific protein LAT52 [Nicotiana tomentosiformis]
Length=161

 Score =   116 bits (291),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 83/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G VYCD CR +F T+++E + GA VRL+C NI+    T+SV+G TD +G Y +T E
Sbjct  27   FDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNISTETETFSVEGVTDKDGKYKLTVE  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDH+D+ C +  VKS +EDC E +  G+ K   RI  +   G+    R  NP+ ++K++ 
Sbjct  87   GDHQDDICEVTVVKSPREDCKESVT-GYEK--ARIECSDNVGIHNAVRYANPLFFMKTEA  143

Query  45   SAVCAEVFKELHYIP  1
             + C EV  EL   P
Sbjct  144  VSGCKEVLDELGLFP  158



>gb|AAQ07442.1| major pollen allergen Ole e 1 [Olea europaea]
 gb|AAQ08186.1| major pollen allergen Ole e 1 [Olea europaea]
 gb|AAQ08187.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ08189.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ08190.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   115 bits (288),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 81/130 (62%), Gaps = 3/130 (2%)
 Frame = -3

Query  390  TVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHED  211
            TVYCD CRA F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH++
Sbjct  3    TVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHKN  62

Query  210  EYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCA  31
            E+C I  + S ++DC+EI  +GWAK   +  L T NG    TR VNP+ + K +    CA
Sbjct  63   EFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCA  119

Query  30   EVFKELHYIP  1
            +V+ +L   P
Sbjct  120  QVYNKLGMYP  129



>pir||G53806 major allergen OLE26 - common olive (fragment)
Length=136

 Score =   115 bits (288),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 80/135 (59%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F+T ++E +PGA VRL+C    +G  T++  G T A G+Y +  E
Sbjct  2    FHIQGQVYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVE  61

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S  +DC+EI  +GW K   +  L T NG    TR VNP+ + K + 
Sbjct  62   RDHKNEFCEITLISSGSKDCNEIPTEGWGKPSLKFILNTVNGT---TRTVNPLGFYKKEA  118

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  119  LPKCAQVYNKLGMYP  133



>ref|NP_568650.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
 dbj|BAD43611.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
 gb|ABR46194.1| At5g45880 [Arabidopsis thaliana]
 gb|AED95311.1| pollen_Ole_e_I-domain containing protein [Arabidopsis thaliana]
Length=174

 Score =   116 bits (291),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD  G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++  + + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVQT  154

Query  48   PSAVCAEVFKELHYIP  1
            P A C   FKEL  +P
Sbjct  155  PLADCPAAFKELGIVP  170



>dbj|BAB09316.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
Length=168

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD  G Y +   
Sbjct  29   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEVT  88

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++  + + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  89   GDHEEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVQT  148

Query  48   PSAVCAEVFKELHYIP  1
            P A C   FKEL  +P
Sbjct  149  PLADCPAAFKELGIVP  164



>pir||F53806 major allergen OLE19 - common olive (fragment)
Length=136

 Score =   115 bits (288),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F+  ++E +PGA VRL+C    +G  T++  G T A G+Y +  E
Sbjct  2    FHIQGQVYCDTCRAGFINELSEFIPGASVRLQCREKKNGDITFTEVGYTRAEGLYSMLVE  61

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC+EI  +GWAK   +  L T NG    TR +NP+ + K + 
Sbjct  62   RDHKNEFCEITLISSGRKDCNEIPIEGWAKPSLKFILNTVNGT---TRTINPLGFYKKEA  118

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  119  LPKCAQVYNKLGMYP  133



>gb|AAQ10267.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10268.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   115 bits (287),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 80/130 (62%), Gaps = 3/130 (2%)
 Frame = -3

Query  390  TVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHED  211
            TVYCD CRA F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH++
Sbjct  3    TVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHKN  62

Query  210  EYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCA  31
            E+C I  + S ++DC EI  +GWAK   +  L T NG    TR VNP+ + K +    CA
Sbjct  63   EFCEITLISSGRKDCDEIPTEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCA  119

Query  30   EVFKELHYIP  1
            +V+ +L   P
Sbjct  120  QVYNKLGMYP  129



>ref|XP_009115274.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
Length=171

 Score =   116 bits (290),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F +TG+VYCD CR +FVTR+++ + GAKV+LEC +  +   T + +  TD +G Y +   
Sbjct  32   FNITGSVYCDTCRVQFVTRLSKFLEGAKVKLECKSRVNQTVTLTKEAVTDKDGKYQMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C    V+S   +C E+  + + +   RI+LT  +G+V  + R +NP+ +++  
Sbjct  92   GDHEEELCEFILVQSPDAECGEVNNEEFLRNAARISLTANDGIVSNEIRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C +VFKEL  +P
Sbjct  152  PLADCPQVFKELGIVP  167



>gb|AEK85659.1| major pollen allergen Ole e1 [Olea europaea]
Length=140

 Score =   115 bits (287),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F+T ++E +PGA +RL+C +  +G  T++  G T A G+Y +  E
Sbjct  6    FHIQGQVYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVE  65

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  +   ++DC+EI  +GW K   +  L T NG    TR VNP+ + K + 
Sbjct  66   RDHKNEFCEITLISDGRKDCNEIPTEGWVKPSLKFILNTLNGT---TRTVNPLGFFKKEA  122

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  123  LPKCAQVYNKLGMYP  137



>gb|AFB73932.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G VYCD CR +F T++++ + GA V+L+C NIT    T+SV+G TD +G Y +T E
Sbjct  27   FDVEGKVYCDTCRVQFETKLSQNIEGATVKLQCRNITTETETFSVEGVTDKDGKYKLTVE  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDH+D+ C +  VKS +EDC E +  G+ K   RI  +   GM    R  NP+ ++K++ 
Sbjct  87   GDHQDDICEVTVVKSPREDCKEAVS-GYEK--ARIECSDNVGMHNAVRYANPLFFMKAEA  143

Query  45   SAVCAEVFKELHYIP  1
               C E   EL   P
Sbjct  144  VEGCKEALDELGLFP  158



>gb|AAQ10269.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10270.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10271.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 80/130 (62%), Gaps = 3/130 (2%)
 Frame = -3

Query  390  TVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHED  211
            TVYCD CRA F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH++
Sbjct  3    TVYCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHKN  62

Query  210  EYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCA  31
            E+C I  + S ++DC EI  +GWAK   +  L T NG    TR VNP+ + K +    CA
Sbjct  63   EFCEITLISSGRKDCDEIPTEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCA  119

Query  30   EVFKELHYIP  1
            +V+ +L   P
Sbjct  120  QVYNKLGMYP  129



>gb|AFB73931.1| LAT52-like protein [Lycium barbarum]
Length=161

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G VYCD CR +F T++++ + GA V+L+C NIT    T+SV+G TD +G Y +T E
Sbjct  27   FDVEGKVYCDTCRVQFETKLSQNIEGATVKLQCRNITTETETFSVEGVTDKDGKYKLTVE  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDH+D+ C +  VKS +EDC E +  G+ K   RI  +   GM    R  NP+ ++K++ 
Sbjct  87   GDHQDDICEVTVVKSPREDCKEAVS-GYEK--ARIECSDNVGMHNAVRYANPLFFMKAEA  143

Query  45   SAVCAEVFKELHYIP  1
               C E   EL   P
Sbjct  144  VEGCKEALDELGLFP  158



>ref|XP_010540511.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F TR+++ + GAKV+LEC NI +   T + +  TD +G Y +   
Sbjct  31   FHIKGSVYCDTCRVQFFTRLSKFLEGAKVKLECKNIDNQTVTLTKEAVTDKSGNYEMVVM  90

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHEDE C I   +S   +CS+I  + + +   RI+LT  +G+V  +TR VNP+ +++  
Sbjct  91   GDHEDEVCEIVLAESPDTECSDINNEEFTRNAARISLTANDGIVSNETRTVNPLGFMRRT  150

Query  48   PSAVCAEVFKELHYIP  1
            P + C + F+EL  +P
Sbjct  151  PLSDCPKAFEELGIVP  166



>emb|CDY01556.1| BnaC07g35460D [Brassica napus]
Length=172

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 86/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD +G Y +   
Sbjct  33   FQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRTNGTVTLTKEAVTDKSGSYKMEVT  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  ++S    CS++  + + +   +++LT  +G+V  +TR VNP+ ++   
Sbjct  93   GDHEEEVCELVLLQSPDSGCSDVSTEAYLRNAAKVSLTANDGIVSHETRIVNPLGFMVKT  152

Query  48   PSAVCAEVFKELHYIP  1
            P A C   FKEL  +P
Sbjct  153  PLADCPAAFKELGIVP  168



>ref|XP_010549400.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=171

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC N  +   T + +  TD +G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKNRVNQTVTLTKEAVTDKSGNYEMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I   +S   +CSEI  + + +   RI+LT  +G+V  +TR+VNP+ +++  
Sbjct  92   GDHEEEVCEIVLGESPDAECSEINNEEFTRNAARISLTANDGIVSNETRSVNPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P   C E FKEL  +P
Sbjct  152  PLGDCPEAFKELGIVP  167



>ref|XP_011029563.1| PREDICTED: olee1-like protein [Populus euphratica]
Length=166

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 84/135 (62%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
             +V G VYCD CR +F T++++ +PGAKV+L C+N  +G  TY+V+G TD+ G Y +   
Sbjct  30   LDVEGKVYCDTCRVEFQTKISDALPGAKVKLACNNRENGTLTYTVEGSTDSRGTYRLPVA  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE++ C ++ V+S + DC+E  K   + +  RI LT   G+V   R  N + Y+K   
Sbjct  90   GDHEEDICEVRLVESPRADCNEPFK---SVDSARILLTKNVGVVNSLRYANALGYMKKVA  146

Query  45   SAVCAEVFKELHYIP  1
               CA+V +E+ ++P
Sbjct  147  QPECAKVLEEMGFLP  161



>gb|KHG25858.1| Olee1-like protein [Gossypium arboreum]
Length=166

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 83/133 (62%), Gaps = 3/133 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F T+++E +PGAKV+LEC    D   TYS + ETDANGVY I  E
Sbjct  33   FVVLGKVYCDTCRVEFETKLSEPIPGAKVKLECRKEGDETVTYSHEAETDANGVYKIPVE  92

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE++ C +  V S + DC+E ++   A E  ++ LT+ +G+ + +R  N + + K   
Sbjct  93   GDHEEQICAVSTVSSPRADCNEKME---AFEKAQVELTSDDGLAEPSRKANNLGFKKKVA  149

Query  45   SAVCAEVFKELHY  7
               CA+V KE+ +
Sbjct  150  VPGCAQVLKEMGF  162



>ref|XP_010538209.1| PREDICTED: pollen-specific protein-like At4g18596 [Tarenaya hassleriana]
Length=170

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC N  +   T   +  TD +G Y +   
Sbjct  31   FHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKNRVNQTVTLVEEAVTDKSGNYEMVVT  90

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V+S + +C EI  + + +   RI+LT  +G+V  +TR VNP+ ++++ 
Sbjct  91   GDHEEEVCEIVLVESPEAECREINNEEFLRNAARISLTANDGIVSNETRTVNPLGFMRNT  150

Query  48   PSAVCAEVFKELHYIP  1
            P   C + FKEL  +P
Sbjct  151  PLPDCPKAFKELDIVP  166



>ref|XP_009794171.1| PREDICTED: anther-specific protein LAT52 [Nicotiana sylvestris]
Length=161

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G VYCD CR +F T+++E + GA VRL+C NI+    T+SV+G TD +G Y +T E
Sbjct  27   FDVEGKVYCDTCRVQFETKLSENVEGATVRLQCRNISTEIETFSVEGVTDKDGKYKLTVE  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDH+D+ C +  VKS +EDC E +  G+ K   RI  +   G+    R  N + ++KS+ 
Sbjct  87   GDHQDDICEVTVVKSPREDCKEAVT-GYEK--ARIECSDNVGIHNAVRYANALFFMKSEA  143

Query  45   SAVCAEVFKELHYIP  1
             + C EV  EL   P
Sbjct  144  VSGCKEVLDELGLFP  158



>ref|XP_007148052.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
 gb|ESW20046.1| hypothetical protein PHAVU_006G176500g [Phaseolus vulgaris]
Length=169

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 83/132 (63%), Gaps = 1/132 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKS-TYSVDGETDANGVYHITA  229
            F V GTVYCD CR +F+TR++E + GA VR+ C  + + K+ T+  +  TDA G Y +  
Sbjct  28   FFVEGTVYCDTCRVQFLTRMSEFLEGAAVRVMCSQVDNAKNVTFDKETVTDALGSYKMEV  87

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            +GDHE++ C +  VKS + DCSE+ K+ + ++  RI++T  NG+V   R  NP+ +LK  
Sbjct  88   DGDHEEDNCQVTLVKSPRPDCSEVDKESYLQQAARISITKNNGIVSPIRQANPLGFLKKD  147

Query  48   PSAVCAEVFKEL  13
                C ++ KEL
Sbjct  148  RLPGCQDLLKEL  159



>ref|XP_008439742.1| PREDICTED: olee1-like protein isoform X1 [Cucumis melo]
 ref|XP_008439744.1| PREDICTED: olee1-like protein isoform X3 [Cucumis melo]
Length=168

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 82/134 (61%), Gaps = 2/134 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITD-GKSTYSVDGETDANGVYHITA  229
            F + G VYCD CR +F TRV++ +PGAKV+L C    + G  T++ +  TD NGVY I  
Sbjct  29   FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEANAGNETFTGEAVTDKNGVYKIEV  88

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            +GDHE+E C +  ++S+ ++CS I  DG+   F R+++T  NG+    R  NP+ +L+  
Sbjct  89   DGDHEEEICEVSLLESADKECSGIPTDGYG-HFARVSITGNNGITNPVRQANPLGFLRKD  147

Query  48   PSAVCAEVFKELHY  7
                C EV +EL +
Sbjct  148  ALPQCKEVLRELGF  161



>pir||A38968 major allergen OLE20 - common olive (fragment)
Length=137

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 81/136 (60%), Gaps = 4/136 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA+F+T ++E +PGA VRLEC +   G  T++  G T A G+Y +  E
Sbjct  2    FHIQGQVYCDTCRARFITELSEFIPGAGVRLECRDGEKGSITFTEVGYTRAEGLYSMLIE  61

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I    SS++DC EI  +GW K   +  L T NG    TR +NP+ + K + 
Sbjct  62   RDHKNEFCEITLASSSRKDCDEIPVEGWVKPSLKFKLNTVNGT---TRTINPLGFFKKEV  118

Query  45   SAVCA-EVFKELHYIP  1
               CA +VF +L   P
Sbjct  119  LPKCAPQVFNKLGMYP  134



>ref|XP_009136942.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY53995.1| BnaA03g58200D [Brassica napus]
Length=171

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 85/136 (63%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD +G Y +   
Sbjct  32   FQIQGSVYCDTCRVQFVTRLSQFLEGAKVKLECRSRTNGTVTLTKEAVTDKSGSYKMEVT  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  + S    CS++  + + +   +++LT  +G+V  +TR VNP+ ++   
Sbjct  92   GDHEEEVCELVLLHSPDSGCSDVSTEAYLRNAAKVSLTANDGIVSHETRIVNPLGFMVKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C   FKEL  +P
Sbjct  152  PLADCPAAFKELGIVP  167



>gb|AAQ83588.1| allergen Fra e 1 [Fraxinus excelsior]
Length=146

 Score =   113 bits (283),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA+F+T+++E + GA VRL+C +  +G  T++  G T   G+Y +  E
Sbjct  12   FHIQGQVYCDTCRARFITKLSEFITGASVRLQCRDKENGDVTFTEIGYTRGEGLYSMFVE  71

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + S ++DC+EI  +GW K   +  L T NG    TR +NP+ + K + 
Sbjct  72   RDHKNEFCEITLLSSGRKDCNEIPIEGWVKPSLKFILNTVNG---TTRTINPLGFFKKEA  128

Query  45   SAVCAEVFKELHYIP  1
               CA+V+ +L   P
Sbjct  129  LPQCAQVYNKLGMYP  143



>gb|AAQ08188.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   113 bits (282),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 81/130 (62%), Gaps = 3/130 (2%)
 Frame = -3

Query  390  TVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHED  211
            TV+CD CRA F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH++
Sbjct  3    TVHCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHKN  62

Query  210  EYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCA  31
            E+C I  + S ++DC+EI  +GWAK   +  L T NG    TR VNP+ + K +    CA
Sbjct  63   EFCEITLISSGRKDCNEIPTEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCA  119

Query  30   EVFKELHYIP  1
            +V+ +L   P
Sbjct  120  QVYNKLGMYP  129



>ref|XP_009602640.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=163

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 79/133 (59%), Gaps = 3/133 (2%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G+VYCD CR +F T+++E + GA VRL C +I   K TYSV+G TD NG Y I  EGD
Sbjct  30   VEGSVYCDTCRVQFQTKLSEYIEGATVRLACKDIETEKETYSVEGVTDKNGKYIIKVEGD  89

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
            HE+E C +  VKS +EDC E        E +R+  +   G+   TR  NP+ ++K++  +
Sbjct  90   HENELCEVSIVKSPREDCKE---SAIGFENSRVVCSANVGIHNPTRYANPLFFMKTEAVS  146

Query  39   VCAEVFKELHYIP  1
             C +V  EL   P
Sbjct  147  GCKDVLDELGLFP  159



>ref|XP_007021723.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY13248.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=162

 Score =   114 bits (284),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 85/136 (63%), Gaps = 4/136 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKS-TYSVDGETDANGVYHITA  229
            F V G VYCD CR +F TR+++ + GA V LEC + T G S TYS +  TD +G Y I  
Sbjct  28   FFVEGKVYCDTCRVEFETRLSQPIKGATVILECRDRTVGGSITYSQESVTDESGKYRIPV  87

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            +GDHE+E C ++ VKS +EDC+E + + W +   R+ LT KNG+    R  N + +LK +
Sbjct  88   QGDHEEEICEVRVVKSPREDCNEFM-EAWQR--ARVLLTKKNGVSDPIRYANNLGFLKKE  144

Query  48   PSAVCAEVFKELHYIP  1
                CAEV +EL ++P
Sbjct  145  AVPGCAEVLEELGFLP  160



>ref|XP_008439743.1| PREDICTED: olee1-like protein isoform X2 [Cucumis melo]
Length=168

 Score =   113 bits (283),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 81/134 (60%), Gaps = 2/134 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITD-GKSTYSVDGETDANGVYHITA  229
            F + G VYCD CR +F TRV++ +PGAKV+L C    + G  T++ +  TD NGVY I  
Sbjct  29   FFIEGKVYCDTCRIQFFTRVSKYLPGAKVKLVCREEANAGNETFTGEAVTDKNGVYKIEV  88

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            +GDHE+E C +  ++S  + C EI  DG+   F R+++T  NG++   R  NP+ + K +
Sbjct  89   DGDHEEEICEVSLLESGDKGCGEIPTDGYG-HFARVSITGNNGIIDPVRQANPLGFKKKE  147

Query  48   PSAVCAEVFKELHY  7
                C EV +EL +
Sbjct  148  ALPQCKEVLRELGF  161



>gb|AAB32652.2| main olive allergen, partial [Olea europaea]
Length=130

 Score =   112 bits (280),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 78/129 (60%), Gaps = 3/129 (2%)
 Frame = -3

Query  387  VYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHEDE  208
            VYCD CRA F+T ++E +PGA VRL+C    +G  T++  G T A G+Y +  E DH++E
Sbjct  2    VYCDTCRAGFITELSEFIPGASVRLQCKEKKNGDITFTEVGYTRAEGLYSMLVERDHKNE  61

Query  207  YCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCAE  28
            +C I  + S  +DC+EI  +GWAK   +  L T NG    TR VNP+ + K +    CA+
Sbjct  62   FCEITLISSGSKDCNEIPTEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCAQ  118

Query  27   VFKELHYIP  1
            V+ +L   P
Sbjct  119  VYNKLGMYP  127



>ref|XP_003541705.1| PREDICTED: olee1-like protein-like [Glycine max]
 gb|KHN08444.1| Olee1-like protein [Glycine soja]
Length=169

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 84/132 (64%), Gaps = 1/132 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKS-TYSVDGETDANGVYHITA  229
            F V GTVYCD CR +F+T+++E + GA VR+ C  + + K+ T+S +  TDA+G Y +  
Sbjct  28   FMVEGTVYCDTCRVQFLTKLSEFLEGATVRVVCSQVDNAKNVTFSKEAVTDASGSYKVEV  87

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            +GDHE++ C +  +KS + DCSE+ ++   ++  RI++T  NG+V   R  NP+ +LK  
Sbjct  88   DGDHEEDTCEVTLLKSPRADCSEVDQESHLQQAARISITKNNGIVSPIRQANPLGFLKKD  147

Query  48   PSAVCAEVFKEL  13
                C ++ KEL
Sbjct  148  RLPGCLDLLKEL  159



>gb|AAQ08947.1| allergen Fra e 1.0101 [Fraxinus excelsior]
Length=145

 Score =   112 bits (281),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA F+T ++E + GA VRL+C +  +GK T++  G T A G+Y +  E
Sbjct  11   FYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKDKENGKVTFTEVGYTRAEGLYSMVIE  70

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + SS++DC EI  +GW K   +  L T NG    TR +NP+ + K + 
Sbjct  71   RDHKNEFCEIVLLSSSRKDCDEIPTEGWVKPSLKFILNTVNGT---TRTINPLGFFKKEV  127

Query  45   SAVCAEVFKELHYIP  1
               C +V+ +L   P
Sbjct  128  LPKCPQVYNKLGMYP  142



>gb|KFK44745.1| hypothetical protein AALP_AA1G297400 [Arabis alpina]
Length=171

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 83/136 (61%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +FVTRV++ + GAKV+LEC    +   T + +  TD  G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFVTRVSKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V+S   +C +I    + +   RI+LT  +G+V  +TR +NP+ +++  
Sbjct  92   GDHEEEVCEIVLVQSPDPECGDINNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKN  151

Query  48   PSAVCAEVFKELHYIP  1
            P   C++VFKEL  +P
Sbjct  152  PLEDCSQVFKELGIVP  167



>ref|XP_008450951.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=165

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F T+V++ + GA V+LEC  I  G  T + +  TD +G Y I A+
Sbjct  27   FFVEGKVYCDTCRVQFFTKVSKFLKGATVKLECKEIEGGSVTLNKEAVTDKSGKYSIEAD  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  VKS   DC EI K+G+    +R+T+T  +G+    R  NP+ +LK + 
Sbjct  87   GDHEEEVCEVSLVKSVDPDCDEISKEGYGHT-SRVTITNNSGITNPVRLANPLAFLKKEK  145

Query  45   SAVCAEVFKELHY  7
               C EV +EL +
Sbjct  146  LPECKEVLRELGF  158



>ref|XP_010277041.1| PREDICTED: anther-specific protein LAT52 [Nelumbo nucifera]
Length=165

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 82/135 (61%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F T+++E + GAKVRLEC +  +    YSV+GETD  G+Y +  E
Sbjct  30   FFVQGKVYCDTCRTQFETKLSEPISGAKVRLECRSRENDDVAYSVEGETDTTGIYKLPVE  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            G HE++ C +K + S ++DCSE        +  R+ L++ NG+   +R  N + ++  KP
Sbjct  90   GSHEEDICEVKLLSSPRKDCSE---PAPGLDHARVLLSSNNGISSASRFANSLGFMVLKP  146

Query  45   SAVCAEVFKELHYIP  1
               C++V KEL  +P
Sbjct  147  IEGCSDVLKELGLLP  161



>gb|AAV74343.1| Fra e 1.0102 major allergen [Fraxinus excelsior]
Length=145

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 80/135 (59%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA F+T ++E + GA VRL+C    +GK T++  G T A G+Y +  E
Sbjct  11   FYVQGQVYCDTCRAGFITELSEFIQGAGVRLQCKEKENGKVTFTEVGYTRAEGLYSMVIE  70

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C I  + SS++DC EI  +GW K   +  L T NG    TR +NP+ + K + 
Sbjct  71   RDHKNEFCEIVLLSSSRKDCHEIPTEGWVKPSLKFILNTVNGT---TRTINPLGFFKKEA  127

Query  45   SAVCAEVFKELHYIP  1
               C +V+ +L   P
Sbjct  128  LPKCPQVYNKLGMYP  142



>gb|AAM65838.1| Ole e I (main olive allergen)-like protein [Arabidopsis thaliana]
Length=174

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 84/136 (62%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD  G Y +   
Sbjct  35   FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTITLTKEAVTDKTGSYKMEVT  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++  + + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  95   GDHEEEVCELVLVQSPDSGCSDVSTEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVQT  154

Query  48   PSAVCAEVFKELHYIP  1
              A C   FKEL  +P
Sbjct  155  XLADCPAAFKELGIVP  170



>emb|CAA16739.1| pollen-specific protein - like [Arabidopsis thaliana]
 emb|CAB78861.1| pollen-specific protein-like [Arabidopsis thaliana]
Length=842

 Score =   120 bits (300),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 87/136 (64%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F++ G+VYCD CR +FVTR+++ + GAKV+LEC + T+G  T + +  TD  G Y +   
Sbjct  306  FQIQGSVYCDTCRVQFVTRLSKFLEGAKVKLECRSRTNGTVTLTKEAVTDKTGSYRMEVT  365

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVK-KTRNVNPILYLKSK  49
            GDHE+E C +  V+S    CS++ K+ + +   +I+LT  +G+V  +TR VNP+ ++   
Sbjct  366  GDHEEEVCELVLVESPDSGCSDVSKEAYLRNAAKISLTANDGIVSHETRIVNPLGFMVQT  425

Query  48   PSAVCAEVFKELHYIP  1
            PSA C   FKEL  +P
Sbjct  426  PSAECPAAFKELGIVP  441



>ref|XP_010499433.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 83/136 (61%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC    +   T + +  TD+ G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYQMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V+S   +C E+    + +   RI+LT  +G+V  +TR +NP+ +++  
Sbjct  92   GDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C + FKEL  +P
Sbjct  152  PLADCPQAFKELGIVP  167



>ref|XP_002316866.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|EEE97478.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=164

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 85/135 (63%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
             +V G VYCD CR +F T++++ +PGAKV+L C+N  +G  TY+V+G TD++G Y +   
Sbjct  30   LDVEGKVYCDTCRVEFQTKISDAIPGAKVKLVCNNRENGTLTYTVEGTTDSSGTYRLPVV  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE++ C ++ V+S + DC+E  K   + +  RI LT   G+V   R  N + Y+K   
Sbjct  90   GDHEEDICEVRLVESPRADCNEPFK---SVDSARILLTKNVGVVDNLRYANALGYMKKVA  146

Query  45   SAVCAEVFKELHYIP  1
               CA+V +E+ ++P
Sbjct  147  QPECAKVLEEMGFLP  161



>ref|XP_010460686.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 83/136 (61%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC    +   T + +  TD+ G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYQMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V+S   +C E+    + +   RI+LT  +G+V  +TR +NP+ +++  
Sbjct  92   GDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C + FKEL  +P
Sbjct  152  PLADCPQAFKELGIVP  167



>ref|XP_006360048.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 81/135 (60%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G VYCD CR +F T+++E + GA V+L+C NI+    T+SV+G TD +G Y +T +
Sbjct  27   FDVEGKVYCDTCRVQFETKLSENLDGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVD  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE++ C +  VKS +EDC E +  G+ K   RI  +   G+    R  NP+ ++K++ 
Sbjct  87   GDHENDICEVTVVKSPREDCKESVS-GYEK--ARIECSNNVGIHNAVRYANPLFFMKAES  143

Query  45   SAVCAEVFKELHYIP  1
               C E   EL   P
Sbjct  144  VQGCKEALDELGLFP  158



>gb|AEK85658.1| major pollen allergen Ole e1 [Olea europaea]
Length=130

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 79/129 (61%), Gaps = 3/129 (2%)
 Frame = -3

Query  387  VYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHEDE  208
            VYCD CRA F+T ++E +PGA +RL+C +  +G  T++  G T A G+Y +  E DH++E
Sbjct  2    VYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKNE  61

Query  207  YCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCAE  28
            +C I  + S ++DC+EI  +GW K   +  L T NG    TR VNP+ + K +    CA+
Sbjct  62   FCEITLISSGRKDCNEIPTEGWVKPSLKFILNTLNGT---TRTVNPLGFFKKEALPKCAQ  118

Query  27   VFKELHYIP  1
            V+ +L   P
Sbjct  119  VYNKLGMYP  127



>ref|XP_009778120.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=163

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 79/133 (59%), Gaps = 3/133 (2%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G+VYCD CR +F T+++E + GA VRL C +I   K TYSV+G TD NG Y I  EGD
Sbjct  30   VEGSVYCDTCRVQFQTKLSEYIEGATVRLACKDIETEKETYSVEGVTDKNGKYIIKVEGD  89

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
            HE+E C +  VKS +EDC E        E +R+  +   G+   TR  NP+ ++K++  +
Sbjct  90   HENELCEVSIVKSPREDCKE---PAIGFENSRVVCSGNVGIHNPTRYANPLFFMKTEAVS  146

Query  39   VCAEVFKELHYIP  1
             C +V  EL   P
Sbjct  147  GCKDVLDELGLFP  159



>ref|XP_004144129.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004171680.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN66323.1| hypothetical protein Csa_1G597700 [Cucumis sativus]
Length=165

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 80/133 (60%), Gaps = 1/133 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F T+V++ + GA V+LEC  I  G  T   +  TD +G Y I A+
Sbjct  27   FFVEGKVYCDTCRVQFFTKVSKFLEGATVKLECKEIEGGSVTLDKEAVTDKSGKYSIEAD  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  +KS   DC EI K+G+    +R+T+T  +G+    R  NP+ +LK + 
Sbjct  87   GDHEEEVCEVSLMKSVDPDCDEISKEGYGHT-SRVTITNNSGITNPVRLANPLAFLKKEK  145

Query  45   SAVCAEVFKELHY  7
             + C EV +EL +
Sbjct  146  LSECKEVLRELGF  158



>gb|AAQ10274.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=131

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 79/130 (61%), Gaps = 3/130 (2%)
 Frame = -3

Query  390  TVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHED  211
            TV CD CRA F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH++
Sbjct  2    TVSCDTCRAGFITELSEFIPGASVRLQCKDKENGDITFTEVGYTRAEGLYSMLVERDHKN  61

Query  210  EYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCA  31
            E+C I  + S ++DC EI  +GWAK   +  L T NG    TR VNP+ + K +    CA
Sbjct  62   EFCEITLISSGRKDCDEIPTEGWAKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCA  118

Query  30   EVFKELHYIP  1
            +V+ +L   P
Sbjct  119  QVYNKLGMYP  128



>gb|AAQ10277.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=131

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 78/129 (60%), Gaps = 3/129 (2%)
 Frame = -3

Query  387  VYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHEDE  208
            VYCD CRA F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH++E
Sbjct  3    VYCDTCRAGFITELSEFIPGASVRLQCKDRENGDITFTEVGYTRAEGLYSMLVERDHKNE  62

Query  207  YCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCAE  28
            +C I  + S ++DC EI  +GW K   +  L T NG    TR VNP+ + K +    CA+
Sbjct  63   FCEITLISSGRKDCDEIPTEGWVKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCAQ  119

Query  27   VFKELHYIP  1
            V+ +L   P
Sbjct  120  VYNKLGMYP  128



>ref|XP_010478273.1| PREDICTED: pollen-specific protein-like At4g18596 [Camelina sativa]
Length=171

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 83/136 (61%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC    +   T + +  TD+ G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDSAGNYEMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V+S   +C E+    + +   RI+LT  +G+V  +TR +NP+ +++  
Sbjct  92   GDHEEELCEIVLVQSPDPECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C + FKEL  +P
Sbjct  152  PLADCPQAFKELGIVP  167



>gb|AEK85662.1| major pollen allergen Ole e1 [Olea europaea]
Length=130

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 79/129 (61%), Gaps = 3/129 (2%)
 Frame = -3

Query  387  VYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHEDE  208
            +YCD CRA F+T ++E +PGA +RL+C +  +G  T++  G T A G+Y +  E DH++E
Sbjct  2    IYCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKNE  61

Query  207  YCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCAE  28
            +C I  + S ++DC+EI  +GW K   +  L T NG    TR VNP+ + K +    CA+
Sbjct  62   FCEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCAQ  118

Query  27   VFKELHYIP  1
            V+ +L   P
Sbjct  119  VYNKLGMYP  127



>ref|NP_174209.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAF88123.1|AC021043_16 Similar to major allergen OLE5c [Arabidopsis thaliana]
 gb|AEE31049.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=171

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 83/136 (61%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC    +   T + +  TD  G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFITRISKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  ++S   +C ++    + +   RI+LT  +G+V  +TR +NP+ +++  
Sbjct  92   GDHEEEVCEIVLLQSPDPECGDVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C +VFKEL  +P
Sbjct  152  PLAECPQVFKELGIVP  167



>ref|XP_009109686.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDX90169.1| BnaA08g18150D [Brassica napus]
Length=171

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 83/136 (61%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC    +   T + +  TD +G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKARENQTVTLTKEAVTDKDGKYEMVVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V+S   +C E+    + +   RI+LT  +G+V  + R +NP+ +++  
Sbjct  92   GDHEEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C +VFKEL  +P
Sbjct  152  PLADCPQVFKELGIVP  167



>ref|XP_004248244.1| PREDICTED: anther-specific protein LAT52 [Solanum lycopersicum]
 sp|P13447.1|LAT52_SOLLC RecName: Full=Anther-specific protein LAT52; Flags: Precursor 
[Solanum lycopersicum]
 emb|CAA33854.1| LAT52 [Solanum lycopersicum]
Length=161

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 80/135 (59%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G VYCD CR +F T+++E + GA V+L+C NI+    T+SV+G TD +G Y +T  
Sbjct  27   FDVEGKVYCDTCRVQFETKLSENLEGATVKLQCRNISTEAETFSVEGVTDKDGKYKLTVN  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE++ C +  VKS +EDC E +  G+ K   RI  +   G+    R  NP+ ++K++ 
Sbjct  87   GDHENDICEVTVVKSPREDCKESVS-GYEK--ARIECSDNVGIHNAVRFANPLFFMKAES  143

Query  45   SAVCAEVFKELHYIP  1
               C E   EL   P
Sbjct  144  VQGCKEALDELGLFP  158



>ref|XP_006304746.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
 gb|EOA37644.1| hypothetical protein CARUB_v10012122mg [Capsella rubella]
Length=171

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 82/136 (60%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC    +   T + +  TD  G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDKAGNYQMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  ++S   +C E+    + +   RI+LT  +G+V  +TR +NP+ +++  
Sbjct  92   GDHEEEVCEIVLLQSPDAECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C + FKEL  +P
Sbjct  152  PLAECPQAFKELGIVP  167



>emb|CDY43319.1| BnaC03g58910D [Brassica napus]
Length=171

 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 82/136 (60%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC    +   T + +  TD  G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAVTDKEGKYEMVVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V+S   +C E+    + +   RI+LT  +G+V  + R +NP+ +++  
Sbjct  92   GDHEEEVCEIILVESPDAECGEVNNQEFLRNAARISLTANDGIVSNEVRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C +VFKEL  +P
Sbjct  152  PLADCPQVFKELGIVP  167



>emb|CDY69202.1| BnaCnng62360D [Brassica napus]
Length=171

 Score =   111 bits (277),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 83/136 (61%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC    +   T + +  TD +G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAMTDKDGNYEMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V+S   +C ++    + +   RI+LT  +G+V  +TR +NP+ +++  
Sbjct  92   GDHEEEVCEIILVQSPDAECGDVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C + FKEL  +P
Sbjct  152  PLADCPQAFKELGIVP  167



>ref|XP_009102877.1| PREDICTED: pollen-specific protein-like At4g18596 [Brassica rapa]
 emb|CDY15649.1| BnaA07g08200D [Brassica napus]
Length=171

 Score =   111 bits (277),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 83/136 (61%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC    +   T + +  TD +G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFMTRLSKVLEGAKVKLECKGRENQTVTLTKEAMTDKDGNYEMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V+S   +C ++    + +   RI+LT  +G+V  +TR +NP+ +++  
Sbjct  92   GDHEEEVCEIILVQSPDAECGDVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C + FKEL  +P
Sbjct  152  PLADCPQAFKELGIVP  167



>gb|KCW69946.1| hypothetical protein EUGRSUZ_F03264 [Eucalyptus grandis]
Length=167

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 80/135 (59%), Gaps = 2/135 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
             +V G V+CD CR  F T+V+  +  +KVRLECHN T G  T S +  TD  G Y +  E
Sbjct  30   LDVVGKVFCDTCRVDFETKVSYGLADSKVRLECHNRTSGALTLSAEAVTDKTGEYRLEVE  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C ++ ++SS+ +CS +++   A    R+ LT KNG+ +  R  N + + K + 
Sbjct  90   GDHEEEICEVQLIESSEPECSSLLE--GAVHNARVALTNKNGVAQPARFANALAFAKKET  147

Query  45   SAVCAEVFKELHYIP  1
             A CA+V  E+  +P
Sbjct  148  LADCAQVLLEMGVLP  162



>gb|AAO22132.1| major pollen allergen Ole e 1 [Olea europaea]
Length=135

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 78/128 (61%), Gaps = 3/128 (2%)
 Frame = -3

Query  384  YCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHEDEY  205
            YCD CRA F+T ++E +PGA +RL+C +  +G  T++  G T A G+Y +  E DH++E+
Sbjct  4    YCDTCRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKNEF  63

Query  204  CGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCAEV  25
            C I  + S ++DC+EI  +GW K   +  L T NG    TR VNP+ + K +    CA+V
Sbjct  64   CEITLISSGRKDCNEIPTEGWVKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCAQV  120

Query  24   FKELHYIP  1
            + +L   P
Sbjct  121  YNKLGMYP  128



>gb|AAQ10272.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10275.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10276.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=129

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 77/128 (60%), Gaps = 3/128 (2%)
 Frame = -3

Query  384  YCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHEDEY  205
            YCD CRA F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH++E+
Sbjct  2    YCDTCRAGFITELSEFIPGAGVRLQCKDGENGNITFTEVGYTRAEGLYSMLVERDHKNEF  61

Query  204  CGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCAEV  25
            C I  + S ++DC EI  +GW K   +  L T NG    TR +NP+ + K +    CA+V
Sbjct  62   CEITLISSGRKDCDEIPTEGWVKPSLKFILNTVNGT---TRTINPLGFFKKEALPKCAQV  118

Query  24   FKELHYIP  1
            + +L   P
Sbjct  119  YNKLGMYP  126



>gb|ACJ83911.1| unknown [Medicago truncatula]
 gb|ACJ86228.1| unknown [Medicago truncatula]
 gb|AFK43996.1| unknown [Medicago truncatula]
 gb|KEH36588.1| pollen Ole e I family allergen [Medicago truncatula]
Length=168

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 80/131 (61%), Gaps = 1/131 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F+TR+ E + GA VR+EC    +G  T++ +  TD +G Y +  +
Sbjct  28   FFVEGVVYCDTCRTQFITRLTEFIEGATVRVECKE-DNGTLTFNKEATTDKSGKYSVEID  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHEDE C +   KS ++DCSE+  +   ++  RI++T  NG+V   R  +P+ +LK + 
Sbjct  87   GDHEDETCEVILCKSPRKDCSEVDSEAHLQQAARISVTNNNGIVSPVRAASPLGFLKKER  146

Query  45   SAVCAEVFKEL  13
               C EV KEL
Sbjct  147  LPKCGEVLKEL  157



>ref|XP_004251892.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=161

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 77/135 (57%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V GTVYCD CR +F TR++E + GAKV+L C ++   K TY+ +  TD NG Y I A 
Sbjct  27   FKVEGTVYCDTCRVQFQTRISEYIEGAKVKLTCRDMETEKVTYTAEALTDKNGKYTIEAS  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE E C +  V+S +EDC +        E +R+  +   GM   TR  NP+ ++K + 
Sbjct  87   GDHEKELCDVGVVQSPREDCKD---PAIGFENSRVVCSNNVGMHNPTRYANPLFFMKKET  143

Query  45   SAVCAEVFKELHYIP  1
               C +V  EL   P
Sbjct  144  LPDCKDVLDELGLFP  158



>ref|XP_006415610.1| hypothetical protein EUTSA_v10008921mg [Eutrema salsugineum]
 gb|ESQ33963.1| hypothetical protein EUTSA_v10008921mg [Eutrema salsugineum]
Length=171

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 82/136 (60%), Gaps = 1/136 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +FVTR+++ + GAKV+LEC    +   T + +  TD  G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFVTRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDKAGNYQMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V S   +CS++    + +   R++LT  +G+V  +TR +NP+ +++  
Sbjct  92   GDHEEEVCEIVLVHSPDAECSDVNNQEFLRNAARVSLTANDGIVSNETRTINPLGFMRKT  151

Query  48   PSAVCAEVFKELHYIP  1
            P A C + F+EL  +P
Sbjct  152  PLADCPQAFQELGIVP  167



>ref|XP_010062811.1| PREDICTED: olee1-like protein [Eucalyptus grandis]
Length=196

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 80/135 (59%), Gaps = 2/135 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
             +V G V+CD CR  F T+V+  +  +KVRLECHN T G  T S +  TD  G Y +  E
Sbjct  59   LDVVGKVFCDTCRVDFETKVSYGLADSKVRLECHNRTSGALTLSAEAVTDKTGEYRLEVE  118

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C ++ ++SS+ +CS +++   A    R+ LT KNG+ +  R  N + + K + 
Sbjct  119  GDHEEEICEVQLIESSEPECSSLLE--GAVHNARVALTNKNGVAQPARFANALAFAKKET  176

Query  45   SAVCAEVFKELHYIP  1
             A CA+V  E+  +P
Sbjct  177  LADCAQVLLEMGVLP  191



>gb|KDP32532.1| hypothetical protein JCGZ_14735 [Jatropha curcas]
Length=165

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 83/133 (62%), Gaps = 3/133 (2%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCDVCR +F T+++E + GA V+LEC    +   TY+V+GETD  G+Y +  EG+
Sbjct  32   VEGKVYCDVCRVEFETKLSEPIKGAVVKLECKIRENNTLTYAVEGETDPQGIYRLPVEGE  91

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
            HE++ C ++ VKS   DC E  K   + +  RI L+   G+V+ +R  NP+ Y+K + + 
Sbjct  92   HEEDICEVRLVKSGMTDCIEPFK---STDRARILLSQNVGVVQASRYANPLGYMKKEANP  148

Query  39   VCAEVFKELHYIP  1
             C +V  ++ ++P
Sbjct  149  NCGQVLLDMGFLP  161



>gb|ACF82695.1| unknown [Zea mays]
 tpg|DAA38042.1| TPA: pollen-specific protein C13 [Zea mays]
Length=167

 Score =   108 bits (269),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + + G VYCD CRA FVT V E + GAKVRLEC +   GK   S+DG TD NG Y I  +
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDGNGTYTIELK  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
              HE++ C +  V+S ++DC ++  D   ++   + LT   G+    R  NP+ YLK  P
Sbjct  92   DSHEEDICEVVLVESPRKDCDQVQAD---RDRAGVLLTRNVGISDNLRPANPLGYLKDVP  148

Query  45   SAVCAEVFKEL  13
              +CA + K+L
Sbjct  149  LPICASLLKQL  159



>gb|ACG33223.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + + G VYCD CRA FVT V E + GAKVRLEC +   GK   S+DG TDANG Y I  +
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDANGTYTIELK  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
              HE++ C +  V+S ++DC ++  D   ++   + LT   G+    R  NP+ Y K  P
Sbjct  92   DSHEEDICEVVLVESPRKDCDQVQAD---RDRAGVLLTRNVGISDNLRPANPLGYFKDVP  148

Query  45   SAVCAEVFKEL  13
              +CA + K+L
Sbjct  149  LPICASLLKQL  159



>ref|XP_006358942.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=161

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V GTVYCD CR +F T+++E + GAKV+L C ++   K TY+ +  TD +G Y I A 
Sbjct  27   FKVEGTVYCDTCRVQFQTKISENIEGAKVQLTCRDMETEKVTYTTEALTDKDGKYTIEAT  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE E C +  + S +EDC E        E TR+  +   GM   TR  NP+ ++K + 
Sbjct  87   GDHEKELCDVGVIHSPREDCKE---PAIGFENTRVVCSNNVGMHNPTRYANPLFFMKKES  143

Query  45   SAVCAEVFKELHYIP  1
               C +V  EL   P
Sbjct  144  LPGCKDVLDELGLFP  158



>gb|ABP58637.1| major pollen allergen Ole e 1 [Olea europaea]
Length=140

 Score =   107 bits (266),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 77/135 (57%), Gaps = 3/135 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G +YCD CRA F+  ++E + GA VRL+C +   G  T++  G T A G+Y +  E
Sbjct  6    FHVQGQIYCDTCRAGFIAELSEFILGAGVRLQCRDSKKGNITFTEVGYTRAEGLYSMLIE  65

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E+C +  + SS++DC EI  +GW +   R  L T NG    T  + P+ + K+K 
Sbjct  66   RDHKNEFCEVNSLSSSRKDCDEIPIEGWVRPSLRFLLNTVNGT---TCTIKPLGFFKNKA  122

Query  45   SAVCAEVFKELHYIP  1
               C +VF +L   P
Sbjct  123  LPKCPQVFNKLGMYP  137



>ref|XP_010941451.1| PREDICTED: pollen-specific protein C13-like [Elaeis guineensis]
Length=165

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 73/129 (57%), Gaps = 2/129 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F VTG VYCD CRA FV    E + GAKVRLEC +   G+ ++S +  TD  G Y IT  
Sbjct  27   FSVTGRVYCDTCRAGFVHEFTEYLGGAKVRLECRDYVSGQVSHSGEALTDKYGYYTITMS  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH++E C +  + S + DC EI  D   ++  R+ LT  NGM  + RNVN I YLK  P
Sbjct  87   DDHQEEICEVVLLDSPRYDCKEIPAD--HRDRARVALTRNNGMSSEQRNVNAIGYLKDVP  144

Query  45   SAVCAEVFK  19
               C  + +
Sbjct  145  LPKCGPMLQ  153



>ref|XP_008467237.1| PREDICTED: olee1-like protein [Cucumis melo]
Length=166

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 78/133 (59%), Gaps = 1/133 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F T+ ++ + GA V+L C  I  G  T S +  TD  G Y I A+
Sbjct  28   FLVEGKVYCDACRVQFFTKASKFLEGATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIEAD  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  VKS+  DCSEI  + + +   R+++T  +G+    R+ NP+ ++K + 
Sbjct  88   GDHEEELCEVTLVKSNDPDCSEISLEKY-EHMARVSITNNSGITNPVRHANPLAFMKKEK  146

Query  45   SAVCAEVFKELHY  7
               C E+ +EL +
Sbjct  147  LPECKEILRELGF  159



>ref|XP_010317514.1| PREDICTED: olee1-like protein [Solanum lycopersicum]
Length=119

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 71/110 (65%), Gaps = 0/110 (0%)
 Frame = -3

Query  330  GAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHEDEYCGIKPVKSSKEDCSEIIK  151
            GA+V+L+C N T    T +VDG+TD +G Y +  E DHED+ C +   KS  +DC+EI  
Sbjct  4    GAEVQLQCKNQTTDAITATVDGKTDEHGFYELLVEHDHEDDICEMMLKKSPMDDCTEIPH  63

Query  150  DGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCAEVFKELHYIP  1
            +  A+E  RIT+T  NG+V  TR+ NP+ +LK + S  C EVFKEL  +P
Sbjct  64   ERNAQESARITITNNNGIVDTTRHANPLFFLKKEASPECDEVFKELELLP  113



>gb|AAQ10273.1| major pollen allergen Ole e 1, partial [Olea europaea]
 gb|AAQ10278.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=131

 Score =   105 bits (262),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 76/128 (59%), Gaps = 3/128 (2%)
 Frame = -3

Query  384  YCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHEDEY  205
            Y D CRA F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH++E+
Sbjct  4    YRDTCRAGFITELSEFIPGASVRLQCKDRENGDITFTEVGYTRAEGLYSMLVERDHKNEF  63

Query  204  CGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCAEV  25
            C I  + S ++DC EI  +GW K   +  L T NG    TR VNP+ + K +    CA+V
Sbjct  64   CEITLISSGRKDCDEIPTEGWVKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCAQV  120

Query  24   FKELHYIP  1
            + +L   P
Sbjct  121  YNKLGMYP  128



>ref|XP_011078225.1| PREDICTED: pollen allergen Che a 1-like [Sesamum indicum]
Length=170

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 77/134 (57%), Gaps = 2/134 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSV-DGETDANGVYHITA  229
            F V G VYCDVCR  F  + +E M GA+V+LEC +   GK TY +  GETD NG+Y + A
Sbjct  31   FIVKGMVYCDVCRVNFFNKFSEPMSGAQVKLECKDKESGKVTYRMTGGETDDNGIYTLPA  90

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFT-RITLTTKNGMVKKTRNVNPILYLKS  52
            EGDH  E C +  VKSS+ +CSEI  D   K  T  +TL   +  +   R  NP+++ + 
Sbjct  91   EGDHLGEVCEVTLVKSSRAECSEIPIDRSGKSPTSEVTLVATSSFMDNIRLANPLVFTRK  150

Query  51   KPSAVCAEVFKELH  10
            +    C E  K++ 
Sbjct  151  EALRKCIEFLKDVQ  164



>gb|AAQ10280.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   105 bits (261),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 78/130 (60%), Gaps = 3/130 (2%)
 Frame = -3

Query  390  TVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHED  211
            TV+   CRA+F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH++
Sbjct  3    TVFRVTCRARFITELSEFIPGAGVRLQCKDGENGNVTFTEVGYTRAEGLYSMLIERDHKN  62

Query  210  EYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCA  31
            E+C I  + SS++DC EI  +GW K   +  L T NG    TR +NP+ + K +    C 
Sbjct  63   EFCEITLLSSSRKDCDEIPVEGWVKPSLKFMLNTVNG---TTRTINPLGFFKKEALPKCP  119

Query  30   EVFKELHYIP  1
            +VF +L   P
Sbjct  120  QVFNKLGMYP  129



>ref|NP_001148343.1| LOC100281953 precursor [Zea mays]
 gb|ACG30892.1| pollen-specific protein C13 precursor [Zea mays]
Length=167

 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 75/131 (57%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + + G VYCD CRA FVT V E + GAKVRLEC +   GK   S+DG TD NG Y    +
Sbjct  32   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERSIDGVTDGNGTYTXELK  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
              HE++ C +  V+S ++DC ++  D   ++   + LT   G+    R  NP+ YLK  P
Sbjct  92   DSHEEDICEVVLVESPRKDCDQVQAD---RDRAGVLLTRNVGISDNLRPANPLGYLKDVP  148

Query  45   SAVCAEVFKEL  13
              +CA + K+L
Sbjct  149  LPICASLLKQL  159



>ref|XP_004143635.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 ref|XP_004168700.1| PREDICTED: olee1-like protein-like [Cucumis sativus]
 gb|KGN50408.1| hypothetical protein Csa_5G172880 [Cucumis sativus]
Length=166

 Score =   105 bits (263),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 78/133 (59%), Gaps = 1/133 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F T+ ++ + GA V+L C  I  G  T S +  TD  G Y I A+
Sbjct  28   FLVEGKVYCDACRVQFFTKASKFLEGATVKLVCKEIEGGSVTLSKEAVTDKTGSYSIEAD  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE++ C +  VKS+  DCSEI  + + +   R+++T  +G+    R+ NP+ ++K + 
Sbjct  88   GDHEEDLCEVTLVKSNDPDCSEISLEKY-EHMARVSITNNSGITNPVRHANPLAFMKKEK  146

Query  45   SAVCAEVFKELHY  7
               C EV +EL +
Sbjct  147  LPECKEVLRELGF  159



>ref|XP_011101379.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=176

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 78/133 (59%), Gaps = 2/133 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSV-DGETDANGVYHITA  229
            F V G V+C+VCR  F+ + +  MP A+V+LEC +   GK  Y +  G+T+ NG Y + A
Sbjct  32   FIVKGKVFCEVCRLNFINKFSHPMPKAEVKLECRDEGTGKVMYRLTGGQTNDNGEYTLYA  91

Query  228  EGDHEDEYCGIKPVKSSKEDCSEI-IKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKS  52
            EGDH +E C +  VKSS+ DC+EI   D   K+   ITLT  NG     R  NP+ + + 
Sbjct  92   EGDHGEEICEVTLVKSSQHDCAEIPTDDSGEKQAAEITLTVNNGFHDNIRLANPLSFTRK  151

Query  51   KPSAVCAEVFKEL  13
            K    CA++ KEL
Sbjct  152  KALPKCAKLLKEL  164



>ref|XP_010261236.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=163

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 75/132 (57%), Gaps = 3/132 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA F T     +PGA+VR+EC +  +    +SV+G TDA G Y+I   
Sbjct  29   FNVVGRVYCDTCRAGFETPATTYIPGARVRVECRDRDNLNLLFSVEGVTDATGTYNIQVA  88

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH D+ C    V+SS+EDC +I      +E   + LT  NG++   R  N + ++K +P
Sbjct  89   EDHGDQLCEAVLVRSSQEDCGKIES---GRERANVVLTRNNGVLSDKRFANNMGFIKDQP  145

Query  45   SAVCAEVFKELH  10
             A CAE+ K+  
Sbjct  146  LAGCAEILKQYQ  157



>ref|XP_004293940.1| PREDICTED: olee1-like protein-like [Fragaria vesca subsp. vesca]
Length=169

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
             +V G V+CD CR +F+TR+ + + GAKV+LEC ++  G  TYS + ET+  G Y I  +
Sbjct  30   LQVEGVVFCDSCRIQFITRIDKLIQGAKVKLECKDLDSGSITYSKEAETNEQGRYSIEVD  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHE+E C +  V S  EDC++I  +   +   RI+LT  NG+    R  NP+ ++K +P
Sbjct  90   SDHEEEECEVVLVSSPDEDCNQISHELHQQISARISLTQHNGIAGPVRIPNPLGFMKKEP  149

Query  45   SAVCAEVFKELHYIP  1
            +  C +V KEL   P
Sbjct  150  APECPQVLKELGLTP  164



>ref|XP_011101449.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=171

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 77/130 (59%), Gaps = 2/130 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGE-TDANGVYHITA  229
            F V G V+C+VCRA F+ + ++ M GA+V+LEC +   G  TYS+ G  T+  G Y + A
Sbjct  28   FIVKGRVFCEVCRANFINKFSKPMVGAEVKLECRDEESGMVTYSLTGGVTNDKGEYRLAA  87

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAK-EFTRITLTTKNGMVKKTRNVNPILYLKS  52
            EGDHE EYC +  VKSS+ DC+EI  DG  +     ITLT  NG     R+ N + + K 
Sbjct  88   EGDHEAEYCEVTLVKSSEPDCAEIPVDGLGEIPAAEITLTANNGFHDTFRHANALFFTKK  147

Query  51   KPSAVCAEVF  22
            +    C E++
Sbjct  148  EAMPQCEELY  157



>ref|XP_009761932.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana sylvestris]
Length=164

 Score =   104 bits (259),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 74/132 (56%), Gaps = 3/132 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G V+CD CR  F T ++E + GA VRL C +I     TYS +G+TD  G Y +T E
Sbjct  27   FDVEGRVFCDTCRLGFATSLSEAIQGATVRLTCRDIETHNETYSTEGKTDMIGKYTLTVE  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE++ C +  V S +EDC EI+ +       R+  +   GM    R  NP+ + K KP
Sbjct  87   GDHENDICEVTVVNSPREDCKEIVSELVKG---RVVCSKNVGMHNAVRFTNPLFFQKDKP  143

Query  45   SAVCAEVFKELH  10
               C E+ +E+ 
Sbjct  144  VPGCKELVEEME  155



>gb|AAQ10281.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=131

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 76/128 (59%), Gaps = 3/128 (2%)
 Frame = -3

Query  384  YCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHEDEY  205
            Y   CRA+F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH++E+
Sbjct  4    YSGHCRARFITELSEFIPGAGVRLQCKDGENGNVTFTEVGYTRAEGLYSMLIERDHKNEF  63

Query  204  CGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCAEV  25
            C I  + SS++DC EI  +GW K   +  L T NG    TR +NP+ + K +    C +V
Sbjct  64   CEITLLSSSRKDCDEIPVEGWVKPSLKFMLNTVNG---TTRTINPLGFFKKEALPKCPQV  120

Query  24   FKELHYIP  1
            F +L   P
Sbjct  121  FNKLGMYP  128



>ref|XP_006348395.1| PREDICTED: anther-specific protein LAT52-like [Solanum tuberosum]
Length=169

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 3/134 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G V+CD CR  FVT ++  + GA VRL C ++     T++ +G+TD  G Y +T E
Sbjct  27   FDVEGKVFCDTCRLGFVTSLSNTLEGATVRLTCKDMETHNETFTTEGKTDYIGKYTLTVE  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE++ C +  V S K+DC EI+ D       R+  +   GM    R VNP+ + K KP
Sbjct  87   GDHENDICEVTLVNSPKDDCKEIVPDMVNN---RVICSKNVGMHNAVRFVNPLFFQKDKP  143

Query  45   SAVCAEVFKELHYI  4
               C E+ +E+  +
Sbjct  144  INGCRELVEEMELV  157



>gb|AAQ10279.1| major pollen allergen Ole e 1, partial [Olea europaea]
Length=132

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 77/130 (59%), Gaps = 3/130 (2%)
 Frame = -3

Query  390  TVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHED  211
            TV  D C A+F+T ++E +PGA VRL+C +  +G  T++  G T A G+Y +  E DH++
Sbjct  3    TVSQDTCCARFITELSEFIPGAGVRLQCKDGENGNVTFTEVGYTRAEGLYSMLIERDHKN  62

Query  210  EYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCA  31
            E+C I  + SS++DC EI  +GW K   +  L T NG    TR +NP+ + K +    C 
Sbjct  63   EFCEITLLSSSRKDCDEIPVEGWVKPSLKFMLNTVNG---TTRTINPLGFFKKEALPKCP  119

Query  30   EVFKELHYIP  1
            +VF +L   P
Sbjct  120  QVFNKLGMYP  129



>ref|NP_001105351.1| pollen-specific protein C13 precursor [Zea mays]
 sp|P33050.1|PSC13_MAIZE RecName: Full=Pollen-specific protein C13; Flags: Precursor [Zea 
mays]
 gb|AAB23277.1| pollen specific protein [Zea mays]
 gb|AFW58125.1| male-gametophyte specific1 [Zea mays]
 prf||2209273A Zm13
Length=170

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 73/131 (56%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + + G VYCD CRA FVT V E + GAKVRLEC +   GK   ++DG TDA G Y I  +
Sbjct  35   YVIQGRVYCDTCRAGFVTNVTEYIAGAKVRLECKHFGTGKLERAIDGVTDATGTYTIELK  94

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
              HE++ C +  V S ++DC E+      ++   + LT   G+    R  NP+ Y K  P
Sbjct  95   DSHEEDICQVVLVASPRKDCDEV---QALRDRAGVLLTRNVGISDSLRPANPLGYFKDVP  151

Query  45   SAVCAEVFKEL  13
              VCA + K+L
Sbjct  152  LPVCAALLKQL  162



>gb|AAO22133.1| major pollen allergen Ole e 1 [Olea europaea]
Length=134

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 75/124 (60%), Gaps = 3/124 (2%)
 Frame = -3

Query  372  CRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHEDEYCGIK  193
            CRA F+T ++E +PGA +RL+C +  +G  T++  G T A G+Y +  E DH++E+C I 
Sbjct  7    CRAGFITELSEFIPGASLRLQCKDKENGDVTFTEVGYTRAEGLYSMLVERDHKNEFCEIT  66

Query  192  PVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVCAEVFKEL  13
             + S ++DC+EI  +GW K   +  L T NG    TR VNP+ + K +    CA+V+ +L
Sbjct  67   LISSGRKDCNEIPTEGWVKPSLKFILNTVNGT---TRTVNPLGFFKKEALPKCAQVYNKL  123

Query  12   HYIP  1
               P
Sbjct  124  GMYP  127



>ref|XP_010321468.1| PREDICTED: LOW QUALITY PROTEIN: major pollen allergen Lol p 11-like 
[Solanum lycopersicum]
Length=162

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 76/133 (57%), Gaps = 3/133 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR  + T  ++ +PG++VR+EC N       Y+V+G T++ G Y I   
Sbjct  28   FLVIGKVYCDTCRCGYETSASKYLPGSRVRIECKNRDTNDLAYTVEGVTNSKGEYKILVN  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             D  DE+C +  ++SS   C+E       ++ TR+ LT+ NGMV  TR  N + +L ++P
Sbjct  88   SDRRDEFCDVVLIRSSDPMCAE---PNTGRDRTRVVLTSNNGMVSNTRFANSLGFLYNEP  144

Query  45   SAVCAEVFKELHY  7
             A C ++ K+  +
Sbjct  145  LASCTKILKQYEF  157



>ref|XP_002447728.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
 gb|EES12056.1| hypothetical protein SORBIDRAFT_06g014740 [Sorghum bicolor]
Length=173

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 73/131 (56%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + + G VYCD CRA FVT V E M GAKVRLEC +   G+   ++DG TDA G Y I  +
Sbjct  38   YVIQGRVYCDTCRAGFVTNVTEYMAGAKVRLECKHFGTGEVERAIDGVTDATGTYTIELK  97

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
              HE++ C +  V+S ++DC +       ++   + LT   G+    R  NP+ Y K  P
Sbjct  98   DSHEEDICQVVLVQSPRKDCDQT---QPLRDRAGVLLTRNVGIADSLRPANPLGYFKDVP  154

Query  45   SAVCAEVFKEL  13
              VCA + K+L
Sbjct  155  LPVCAALLKQL  165



>ref|XP_004244268.1| PREDICTED: anther-specific protein LAT52-like [Solanum lycopersicum]
Length=169

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 75/134 (56%), Gaps = 3/134 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G V+CD CR  FVT ++  + GA VR+ C ++     T++ +G+TD  G Y +  E
Sbjct  27   FNVEGKVFCDTCRLGFVTSLSNTLEGATVRMTCKDMETHNETFTTEGKTDGIGKYTLKVE  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE++ C +  V S K+DC E++ D       R+  +   GM    R VNP+ Y K KP
Sbjct  87   GDHENDICEVTLVNSPKDDCKEVVPDMVNN---RVICSKNVGMHNAVRFVNPLFYQKDKP  143

Query  45   SAVCAEVFKELHYI  4
               CA++ +E+  +
Sbjct  144  IDGCAKLVEEMELV  157



>gb|EYU45018.1| hypothetical protein MIMGU_mgv1a015317mg [Erythranthe guttata]
Length=161

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 76/131 (58%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CR +F T +++R+PGA VRLEC N      TYSV+G T+A+G Y +  +
Sbjct  30   FNIEGDVYCDPCRVQFHTELSKRIPGATVRLECQNEETKAVTYSVEGLTNADGHYSLRVD  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE + C +K +KS   +CSE + D   +E +RI  T   GM    R  NPI ++    
Sbjct  90   GDHEKDVCVVKAIKSPIAECSEPMTD--VRE-SRIVCTNNIGMHSAVRFANPIGFMTKVG  146

Query  45   SAVCAEVFKEL  13
            S  C  V ++ 
Sbjct  147  SPQCIPVLQDF  157



>gb|EYU26327.1| hypothetical protein MIMGU_mgv1a015422mg [Erythranthe guttata]
Length=158

 Score =   101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 75/131 (57%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F T +A+R+ GA VRLEC ++     TYSV+G T  NG Y +   
Sbjct  26   FNVEGDVYCDPCRVQFETVLAQRLIGATVRLECRDLVKKAVTYSVEGVTGFNGHYSLPVV  85

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDH++E C +  VKS + DC E + D +AK  +RI+ TT +G     R  NPI ++    
Sbjct  86   GDHQNEICEVAVVKSPRPDCIEPMGD-FAK--SRISCTTNDGTHAAVRFANPIGFMTGAA  142

Query  45   SAVCAEVFKEL  13
               C  V  +L
Sbjct  143  VPQCTPVLFDL  153



>ref|XP_006366520.1| PREDICTED: olee1-like protein-like [Solanum tuberosum]
Length=162

 Score =   100 bits (250),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 74/133 (56%), Gaps = 3/133 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR  F T  +  +PG++VR+EC N       Y+V+G T++ G Y I   
Sbjct  28   FLVVGKVYCDTCRCGFETSASMYLPGSRVRIECKNRDTNDLAYTVEGFTNSKGEYKILVN  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             D  DE+C +  ++SS   C+E       ++  R+ LT+ NGMV  TR  N + +L ++P
Sbjct  88   SDRRDEFCDVVLIRSSDPMCAE---PNTGRDRARVVLTSNNGMVSNTRFANSMGFLSNEP  144

Query  45   SAVCAEVFKELHY  7
             A C ++ ++  +
Sbjct  145  LASCTKILQQYEF  157



>ref|XP_010269200.1| PREDICTED: pollen-specific protein C13-like [Nelumbo nucifera]
Length=159

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 71/134 (53%), Gaps = 3/134 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA F T     +PGAKVR+EC +       +SVDG TD+ G Y I   
Sbjct  27   FTVFGKVYCDNCRAGFETSATTYIPGAKVRVECRDRDTLNLLFSVDGVTDSTGSYKIQVA  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED+ C    V S + DCS +      +E  R+ LT  NG+    R  N + ++K +P
Sbjct  87   EDHEDQLCESVLVSSPQNDCSAVEP---GRERARVILTRGNGIASDNRYANSLGFIKDQP  143

Query  45   SAVCAEVFKELHYI  4
               CAE+ K+   +
Sbjct  144  LPGCAEIMKQYQEL  157



>ref|XP_009598969.1| PREDICTED: anther-specific protein LAT52-like [Nicotiana tomentosiformis]
Length=164

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 73/132 (55%), Gaps = 3/132 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F+V G V+CD CR  F T ++E + GA V L C +I     TYS +G+TD  G Y +T E
Sbjct  27   FDVEGRVFCDTCRLGFATSLSEVIQGATVGLTCRDIETHNETYSTEGKTDMIGKYTLTVE  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE++ C +  V S +EDC EI+ +       R+  +   GM    R  NP+ + K KP
Sbjct  87   GDHENDICEVTVVNSPREDCKEIVSELVKG---RVVCSKNVGMHNAVRFTNPLFFQKDKP  143

Query  45   SAVCAEVFKELH  10
               C E+ +E+ 
Sbjct  144  VPGCKELVEEME  155



>gb|KDP21093.1| hypothetical protein JCGZ_21564 [Jatropha curcas]
Length=221

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 80/191 (42%), Gaps = 56/191 (29%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHN-------------ITDGKSTYSVDG  265
            F V G VYCD CR +F+T+V   + GA V LEC N             +TD    YS+  
Sbjct  26   FNVEGVVYCDTCRVQFMTKVTTLIEGATVHLECFNRTGDVLTYTSPEAVTDAAGKYSIPV  85

Query  264  E-------------------------------------------TDANGVYHITAEGDHE  214
            E                                           TDA G Y I  EGDHE
Sbjct  86   EGDHEDELCQVMLLKSPNPDCATVHLECFNRTGDVLTYTSPEAVTDAAGKYSIPVEGDHE  145

Query  213  DEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVC  34
            DE C +  +KS   DC+EI KD + +E   +TLT  NG+    R  NP+ +LK +    C
Sbjct  146  DELCQVMLLKSPNPDCNEINKDPFVRESASVTLTNDNGIAGPAREANPLGFLKKEILPEC  205

Query  33   AEVFKELHYIP  1
             EV +EL   P
Sbjct  206  PEVLRELGITP  216



>ref|XP_002268073.1| PREDICTED: pollen-specific protein C13 [Vitis vinifera]
 emb|CBI33037.3| unnamed protein product [Vitis vinifera]
Length=159

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 76/130 (58%), Gaps = 3/130 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F T     + GA+VR+EC +    +  YSV+G TD+ G Y  +  
Sbjct  27   FVLHGRVYCDTCRAGFETSATTYIAGARVRIECKDRNSLQLVYSVEGVTDSTGTYKFSIA  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH D+ C    VKS + DC+++      ++ +R++LT  NG+V  TR  N + ++K +P
Sbjct  87   DDHGDQMCDAVLVKSPQPDCAKV---DAGRDRSRLSLTRSNGLVSDTRFANAMGFMKDEP  143

Query  45   SAVCAEVFKE  16
            ++ C ++ K+
Sbjct  144  ASGCTQLLKQ  153



>ref|XP_006857531.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
 gb|ERN18998.1| hypothetical protein AMTR_s00061p00032820 [Amborella trichopoda]
Length=159

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 70/129 (54%), Gaps = 3/129 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            FEV G VYCD CRA F T     + G+ VRLEC +    + TYS++G TDA G Y +   
Sbjct  27   FEVEGRVYCDTCRAGFETSATTYIKGSTVRLECKDRATHQLTYSIEGVTDATGTYRLPVS  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             D + E C +  V S +  C + +     +E  R+ LT  NG+V  TR  N + +LK +P
Sbjct  87   DDRQHEICEVVVVSSPEAGCGKAM---LGRERARVLLTHNNGIVSNTRYANALAFLKDEP  143

Query  45   SAVCAEVFK  19
               CAE+ K
Sbjct  144  LPRCAELLK  152



>gb|AAN76546.1|AF393475_1 LLP-B3 protein [Lilium longiflorum]
Length=160

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 73/129 (57%), Gaps = 3/129 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA F T +   + GAKV+LEC +  +    ++V+G T++ G Y I  E
Sbjct  28   FIVEGRVYCDSCRAGFETNITTYIEGAKVKLECRHFDNDSIAHTVEGVTNSTGTYSIQLE  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHE E C +  V S   DC+EI    + ++  R+TLT  NG+    R  N + +L+ +P
Sbjct  88   NDHESEICEVVLVSSPIFDCNEI---DYDRDRARVTLTNNNGIDSPIRYANSLGFLQEQP  144

Query  45   SAVCAEVFK  19
              +C ++ K
Sbjct  145  DIICGDLLK  153



>ref|XP_006652233.1| PREDICTED: pollen-specific protein C13-like [Oryza brachyantha]
Length=166

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 71/131 (54%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + V G VYCD CRA F T V E + GAKVRLEC +   G    +VDG TD  G Y I  +
Sbjct  31   YLVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHYGTGNIERAVDGVTDETGTYKIELK  90

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
              HE++ C +  VKS   +C E+  +   ++  R+ LT   G+    R  NP+ YLK  P
Sbjct  91   DSHEEDICEVVLVKSPLANCGEVQAE---RDRARVLLTRNVGICDNLRFANPLGYLKDIP  147

Query  45   SAVCAEVFKEL  13
              VC E+ K+ 
Sbjct  148  LPVCGELLKQF  158



>ref|XP_010942360.1| PREDICTED: pollen allergen Phl p 11-like [Elaeis guineensis]
Length=174

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 71/133 (53%), Gaps = 3/133 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CR  F T +   MPGAKVRLEC      + TY  +  TD  G+Y +T  
Sbjct  40   FTLEGRVYCDTCRTGFETDLTTYMPGAKVRLECMRYGTDELTYKAEATTDFLGIYQMTVP  99

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH ++ C +  VKSS ++C+EI      ++  RITL    G++   R  N + YL  KP
Sbjct  100  DDHSNDQCSVVLVKSSLDNCTEIEP---GRDRVRITLAQDGGLLSNIRQANALGYLIDKP  156

Query  45   SAVCAEVFKELHY  7
               C ++ ++  +
Sbjct  157  LLECGKLLQKYGF  169



>ref|XP_006464247.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Citrus sinensis]
Length=161

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 72/135 (53%), Gaps = 5/135 (4%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CR  F T     + GA VR+EC +       YS+DGETD+ G Y+I  +
Sbjct  25   FHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNIHVD  84

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDH+D+ C  K + S   DC         +  +++ LT  NG V      N + +LK++P
Sbjct  85   GDHQDQICYSKLISSPLADCKTA---DPGRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  45   SAVCAEVFKELHYIP  1
             A C E+ K+  Y+P
Sbjct  142  LAFCPELLKK--YLP  154



>ref|XP_011070069.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=161

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 73/131 (56%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F T ++  + GA VRLEC +I     TYS++G T ++G Y +T +
Sbjct  26   FHVEGDVYCDPCRVQFETELSYNLAGATVRLECRDIETKTVTYSMEGVTGSDGHYSLTVK  85

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE + C + PVKS K +CSE + D    E  +I  T  +G+    R  NPI ++  + 
Sbjct  86   GDHEKDICEVIPVKSPKAECSEPMGD---YERAKIECTENSGLHNPIRYANPIGFMTPEI  142

Query  45   SAVCAEVFKEL  13
               C  +   L
Sbjct  143  LPACGPILANL  153



>emb|CDP16229.1| unnamed protein product [Coffea canephora]
Length=161

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 76/135 (56%), Gaps = 4/135 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F T +++ + GA+V L+C    +G  T S    TDANG Y ++A+
Sbjct  26   FTVKGRVYCDPCRVEFQTSLSKSIEGAEVELQCRVRENGTVTVSQKATTDANGNYELSAQ  85

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  V S  ++C+      +A+   R+ LT  NG+    R  N + Y  +K 
Sbjct  86   GDHEEEICEVVSVSSPSQECNV----PFAENKARVLLTQNNGVQGTDRYANALGYKTTKT  141

Query  45   SAVCAEVFKELHYIP  1
            +  C  + +E+ YIP
Sbjct  142  NPDCKAILQEMGYIP  156



>gb|KDO80906.1| hypothetical protein CISIN_1g031458mg [Citrus sinensis]
Length=159

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD C+A F T     + GAKV++EC +    +  YS +G+TD+ G Y I   
Sbjct  27   FSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKILVS  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH+D+ C    V S + DC  +      +E +R+ LT+ NG+  +TR  N + ++K++P
Sbjct  87   EDHQDQLCDAVLVSSPQNDCKTV---APGRERSRVILTSYNGISSETRYANSMGFMKAEP  143

Query  45   SAVCAEVFK  19
             + CAEV +
Sbjct  144  MSGCAEVLR  152



>ref|XP_006472638.1| PREDICTED: pollen-specific protein C13-like [Citrus sinensis]
Length=159

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD C+A F T     + GAKV++EC +    +  YS +G+TD+ G Y I   
Sbjct  27   FSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKILVS  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH+D+ C    V S + DC  +      +E +R+ LT+ NG+  +TR  N + ++K++P
Sbjct  87   EDHQDQLCDAVLVSSPQNDCKTV---APGRERSRVILTSYNGISSETRYANSMGFMKAEP  143

Query  45   SAVCAEVFK  19
             + CAEV +
Sbjct  144  MSGCAEVLR  152



>emb|CDO96791.1| unnamed protein product [Coffea canephora]
Length=121

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 68/107 (64%), Gaps = 3/107 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAK-VRLE--CHNITDGKSTYSVDGETDANGVYHI  235
            F+V G VYCD CRA+   R++E MPG   V LE           TYS++G+T+A+ +Y +
Sbjct  14   FKVEGEVYCDKCRAQLKNRLSEPMPGTNFVYLEPLAPFFHARHLTYSLEGQTEASTIYSL  73

Query  234  TAEGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV  94
              EGDHEDE C    VKS+K DCSEI K G A+  +RI+LT  NG+V
Sbjct  74   EVEGDHEDEICEDVLVKSNKPDCSEIPKQGLAQASSRISLTANNGIV  120



>ref|XP_009342278.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 76/129 (59%), Gaps = 4/129 (3%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCD CR +F TR++  + GA V LEC +  +G   Y V+G+TD NG+Y +    +
Sbjct  34   VEGKVYCDPCRVQFETRLSTPIDGATVALECRSRENGTIVYVVEGKTDKNGIYSLATHKE  93

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
             E++ C ++ V+SS ++C+    D +  E  RI LT  NG+    R  NP+ ++K + ++
Sbjct  94   FEEQICEVRTVRSSTDECA----DHFDIERARILLTHNNGVNALARYANPLGFMKKESTS  149

Query  39   VCAEVFKEL  13
             C  V KEL
Sbjct  150  ECEAVLKEL  158



>ref|XP_006428158.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
 gb|ESR41398.1| hypothetical protein CICLE_v10027141mg, partial [Citrus clementina]
Length=250

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CR  F T     + GA VR+EC +       YS+DGETD+ G Y+I  +
Sbjct  25   FHIRGRVYCDTCRCGFETSATTYIQGAHVRIECKDRNSLNLKYSIDGETDSTGTYNIHVD  84

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDH+D+ C  K + S   DC         +  +++ LT  NG V      N + +LK++P
Sbjct  85   GDHQDQICYSKLISSPLADCKTADP---GRACSQVILTRSNGAVSNLHFANALGFLKARP  141

Query  45   SAVCAEVFKEL  13
             A C E+ K+L
Sbjct  142  LAFCPELLKKL  152



>ref|XP_006434027.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
 gb|ESR47267.1| hypothetical protein CICLE_v10002743mg [Citrus clementina]
Length=159

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD C+A F T     + GAKV++EC +    +  YS +G+TD+ G Y I   
Sbjct  27   FSVEGRVYCDTCQAGFETPATTYIAGAKVKVECKDRKSMQVVYSREGKTDSTGTYKILVS  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH+D+ C    + S + DC  +      +E +R+ LT+ NG+  +TR  N + ++K++P
Sbjct  87   EDHQDQLCDAVLISSPQNDCKTV---APGRERSRVILTSYNGISSETRYANSMGFMKAEP  143

Query  45   SAVCAEVFK  19
             + CAEV +
Sbjct  144  MSGCAEVLR  152



>ref|XP_008359333.1| PREDICTED: olee1-like protein [Malus domestica]
Length=166

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 75/129 (58%), Gaps = 4/129 (3%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCD CR +F TR++  + GA V LEC +  +G   Y+++G+TD NG+Y + A+ +
Sbjct  34   VEGKVYCDPCRVQFETRLSTPLDGATVALECRSRENGTMVYTLEGKTDKNGIYSLPADKN  93

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
             E++ C ++ V S   DC+    D +  E  RI LT  NG+    R  NP+ ++K + + 
Sbjct  94   FEEQICEVRTVSSPTGDCA----DHFDIEKARILLTHNNGVKAMARYANPLGFMKKESTT  149

Query  39   VCAEVFKEL  13
             C  V KEL
Sbjct  150  ECEAVLKEL  158



>ref|XP_008234009.1| PREDICTED: pollen-specific protein C13 [Prunus mume]
Length=159

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 71/132 (54%), Gaps = 3/132 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA F T     +PGA VRLEC +       Y+ +G TD+ G Y I   
Sbjct  27   FTVEGKVYCDTCRAGFETSATTYIPGATVRLECRDRKTMDIRYTKEGRTDSTGTYKIPVT  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED++C    V SS++DC+        ++  R+ LT  NG+    R  N + ++K++ 
Sbjct  87   EDHEDQFCDAVLVSSSQKDCAAA---APGRDRARVILTGYNGIASYNRFANAMGFMKNEA  143

Query  45   SAVCAEVFKELH  10
               CA++ K+L 
Sbjct  144  VPGCAQILKQLQ  155



>ref|XP_009408781.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 68/128 (53%), Gaps = 3/128 (2%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCD CRA F T+  E + GAKV+LEC N T G ST +    T+  G Y I    D
Sbjct  32   VEGRVYCDTCRAGFETKATEYIEGAKVKLECKNYTTGASTLTAVAVTNNKGTYQIPVSDD  91

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
            H++E C +  V S + DCSE I DG  +    + LT   G+    R  N + +LK  P A
Sbjct  92   HQEESCAVMLVSSPRSDCSE-ISDG--RNHAAVVLTHNVGITSSVRYANSLGFLKDVPLA  148

Query  39   VCAEVFKE  16
             C ++  +
Sbjct  149  SCGQMLMQ  156



>gb|KHG10520.1| Olee1-like protein [Gossypium arboreum]
Length=180

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 78/134 (58%), Gaps = 4/134 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGK-STYSVDGETDANGVYHITA  229
            F V G VYCD CR +F T++++ + GA V+LEC NIT+ K  ++S D  TD  G Y I  
Sbjct  32   FIVEGRVYCDTCRVEFETKISQPIKGASVKLECRNITNEKIVSHSQDVVTDEAGGYKIEV  91

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            +GDHEDE C +  VKS + DC+E   + W K   R+ LT  +G+    R  N + Y+K +
Sbjct  92   KGDHEDEICEVSLVKSPRADCNEPT-EVWRK--ARVVLTKADGVSGTYRFANNLGYMKKE  148

Query  48   PSAVCAEVFKELHY  7
                C +V  E+ Y
Sbjct  149  ALPECKKVLTEMGY  162



>emb|CDP06002.1| unnamed protein product [Coffea canephora]
Length=161

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 4/135 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F T +++ + GA+V L+C    +G  T S    TDANG Y ++ +
Sbjct  26   FTVKGRVYCDPCRVEFQTSLSKNIEGAEVELQCRVRENGTVTVSQKATTDANGNYELSVQ  85

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE+E C +  V S   +C+    +  A    RI LT  NG+    R  NP+ Y  ++ 
Sbjct  86   GDHEEEICEVASVSSPSLECNVPFGENKA----RILLTQNNGVQGTDRFANPLGYKTTEA  141

Query  45   SAVCAEVFKELHYIP  1
            +  C  + +E+ YIP
Sbjct  142  NPDCKPILQEMGYIP  156



>ref|XP_004975466.1| PREDICTED: pollen-specific protein C13-like [Setaria italica]
Length=163

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 70/130 (54%), Gaps = 3/130 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F T V E + GAKVRLEC +   G    ++DG TD +G Y I  +
Sbjct  29   FVIQGRVYCDTCRAGFQTNVTEYIKGAKVRLECKHFGTGAVERAIDGVTDESGFYTIKLK  88

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            G HE++ C +  ++S ++DC+E+       +   + L    G+    R  NP+ Y K  P
Sbjct  89   GGHEEDICEVILIESPRKDCAEVPAH---SDRASVLLAKDAGISDDMRFPNPLGYFKDVP  145

Query  45   SAVCAEVFKE  16
              VC  V KE
Sbjct  146  LPVCGAVLKE  155



>ref|XP_010942359.1| PREDICTED: major pollen allergen Lol p 11-like [Elaeis guineensis]
Length=174

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 3/133 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F +TG VYCD CRA F T +   MPGAKVRLEC      + TY  +  T  +G+Y +   
Sbjct  40   FVLTGRVYCDTCRAGFETDITSSMPGAKVRLECKRYGTDELTYEAEATTQLSGMYQMIVP  99

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH ++ C +  VKSS   C+EI      ++  RITL    G++  +R  N + +L  +P
Sbjct  100  DDHSNDQCSVVLVKSSFNKCTEIEP---GRDRVRITLAQDGGLLSNSRQANALGFLIDEP  156

Query  45   SAVCAEVFKELHY  7
               C ++ ++  +
Sbjct  157  LPSCGKLLQKYGF  169



>ref|XP_008226528.1| PREDICTED: olee1-like protein [Prunus mume]
Length=163

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 74/129 (57%), Gaps = 4/129 (3%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCD CR +F TR++  + GA V LEC    +G   Y++ G+TD NG+Y + A+ D
Sbjct  31   VEGRVYCDPCRVQFETRLSVPLEGAVVALECRGRENGTLAYTLQGKTDKNGIYSLPADED  90

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
             E++ C ++ V S + +C+    D +  E  R+ LT  NG+    R  NP+ ++++    
Sbjct  91   MEEQICEVRTVSSPRANCN----DHFDFERARVLLTHNNGVKSMARYANPLGFMQNASVT  146

Query  39   VCAEVFKEL  13
             C EV KEL
Sbjct  147  ECEEVLKEL  155



>gb|EPS72638.1| hypothetical protein M569_02120, partial [Genlisea aurea]
Length=161

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 73/130 (56%), Gaps = 4/130 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITD-GKSTYSVDGETDANGVYHITA  229
            F+V G VYCD CR +F+T ++ R+ GA VRL+CH   D G  TYSV+G+T  +G Y +  
Sbjct  35   FDVVGEVYCDPCRVQFMTELSRRLVGATVRLQCHRYNDTGCITYSVEGKTGFDGRYRLQV  94

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            +GDHE + C +K + S + DC+  + D      +RI  T   G+    R  NP+ ++   
Sbjct  95   KGDHESDLCFVKVIGSPRADCAVPMTDVVE---SRIVCTKNVGISSPVRYANPLGFMTRA  151

Query  48   PSAVCAEVFK  19
             +  C  V K
Sbjct  152  AAPRCLPVLK  161



>ref|XP_009340070.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 74/129 (57%), Gaps = 4/129 (3%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCD CR +F TR++  + GA V LEC +  +G   Y ++G+TD NG+Y + A+ +
Sbjct  34   VEGKVYCDPCRVQFETRLSTPLDGATVALECRSRENGTMVYRLEGKTDKNGIYSLPADKN  93

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
             E++ C ++ V S   DC+    D +  E  RI LT  NG+    R  NP+ ++K + + 
Sbjct  94   FEEQICEVRTVSSPTGDCA----DHFDIEKARILLTHNNGVKAMARYANPLGFMKKESTP  149

Query  39   VCAEVFKEL  13
             C  V KEL
Sbjct  150  ECEAVLKEL  158



>ref|XP_008775180.1| PREDICTED: pollen-specific protein C13-like [Phoenix dactylifera]
Length=168

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 72/130 (55%), Gaps = 3/130 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTY-SVDGETDANGVYHITA  229
            F V G VYCD CRA FV    E + GAKVRLEC +   G+  + S +  TD NG Y I  
Sbjct  30   FHVRGRVYCDTCRAGFVHEYTEYLEGAKVRLECKHYGSGEIAHRSEEAVTDGNGNYVIDI  89

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
              DH++E C +  V+S ++DC EI  D   +   R+ LT+ NG+  + R  NPI +L+  
Sbjct  90   TDDHQEETCEVVLVESPRDDCKEIPADHGIR--ARVMLTSNNGISSEWREANPIGFLRDA  147

Query  48   PSAVCAEVFK  19
            P   C  + +
Sbjct  148  PLPKCGAMLQ  157



>ref|XP_007225977.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
 gb|EMJ27176.1| hypothetical protein PRUPE_ppa012675mg [Prunus persica]
Length=159

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 72/132 (55%), Gaps = 3/132 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G V+CD CRA F T     +PGA VRLEC +       Y+ +G TD+ G Y I   
Sbjct  27   FTVEGKVFCDPCRAGFETSATTYIPGATVRLECRDRKTMDIRYTKEGRTDSTGTYKIPVT  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED++C    V SS++DC+        ++  R+ LT  NG+    R  N + ++K++ 
Sbjct  87   EDHEDQFCDAVLVSSSQKDCAAA---APGRDRARVILTGYNGIASYNRFANAMGFMKNEA  143

Query  45   SAVCAEVFKELH  10
             + CA++ K+L 
Sbjct  144  VSGCAQILKQLQ  155



>ref|XP_011101376.1| PREDICTED: pollen allergen Che a 1-like isoform X1 [Sesamum indicum]
Length=171

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 78/138 (57%), Gaps = 3/138 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKS-TYSVDG-ETDANGVYHIT  232
            F V G VYCD CRA FVT+ ++RMPGA+V+L C +  D  + T+ + G  TD  G Y I 
Sbjct  28   FIVRGDVYCDYCRATFVTQFSKRMPGAEVKLVCRDDFDKDNITFRMTGIVTDDKGEYTIE  87

Query  231  AEGDHEDEYCGIKPVKSSKEDCSEIIKDGWA-KEFTRITLTTKNGMVKKTRNVNPILYLK  55
             E DH+ E C +  VKSS  DC+EI+KDG   K    + LT  N    K RN + + +  
Sbjct  88   VEDDHKGETCEVTLVKSSMHDCAEIVKDGLGRKPAADVVLTNTNFYHGKFRNASSLTFSP  147

Query  54   SKPSAVCAEVFKELHYIP  1
             K +  C E+ KE+   P
Sbjct  148  KKRAPECIELKKEIEEDP  165



>ref|XP_002307393.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
 gb|ABK95954.1| unknown [Populus trichocarpa]
 gb|EEE94389.1| pollen Ole e 1 allergen and extensin family protein [Populus 
trichocarpa]
Length=159

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 70/129 (54%), Gaps = 3/129 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G+VYCD C A F T     + GAKVRLEC +       YS +G TD+ G Y IT +
Sbjct  27   FVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTGKYTITVD  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED+ C    V S ++DC         ++  R+ LT  NG+V  TR  N + ++ ++P
Sbjct  87   EDHEDQICDCMLVSSPRKDCRS---PSAGRDRARVILTNDNGLVSTTRYANAMGFMAAQP  143

Query  45   SAVCAEVFK  19
             + C E+ +
Sbjct  144  MSGCTELLR  152



>gb|EAY93952.1| hypothetical protein OsI_15725 [Oryza sativa Indica Group]
Length=165

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + V G VYCD CRA F T V E + GAKVRLEC +    K   ++DG TD  G Y I  +
Sbjct  30   YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
              HE++ C +  V S   +CSEI  +   ++  R+ LT   G+    R  NP+ YLK  P
Sbjct  90   DSHEEDICEVVLVHSPLANCSEIEAE---RDRARVLLTRNVGICDNLRLANPLGYLKDIP  146

Query  45   SAVCAEVFKEL  13
              VC  + K+ 
Sbjct  147  LPVCGALLKQF  157



>ref|XP_002890794.1| hypothetical protein ARALYDRAFT_336019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67053.1| hypothetical protein ARALYDRAFT_336019 [Arabidopsis lyrata subsp. 
lyrata]
Length=621

 Score =   100 bits (248),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/123 (37%), Positives = 74/123 (60%), Gaps = 1/123 (1%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G+VYCD CR +F+TR+++ + GAKV+LEC    +   T + +  TD  G Y +   
Sbjct  32   FHIKGSVYCDTCRVQFITRLSKFLEGAKVKLECKGRENQTVTLTKEAVTDNAGNYQMEVM  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMV-KKTRNVNPILYLKSK  49
            GDHE+E C I  V+S   +C E+    + +   RI+LT  +G+V  +TR +NP+ +++  
Sbjct  92   GDHEEEVCEIVLVQSPDAECGEVNNQEFLRNAARISLTANDGIVSNETRTINPLGFMRKT  151

Query  48   PSA  40
            P A
Sbjct  152  PLA  154



>ref|XP_009334049.1| PREDICTED: olee1-like protein [Pyrus x bretschneideri]
Length=166

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 75/129 (58%), Gaps = 4/129 (3%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCD CR +F TR++  + GA V LEC +  +G   Y V+G+TD NG+Y +    +
Sbjct  34   VEGKVYCDPCRVQFETRLSTPIDGATVALECRSRENGTIVYVVEGKTDKNGIYSLATHKE  93

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
             E++ C ++ V+S  ++C+    D +  E  RI LT  NG+    R  NP+ ++K + ++
Sbjct  94   FEEQICEVRTVRSPTDECA----DHFDIERARILLTHNNGVNALARYANPLGFMKKESTS  149

Query  39   VCAEVFKEL  13
             C  V KEL
Sbjct  150  ECEAVLKEL  158



>emb|CAH66537.1| H0209H04.4 [Oryza sativa Indica Group]
 gb|AFI71825.1| pollen specific protein [Oryza sativa]
Length=165

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + V G VYCD CRA F T V E + GAKVRLEC +    K   ++DG TD  G Y I  +
Sbjct  30   YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
              HE++ C +  V S   +CSEI  +   ++  R+ LT   G+    R  NP+ YLK  P
Sbjct  90   DSHEEDICEVVLVHSPLANCSEIEAE---RDRARVLLTRNVGICDNLRLANPLGYLKDIP  146

Query  45   SAVCAEVFKEL  13
              VC  + K+ 
Sbjct  147  LPVCGALLKQF  157



>ref|XP_011102257.1| PREDICTED: olee1-like protein [Sesamum indicum]
Length=171

 Score = 95.1 bits (235),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 78/138 (57%), Gaps = 3/138 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKS-TYSVDG-ETDANGVYHIT  232
            F V G VYCD CRA FVT+ ++RMPGA+V+L C +  D  + T  + G  TD  G Y I 
Sbjct  28   FIVRGDVYCDYCRATFVTQFSKRMPGAEVKLVCRDDFDKDNVTLRMTGIVTDDKGEYTID  87

Query  231  AEGDHEDEYCGIKPVKSSKEDCSEIIKDGWA-KEFTRITLTTKNGMVKKTRNVNPILYLK  55
             E DH+ E C +  VKSS  DC+EI+KDG   K    + LTT +    K RN + + +  
Sbjct  88   VEDDHKSETCEVTLVKSSMHDCAEIVKDGLGRKSAADVVLTTTDYYNDKFRNSSSLTFSP  147

Query  54   SKPSAVCAEVFKELHYIP  1
             K +  C E+ KE+   P
Sbjct  148  KKRAPECIELKKEIEEDP  165



>ref|XP_008376286.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008343323.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_008353938.1| PREDICTED: pollen-specific protein C13-like [Malus domestica]
 ref|XP_009369651.1| PREDICTED: pollen-specific protein C13-like [Pyrus x bretschneideri]
Length=159

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 73/132 (55%), Gaps = 3/132 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA + T+    + GAKVRLEC + +     Y+ +G TD+ G Y I   
Sbjct  27   FTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKSSMALVYTKEGTTDSAGCYKIPVA  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH D++C    V S ++DC+ +      +E  R+ LT  NG+   TR  N + +++++ 
Sbjct  87   EDHLDQFCDAVLVSSPQKDCATV---SPGRERARVILTGYNGIASYTRFANAMGFMRTEA  143

Query  45   SAVCAEVFKELH  10
             + C ++ KEL 
Sbjct  144  LSGCTQILKELQ  155



>ref|XP_002513885.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
 gb|EEF48468.1| Pollen-specific protein C13 precursor, putative [Ricinus communis]
Length=159

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 70/130 (54%), Gaps = 3/130 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            FEV G VYCD CRA F T     + GAKVR+EC +    +  YS +G TD+ G Y I  +
Sbjct  27   FEVEGRVYCDTCRAGFETSKTTYVAGAKVRVECKDRKTMELVYSKEGTTDSTGTYRIHVD  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH+D+ C    V S + DC   +K    ++  R+ LT  NG+V   R  N I ++K   
Sbjct  87   EDHQDQLCDAMLVSSPQHDC---MKPSSGRDRARVILTNNNGIVSNKRYANSIGFMKEDA  143

Query  45   SAVCAEVFKE  16
             + C E+ ++
Sbjct  144  MSGCFELLRQ  153



>ref|NP_001052674.1| Os04g0398700 [Oryza sativa Japonica Group]
 emb|CAE05158.2| OSJNBa0039C07.14 [Oryza sativa Japonica Group]
 dbj|BAF14588.1| Os04g0398700 [Oryza sativa Japonica Group]
 gb|EAZ30594.1| hypothetical protein OsJ_14643 [Oryza sativa Japonica Group]
Length=165

 Score = 94.7 bits (234),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + V G VYCD CRA F T V E + GAKVRLEC +    K   ++DG TD  G Y I  +
Sbjct  30   YVVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKHFGTDKVERAIDGVTDETGTYKIELK  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
              HE++ C +  V S   +CSEI  +   ++  R+ LT   G+    R  NP+ YLK  P
Sbjct  90   DSHEEDICEVVLVHSPLANCSEIEAE---RDRARVLLTRNVGICDNLRLANPLGYLKDIP  146

Query  45   SAVCAEVFKEL  13
              +C  + K+ 
Sbjct  147  LPICGALLKQF  157



>ref|XP_008378536.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=218

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 72/132 (55%), Gaps = 3/132 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA + T+    + GAKVRLEC + T     Y+ +G TD+ G Y I   
Sbjct  86   FTVEGKVYCDTCRAGYETKAITYIAGAKVRLECRDKTSMALLYTKEGTTDSAGCYKIPVA  145

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH D++C    V S ++DC+ +      +E  R+ LT  NG+    R  N + +++++ 
Sbjct  146  EDHLDQFCDAVLVSSPQKDCATV---SPGRERARVILTANNGIASYNRFANAMGFMRTEA  202

Query  45   SAVCAEVFKELH  10
             + C ++ KEL 
Sbjct  203  LSGCTQILKELQ  214



>ref|XP_003566418.1| PREDICTED: major pollen allergen Lol p 11-like [Brachypodium 
distachyon]
Length=169

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 75/130 (58%), Gaps = 4/130 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F VTG VYCD CRA F T  +  +PGA V++EC +    +  +  +  TDA G Y +   
Sbjct  31   FLVTGRVYCDTCRAGFETNASHSIPGAVVQMECRHFETNELHHKAEATTDAQGWYKMEVG  90

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKK-TRNVNPILYLKSK  49
             DH++E C +  ++S ++DC+EI K   +++  R+ LT  NG+ +   R  NPI + + +
Sbjct  91   EDHQEEICEVALLRSPEKDCAEIEK---SRDRCRVPLTRNNGIKQSGVRYANPIAFFRKE  147

Query  48   PSAVCAEVFK  19
            P A C +V +
Sbjct  148  PLANCGDVLR  157



>ref|XP_011101377.1| PREDICTED: olee1-like protein isoform X2 [Sesamum indicum]
 ref|XP_011101378.1| PREDICTED: olee1-like protein isoform X3 [Sesamum indicum]
Length=171

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 77/138 (56%), Gaps = 3/138 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKS-TYSVDG-ETDANGVYHIT  232
            F V G VYCD CRA FVT+ ++RMPGA+V+L C +  D  + T  + G  TD  G Y I 
Sbjct  28   FIVRGDVYCDYCRATFVTQFSKRMPGAEVKLVCRDDFDKDNVTLRMTGIVTDDKGEYTID  87

Query  231  AEGDHEDEYCGIKPVKSSKEDCSEIIKDGWA-KEFTRITLTTKNGMVKKTRNVNPILYLK  55
             E DH  E C +  VKSS  DC+EI+KDG   K    + LTT +    K RN + + +  
Sbjct  88   VEDDHNSETCEVTLVKSSMHDCAEIVKDGLGRKPAADVILTTTDYYHDKFRNASSLTFSP  147

Query  54   SKPSAVCAEVFKELHYIP  1
             K +  C E+ KE+   P
Sbjct  148  KKRAPECIELKKEIEEDP  165



>ref|XP_011006159.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011016058.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
Length=159

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 70/129 (54%), Gaps = 3/129 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G+VYCD C A F T     + GAKVRLEC +       YS +G TD+ G Y IT +
Sbjct  27   FVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTGKYTITVD  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH+D+ C    V S ++DC         ++  R+ LT  NG+V  TR VN + ++ + P
Sbjct  87   EDHKDQICDCMLVSSPRKDCRS---PSAGRDRARVILTNNNGLVSTTRYVNAMGFMAAHP  143

Query  45   SAVCAEVFK  19
             + C E+ +
Sbjct  144  MSGCTELLR  152



>gb|KDP46869.1| hypothetical protein JCGZ_24078 [Jatropha curcas]
Length=159

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 73/131 (56%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR  F T     +PGAKVR+EC +  + +  YS++G+TD+ G Y I  +
Sbjct  27   FFVHGRVYCDTCRCGFETNKTTYIPGAKVRIECLDRVNSQLKYSIEGKTDSTGTYRIKVK  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH+D++C    V S + +C +    G ++    + LT  NG V      N + Y + +P
Sbjct  87   DDHQDQFCYAVLVSSPQANC-KTADPGRSR--AEVILTRSNGAVSDLHFANSMGYFRYQP  143

Query  45   SAVCAEVFKEL  13
             + CAE+ KEL
Sbjct  144  MSGCAELVKEL  154



>ref|XP_008348540.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Malus domestica]
Length=162

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 70/130 (54%), Gaps = 3/130 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR  F T     +PGA+VR+EC +    +  YSV+GETD+ G Y+I  E
Sbjct  28   FHVQGRVYCDTCRCGFETTATNYIPGARVRIECKDRNTLQLAYSVEGETDSTGTYNILVE  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED+ C    V S   DC         +    + +T  NG+VK  R  N + + K++P
Sbjct  88   EDHEDQICESVLVSSPISDCKSA---DPGRSRANVVVTRYNGVVKDKRYANNMGFFKNEP  144

Query  45   SAVCAEVFKE  16
             A C ++ ++
Sbjct  145  LAGCEKILEQ  154



>ref|XP_008797140.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
 ref|XP_008797142.1| PREDICTED: major pollen allergen Lol p 11-like [Phoenix dactylifera]
Length=174

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = -3

Query  393  GTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGDHE  214
            G VYCD CRA F T +   +PGAKVRLEC      + TY+ +  TD  G+Y I   GDH 
Sbjct  44   GHVYCDTCRAGFETDLTAYIPGAKVRLECTRYGTDEVTYAAEATTDLLGIYQIVVPGDHS  103

Query  213  DEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSAVC  34
            ++ C +  +KS+ ++C+E IK G  ++  R+ L    G++   R  N + +L ++P A C
Sbjct  104  EDQCSVVLMKSAVDNCTE-IKPG--RDRARVVLAQDGGLLSNVRRANALGFLIAEPLAEC  160

Query  33   AEVFKELHY  7
             ++ ++  +
Sbjct  161  GKLLQKYGF  169



>ref|XP_007018845.1| Pollen-specific protein C13, putative [Theobroma cacao]
 gb|EOY16070.1| Pollen-specific protein C13, putative [Theobroma cacao]
Length=159

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 69/127 (54%), Gaps = 3/127 (2%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCD CRA F T     M GAKV++EC +   G+  Y  +G TD+ G Y +    D
Sbjct  29   VQGQVYCDRCRAGFETPKTRNMAGAKVKVECSDRKTGQVVYKKEGYTDSTGHYKVVVSED  88

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
            H DE C    VKSS+ DC+++      +E  R+ LT  NG+   TR  N + ++  +  A
Sbjct  89   HLDEICDAILVKSSQPDCAKM---SPGRERARVILTNFNGIASNTRFANAMGFMADEADA  145

Query  39   VCAEVFK  19
             CAE+ K
Sbjct  146  GCAEIMK  152



>gb|ADI55168.1| AS1 [Gossypium hirsutum]
Length=182

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 76/135 (56%), Gaps = 4/135 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDAN-GVYHITA  229
            FEV G VYCD CR +F T ++E +PGA VRLEC N TD K TY     T  + G Y I  
Sbjct  40   FEVLGHVYCDTCRVEFETSISEPIPGATVRLECRNRTDEKITYQSPEITAGDKGNYKIQV  99

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
             GD+E+  C +  VKS + DC++  ++ W K   R+ LTT +G+  + R  N + + K +
Sbjct  100  TGDYEESDCDVMLVKSPRADCNDPTEE-WRK--ARVVLTTLDGVSGEIRFANNLGFKKKE  156

Query  48   PSAVCAEVFKELHYI  4
                C +V  E+ Y 
Sbjct  157  ALPECTKVLTEMGYF  171



>ref|XP_007213539.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
 gb|EMJ14738.1| hypothetical protein PRUPE_ppa019680mg [Prunus persica]
Length=163

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 73/129 (57%), Gaps = 4/129 (3%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCD CR +F TR++  + GA V LEC    +G   Y++ G+TD NG+Y +  + D
Sbjct  31   VEGRVYCDPCRVQFETRLSVPLEGAVVALECRGRENGTLAYTLQGKTDKNGIYSLPTDED  90

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
             E++ C ++ V S + +C+E     +  E  R+ LT  NG+    R  NP+ +++ +   
Sbjct  91   MEEQICEVRTVSSPRANCNE----HFEFERARVLLTYNNGVKSMARYANPLGFMQKESVT  146

Query  39   VCAEVFKEL  13
             C +V KEL
Sbjct  147  ECEQVLKEL  155



>ref|XP_011016068.1| PREDICTED: pollen-specific protein C13-like [Populus euphratica]
 ref|XP_011027685.1| PREDICTED: pollen-specific protein C13 isoform X1 [Populus euphratica]
 ref|XP_011027686.1| PREDICTED: pollen-specific protein C13 isoform X2 [Populus euphratica]
Length=159

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 70/129 (54%), Gaps = 3/129 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD C A F T     + G+KV++EC +       YS +G TD+ G Y IT +
Sbjct  27   FSVQGRVYCDTCHAGFETPKTTYIAGSKVKVECRDRKTQDLVYSKEGTTDSTGTYIITVD  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH+D+ C    V S ++DCS        +E  R+ LT  NG+V  TR  N + ++ ++P
Sbjct  87   EDHKDQICDAMLVSSPRQDCSS---PSAGRERARVILTNYNGLVSTTRYANSMGFMAAQP  143

Query  45   SAVCAEVFK  19
             + C E+ +
Sbjct  144  MSGCTELLR  152



>ref|XP_009396935.1| PREDICTED: pollen-specific protein C13-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 3/128 (2%)
 Frame = -3

Query  399  VTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAEGD  220
            V G VYCD CRA F T   E + GAKV+LEC N T G+  ++    TDA G Y IT   D
Sbjct  32   VEGRVYCDTCRAGFETTATEYIAGAKVKLECKNYTTGEIIHTNQATTDATGKYQITVVDD  91

Query  219  HEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKPSA  40
            H++E C +  + S + DCSEI +    +    + +T   G+    R  N + +LK KP  
Sbjct  92   HQEETCQVTLISSPRSDCSEISE---GRNSALVVVTHNVGITSGVRYANSLGFLKEKPLE  148

Query  39   VCAEVFKE  16
             C ++  +
Sbjct  149  TCGQLLLQ  156



>ref|XP_007206364.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
 gb|EMJ07563.1| hypothetical protein PRUPE_ppa017800mg [Prunus persica]
Length=160

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 70/134 (52%), Gaps = 4/134 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CR  F T     +PGA VR+EC      +  YSV+GETDA G Y+I  E
Sbjct  26   FHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDATGTYNILVE  85

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED+ C    V S   DC         ++   + +T  NG+VK     N + + K +P
Sbjct  86   DDHEDQICESVLVSSPVNDCKSA---DPGRKRANVVVTRYNGVVKDKHYANNMGFFKDQP  142

Query  45   SAVCAEVFKE-LHY  7
             A C E+ K+ L+Y
Sbjct  143  LAGCEELLKQYLNY  156



>gb|EYU31033.1| hypothetical protein MIMGU_mgv1a015328mg [Erythranthe guttata]
Length=161

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 71/134 (53%), Gaps = 3/134 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR  F T V + MP AKVR+EC +    K TY+ +  TD +G Y    +
Sbjct  29   FLVKGCVYCDSCRCGFETDVTKYMPSAKVRIECRDRDSAKLTYTQEAVTDESGCYSAVVQ  88

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             D  +++C    VKSS ++CS        ++  R+ LT  NGM    R  N + +LK+ P
Sbjct  89   SDRGEDFCDAVLVKSSDDECS---VPNAGRDRARVILTRNNGMTDNVRYANNMGFLKNIP  145

Query  45   SAVCAEVFKELHYI  4
             + CA++  +   I
Sbjct  146  LSNCAQILHKYQII  159



>ref|XP_009764546.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Nicotiana sylvestris]
Length=161

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 72/132 (55%), Gaps = 3/132 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G  YCD CR  F T   + + GAKVR+EC +     STY+V+G T++ G Y+I   
Sbjct  27   FLVKGKAYCDTCRCGFETPATKYLAGAKVRIECRHRVIEASTYTVEGVTNSKGEYNILVN  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             D  D+ C +  VKS    C+   K    ++ +R+ LT  NGM+  TR  N + +L+ +P
Sbjct  87   SDRGDDACDVILVKSPDRTCT---KPNAGRDRSRVILTRNNGMISNTRFANAMGFLRDEP  143

Query  45   SAVCAEVFKELH  10
             + C ++ ++  
Sbjct  144  LSSCTQILQQYQ  155



>gb|ABC86745.1| pollen-specific protein [Vitis pseudoreticulata]
Length=159

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 69/130 (53%), Gaps = 3/130 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CRA F T     + GAKVR+EC +    +  YS++G TD+ G Y I   
Sbjct  27   FVLQGRVYCDTCRAGFETSATTYIAGAKVRVECKDRNSMQLLYSIEGITDSTGTYKIMVT  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED+ C    V S + DC+ +      ++   + LT  NG+V   R  N + +LK  P
Sbjct  87   EDHEDQLCDAVLVSSPQSDCASV---DPGRDRAAVILTRYNGIVSDNRYANSMGFLKDHP  143

Query  45   SAVCAEVFKE  16
             + C ++ ++
Sbjct  144  MSECTQLLQQ  153



>ref|XP_011090511.1| PREDICTED: major pollen allergen Lol p 11-like [Sesamum indicum]
Length=159

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 71/132 (54%), Gaps = 3/132 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F VTG+VYCD CR  + T     + GA VR+EC N  +G+ TY+ +  TD+ G Y +  E
Sbjct  27   FHVTGSVYCDTCRCGYETDATTYIAGATVRIECRNKDNGQLTYTKEAVTDSTGHYSVLVE  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             D  D++C    VKS+  +CS        ++  R+ LT  NGM+   R  N + +LK+ P
Sbjct  87   TDRGDDFCDAVLVKSADPECS---TPNEGRDRARVILTRNNGMISNKRFANAMGFLKNTP  143

Query  45   SAVCAEVFKELH  10
             A C  + ++  
Sbjct  144  LANCPMILQKYQ  155



>ref|XP_011098227.1| PREDICTED: anther-specific protein LAT52-like [Sesamum indicum]
Length=163

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 73/131 (56%), Gaps = 3/131 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR +F T ++  + GA VR+EC +I   K T+S++G T ++G Y I   
Sbjct  28   FYVEGDVYCDPCRVQFETELSYHIAGAMVRVECRDIETKKITFSMEGVTGSDGHYSIMVT  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
            GDHE + C + P +S K +CSE + D    E  ++  T  +G+    R  NP+ ++  K 
Sbjct  88   GDHEKDICEVIPTRSPKNECSEPMGD---YERAKVECTENSGLHNTIRYANPVGFMTPKV  144

Query  45   SAVCAEVFKEL  13
               CA +  +L
Sbjct  145  LPECAPILADL  155



>dbj|BAK06698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=167

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 68/129 (53%), Gaps = 3/129 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + V G VYCD CRA F T V E + GAKVRLEC      K   S+DG TD +G Y I  +
Sbjct  32   YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECRRFGTDKLERSIDGVTDESGTYKIELK  91

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
              H ++ C +  V+S   +C+EI      +    I L+   G+    R  NP+ YLK KP
Sbjct  92   DSHPEDICEMVLVQSPLPNCNEI---QALRNRAEIVLSRNVGISDNIRLANPLGYLKDKP  148

Query  45   SAVCAEVFK  19
              VC ++ K
Sbjct  149  LPVCPDLLK  157



>ref|XP_008234688.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Prunus mume]
Length=162

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/134 (39%), Positives = 69/134 (51%), Gaps = 4/134 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F + G VYCD CR  F T     +PGA VR+EC      +  YSV+GETDA G Y+I  E
Sbjct  28   FHIQGRVYCDTCRCGFETTATTYIPGATVRIECKYRNTLQLAYSVEGETDATGTYNILVE  87

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED+ C    V S   DC         +    + +T  NG+VK     N + + K +P
Sbjct  88   DDHEDQICESVLVSSPVNDCKSA---DPRRNRANVVVTRYNGIVKDKHYANNMGFFKDQP  144

Query  45   SAVCAEVFKE-LHY  7
             A C E+ K+ L+Y
Sbjct  145  LAGCEELLKQYLNY  158



>ref|XP_010538956.1| PREDICTED: major pollen allergen Lol p 11 [Tarenaya hassleriana]
Length=159

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 72/130 (55%), Gaps = 3/130 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CRA F T  +  +PGA V+LEC +    +  YS +  TD+ G Y I   
Sbjct  27   FVVRGRVYCDTCRAGFETPASTYIPGAVVKLECKDRRSMELVYSHEARTDSTGAYKIWVN  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED+ C I  VKS +  CS++      +E  R+TLT  NG+    R VN + + + + 
Sbjct  87   EDHEDQLCDIMLVKSPQLGCSKV---SHGRERARVTLTRYNGIASDDRYVNNMGFERDEA  143

Query  45   SAVCAEVFKE  16
             + C+E+ ++
Sbjct  144  LSGCSEIMRQ  153



>gb|KHG13789.1| Anther-specific LAT52 [Gossypium arboreum]
Length=188

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 78/134 (58%), Gaps = 4/134 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTY-SVDGETDANGVYHITA  229
            + V G VYCD CR +F T+++E + GA V+LEC N T+   T+ S +   D++G YHI  
Sbjct  33   YMVVGHVYCDTCRVEFETKLSEPISGAVVKLECRNRTNEAITFQSSEIVADSHGDYHIIV  92

Query  228  EGDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSK  49
            EGD+E+  C +  V+S + DCS+   + W K  +R+ LTT +G+  K R  N + + K  
Sbjct  93   EGDYEESDCDVALVRSPRADCSD-PTEAWRK--SRVVLTTFDGLSNKLRFANNLGFKKDI  149

Query  48   PSAVCAEVFKELHY  7
                C  + KE+ Y
Sbjct  150  ALPQCTRILKEMGY  163



>ref|XP_010436385.1| PREDICTED: protein DOWNSTREAM OF FLC-like [Camelina sativa]
Length=159

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 68/129 (53%), Gaps = 3/129 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD C A F T  +  +PGA VRLEC +    + TYS +  TD+ G Y I   
Sbjct  27   FVVRGRVYCDTCLAGFETSASTYIPGAVVRLECKDRRTMELTYSHEARTDSTGSYKILVN  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DH+D++C    V SS+  CS +       +  R+TLT  NG+    R  N + +L+  P
Sbjct  87   EDHDDQFCDATLVSSSQLRCSTL---SPGHDRARVTLTRFNGIASDERFANTMGFLRDAP  143

Query  45   SAVCAEVFK  19
               CAE+ K
Sbjct  144  MPGCAEIMK  152



>ref|XP_009134109.1| PREDICTED: pollen-specific protein C13 [Brassica rapa]
Length=159

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 68/130 (52%), Gaps = 3/130 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD C A F T  +  +PGA VRLEC +    + TY  +  TD+ G Y I   
Sbjct  27   FVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRRTMELTYRHEARTDSTGSYRILVS  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED++C    V SS+  CS +       +  R+TLT  NG+    R  N + +L+   
Sbjct  87   EDHEDQFCDTMLVSSSQLRCSNV---SPGHDRARVTLTRFNGIASDERFANNLGFLRDAA  143

Query  45   SAVCAEVFKE  16
            S  CAE+ K+
Sbjct  144  SPGCAEIMKQ  153



>ref|XP_009600627.1| PREDICTED: major pollen allergen Lol p 11-like [Nicotiana tomentosiformis]
Length=162

 Score = 92.0 bits (227),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 71/132 (54%), Gaps = 3/132 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD CR  F T  ++ + G++VR+EC N      +Y+++G T++ G Y I   
Sbjct  27   FLVVGKVYCDTCRCGFETSASKYLAGSRVRIECKNRDTNDISYTIEGVTNSKGEYKILVY  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             D  DE C +  ++SS   C+        ++  R+ LT  NGMV  TR  N I +L ++P
Sbjct  87   SDRGDEVCDVVLIRSSDPMCA---VPNAGRDRARVVLTRNNGMVSNTRFANSIGFLSNEP  143

Query  45   SAVCAEVFKELH  10
             A C ++ ++  
Sbjct  144  LASCNQILQQYQ  155



>gb|AEW90946.1| pollen-specific protein F8-4 [Secale cereale x Triticum turgidum 
subsp. durum]
 gb|AEW90947.1| pollen-specific protein F8-5 [Secale cereale x Triticum turgidum 
subsp. durum]
Length=165

 Score = 92.0 bits (227),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 69/132 (52%), Gaps = 3/132 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            + V G VYCD CRA F T V E + GAKVRLEC      K   S+DG TD  G Y I  +
Sbjct  30   YIVQGRVYCDTCRAGFETNVTEYIKGAKVRLECKRFGTEKVERSIDGVTDETGTYKIELK  89

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
              H ++ C +  V+S   +C+EI      ++   I L+   G+    R  NP+ YLK KP
Sbjct  90   DSHPEDICEMVLVQSPLANCNEIQD---LRDRAEIVLSRNVGISDNIRMANPLGYLKDKP  146

Query  45   SAVCAEVFKELH  10
              VC ++ K  +
Sbjct  147  LPVCPDLLKTFN  158



>ref|NP_001057857.1| Os06g0556600 [Oryza sativa Japonica Group]
 dbj|BAD53560.1| putative pollen allergen Phl p 11 [Oryza sativa Japonica Group]
 dbj|BAD54134.1| putative pollen allergen Phl p 11 [Oryza sativa Japonica Group]
 dbj|BAF19771.1| Os06g0556600 [Oryza sativa Japonica Group]
 gb|EAZ01328.1| hypothetical protein OsI_23359 [Oryza sativa Indica Group]
 gb|EAZ37341.1| hypothetical protein OsJ_21682 [Oryza sativa Japonica Group]
 dbj|BAG93005.1| unnamed protein product [Oryza sativa Japonica Group]
Length=175

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 74/131 (56%), Gaps = 4/131 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F VTG VYCD CRA F T V++ +PGA V +EC +   G+ +   +  TD  G Y +  +
Sbjct  38   FVVTGRVYCDPCRAGFETNVSKSIPGATVSVECRHYGAGRESLKAEATTDEKGWYKVEID  97

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKK-TRNVNPILYLKSK  49
             DH++E C +   KSS   CSE  K    ++ +R+ LT+ NG+ +   R  NPI + + +
Sbjct  98   QDHQEEICEVVLDKSSDPACSETEK---TRDRSRVPLTSNNGLKQNGIRYANPIAFFRKE  154

Query  48   PSAVCAEVFKE  16
            P A C  + ++
Sbjct  155  PLADCGSILQK  165



>emb|CDY05022.1| BnaC03g28200D [Brassica napus]
Length=159

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 68/134 (51%), Gaps = 3/134 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD C A F T  +  +PGA VRLEC +    + TY  +  TD+ G Y I   
Sbjct  27   FVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRRTMELTYRHEARTDSTGSYKILVS  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED++C    V SS+  CS +          R+TLT  NG+    R  N + +L+   
Sbjct  87   EDHEDQFCDTMLVSSSQLRCSNV---SPGHNRARVTLTRFNGIASDERFANNLGFLRDAA  143

Query  45   SAVCAEVFKELHYI  4
            S  CAE+ K+   I
Sbjct  144  SPGCAEIMKQYQEI  157



>emb|CDY12288.1| BnaA09g24880D [Brassica napus]
 emb|CDX90693.1| BnaA03g23730D [Brassica napus]
Length=159

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 68/130 (52%), Gaps = 3/130 (2%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F V G VYCD C A F T  +  +PGA VRLEC +    + TY  +  TD+ G Y I   
Sbjct  27   FVVRGRVYCDTCLAGFETSASTFIPGAVVRLECKDRRTMELTYRHEARTDSTGSYKILVS  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKKTRNVNPILYLKSKP  46
             DHED++C    V SS+  CS +       +  R+TLT  NG+    R  N + +L+   
Sbjct  87   EDHEDQFCDTMLVSSSQLRCSNV---SPGHDRARVTLTRFNGIASDERFANNLGFLRDAA  143

Query  45   SAVCAEVFKE  16
            S  CAE+ K+
Sbjct  144  SPGCAEIMKQ  153



>ref|NP_001150330.1| pollen allergen Phl p 11 precursor [Zea mays]
 gb|ACG38668.1| pollen allergen Phl p 11 [Zea mays]
Length=165

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 72/130 (55%), Gaps = 4/130 (3%)
 Frame = -3

Query  405  FEVTGTVYCDVCRAKFVTRVAERMPGAKVRLECHNITDGKSTYSVDGETDANGVYHITAE  226
            F VTG VYCD CRA F T V+  + GA V +EC +    +     +  TDA G Y +   
Sbjct  27   FVVTGRVYCDNCRAGFETNVSHAIEGATVEMECRHFESQEVHDKAEATTDAGGWYRMEIS  86

Query  225  GDHEDEYCGIKPVKSSKEDCSEIIKDGWAKEFTRITLTTKNGMVKK-TRNVNPILYLKSK  49
            GDH+DE C +  +KS + DC+EI +    +E  R+ LT  +G+ +   R  NPI + + +
Sbjct  87   GDHQDEICEVLLLKSPEADCAEIER---TRERCRVPLTRNDGIRQSGIRYANPIAFFRKE  143

Query  48   PSAVCAEVFK  19
            P + C E+ +
Sbjct  144  PLSNCGELLR  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644683884684