BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c100245_g1_i1 len=339 path=[317:0-338]

Length=339
                                                                      Score     E

ref|XP_006374213.1|  homeobox-leucine zipper family protein           66.2    5e-10   
ref|XP_009110376.1|  PREDICTED: homeobox-leucine zipper protein H...  64.3    2e-09   
ref|XP_009778533.1|  PREDICTED: homeobox-leucine zipper protein H...  64.3    2e-09   
emb|CDX96744.1|  BnaA08g22870D                                        64.3    2e-09   
ref|XP_009110377.1|  PREDICTED: homeobox-leucine zipper protein H...  64.3    2e-09   
emb|CDY26204.1|  BnaA06g12130D                                        64.3    2e-09   
emb|CDX83884.1|  BnaC08g17610D                                        64.3    2e-09   
ref|XP_006416656.1|  hypothetical protein EUTSA_v10006969mg           63.2    5e-09   
ref|XP_009355964.1|  PREDICTED: homeobox-leucine zipper protein H...  63.2    5e-09   
ref|XP_009355965.1|  PREDICTED: homeobox-leucine zipper protein H...  63.2    5e-09   
ref|XP_011072039.1|  PREDICTED: homeobox-leucine zipper protein H...  63.2    6e-09   
ref|XP_010069492.1|  PREDICTED: homeobox-leucine zipper protein H...  62.8    6e-09   
ref|XP_006478112.1|  PREDICTED: homeobox-leucine zipper protein H...  62.8    6e-09   
ref|XP_007010890.1|  Homeobox-leucine zipper protein HDG11            62.8    7e-09   
ref|XP_006364383.1|  PREDICTED: homeobox-leucine zipper protein H...  62.8    7e-09   
gb|KDO46401.1|  hypothetical protein CISIN_1g006760mg                 62.8    7e-09   
ref|XP_004235382.1|  PREDICTED: homeobox-leucine zipper protein H...  62.8    7e-09   
ref|XP_009606250.1|  PREDICTED: homeobox-leucine zipper protein H...  62.8    7e-09   
ref|XP_004299483.1|  PREDICTED: homeobox-leucine zipper protein H...  62.8    7e-09   
ref|XP_006441353.1|  hypothetical protein CICLE_v10019153mg           62.8    7e-09   
ref|XP_011086973.1|  PREDICTED: homeobox-leucine zipper protein H...  62.8    7e-09   
ref|XP_007210460.1|  hypothetical protein PRUPE_ppa015345m1g          62.0    8e-09   
ref|XP_006374212.1|  hypothetical protein POPTR_0015s05050g           62.4    9e-09   
ref|XP_009587298.1|  PREDICTED: homeobox-leucine zipper protein H...  62.4    9e-09   
ref|XP_011035552.1|  PREDICTED: homeobox-leucine zipper protein H...  62.4    9e-09   
ref|XP_009786509.1|  PREDICTED: homeobox-leucine zipper protein H...  62.4    1e-08   
ref|XP_007152598.1|  hypothetical protein PHAVU_004G143500g           62.4    1e-08   
ref|XP_010663934.1|  PREDICTED: homeobox-leucine zipper protein H...  62.4    1e-08   
ref|XP_004515249.1|  PREDICTED: homeobox-leucine zipper protein H...  62.4    1e-08   
ref|XP_002271012.1|  PREDICTED: homeobox-leucine zipper protein H...  62.0    1e-08   Vitis vinifera
emb|CAN83483.1|  hypothetical protein VITISV_009450                   62.0    1e-08   Vitis vinifera
emb|CBI35303.3|  unnamed protein product                              62.0    1e-08   
ref|XP_008240378.1|  PREDICTED: homeobox-leucine zipper protein H...  62.0    1e-08   
ref|XP_008375041.1|  PREDICTED: homeobox-leucine zipper protein H...  61.6    2e-08   
ref|XP_002317722.2|  hypothetical protein POPTR_0012s03550g           61.6    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008445879.1|  PREDICTED: homeobox-leucine zipper protein H...  61.6    2e-08   
ref|XP_004137568.1|  PREDICTED: homeobox-leucine zipper protein H...  61.6    2e-08   
gb|KDP45798.1|  hypothetical protein JCGZ_17405                       61.6    2e-08   
emb|CDY26205.1|  BnaA06g12120D                                        60.8    3e-08   
ref|XP_003549189.1|  PREDICTED: homeobox-leucine zipper protein H...  60.8    3e-08   
ref|XP_006587436.1|  PREDICTED: homeobox-leucine zipper protein H...  60.8    3e-08   
gb|AIA58892.1|  homeodomain protein HOX3-D                            60.8    3e-08   
gb|AIA58891.1|  homeodomain protein HOX3-A                            60.8    4e-08   
gb|AAU12247.1|  homeodomain protein HOX3                              60.8    4e-08   Gossypium hirsutum [American cotton]
emb|CDO98613.1|  unnamed protein product                              60.5    4e-08   
ref|XP_009149243.1|  PREDICTED: homeobox-leucine zipper protein H...  60.5    4e-08   
ref|XP_002527933.1|  homeobox protein, putative                       59.7    7e-08   Ricinus communis
ref|XP_004241474.1|  PREDICTED: homeobox-leucine zipper protein H...  59.7    7e-08   
ref|XP_006347370.1|  PREDICTED: homeobox-leucine zipper protein H...  59.7    8e-08   
ref|XP_011000766.1|  PREDICTED: homeobox-leucine zipper protein H...  59.7    8e-08   
gb|EPS60199.1|  hypothetical protein M569_14605                       58.5    1e-07   
emb|CDY19185.1|  BnaC05g13860D                                        58.9    1e-07   
ref|XP_010244428.1|  PREDICTED: homeobox-leucine zipper protein R...  58.9    2e-07   
ref|XP_010244355.1|  PREDICTED: homeobox-leucine zipper protein R...  58.5    2e-07   
gb|EYU22268.1|  hypothetical protein MIMGU_mgv1a002027mg              58.5    2e-07   
gb|EYU22269.1|  hypothetical protein MIMGU_mgv1a002027mg              58.5    2e-07   
ref|XP_010268321.1|  PREDICTED: homeobox-leucine zipper protein H...  58.2    2e-07   
ref|XP_010268322.1|  PREDICTED: homeobox-leucine zipper protein H...  58.2    2e-07   
ref|XP_010540046.1|  PREDICTED: homeobox-leucine zipper protein H...  58.2    3e-07   
ref|XP_010540042.1|  PREDICTED: homeobox-leucine zipper protein H...  58.2    3e-07   
ref|XP_010932508.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox-leu...  57.8    3e-07   
ref|XP_010099679.1|  Homeobox-leucine zipper protein HDG11            57.0    6e-07   
tpg|DAA05772.1|  TPA: class IV HD-Zip protein HDZ42                   56.6    7e-07   
ref|XP_002985242.1|  hypothetical protein SELMODRAFT_234698           56.6    7e-07   
ref|XP_002970050.1|  hypothetical protein SELMODRAFT_450564           56.6    9e-07   
ref|XP_008806630.1|  PREDICTED: homeobox-leucine zipper protein R...  55.8    1e-06   
ref|XP_008789231.1|  PREDICTED: homeobox-leucine zipper protein R...  55.8    1e-06   
ref|XP_008789233.1|  PREDICTED: homeobox-leucine zipper protein R...  55.8    1e-06   
ref|XP_008789232.1|  PREDICTED: homeobox-leucine zipper protein R...  55.8    1e-06   
ref|XP_010917295.1|  PREDICTED: homeobox-leucine zipper protein R...  55.5    2e-06   
ref|XP_002305259.2|  hypothetical protein POPTR_0004s07310g           55.1    3e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010537520.1|  PREDICTED: homeobox-leucine zipper protein H...  55.1    3e-06   
ref|XP_006849468.1|  hypothetical protein AMTR_s00024p00094630        54.3    4e-06   
ref|XP_011005937.1|  PREDICTED: homeobox-leucine zipper protein R...  54.3    4e-06   
gb|KEH26844.1|  homeobox leucine zipper protein                       53.9    7e-06   
ref|XP_010498166.1|  PREDICTED: homeobox-leucine zipper protein H...  53.9    7e-06   
gb|EMT33784.1|  Homeobox-leucine zipper protein ROC8                  53.5    7e-06   
ref|XP_010476956.1|  PREDICTED: homeobox-leucine zipper protein H...  53.5    7e-06   
ref|XP_010462761.1|  PREDICTED: homeobox-leucine zipper protein H...  53.5    8e-06   
dbj|BAK07849.1|  predicted protein                                    53.5    8e-06   
ref|XP_004170013.1|  PREDICTED: homeobox-leucine zipper protein H...  52.8    8e-06   
ref|XP_007160572.1|  hypothetical protein PHAVU_002G333100g           53.5    9e-06   
ref|XP_006656750.1|  PREDICTED: homeobox-leucine zipper protein R...  53.1    1e-05   
sp|Q69T58.2|ROC8_ORYSJ  RecName: Full=Homeobox-leucine zipper pro...  53.1    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003530982.1|  PREDICTED: homeobox-leucine zipper protein H...  53.1    1e-05   
ref|NP_564041.2|  homeobox-leucine zipper protein HDG12               53.1    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EYU32068.1|  hypothetical protein MIMGU_mgv1a0015191mg             50.1    1e-05   
dbj|BAD35894.1|  putative homeobox                                    53.1    1e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006306921.1|  hypothetical protein CARUB_v10008485mg           53.1    1e-05   
tpg|DAA34963.1|  TPA: homeodomain leucine zipper family IV protein    52.8    1e-05   
gb|AFW73675.1|  putative homeobox/lipid-binding domain family pro...  52.8    1e-05   
gb|AFW73676.1|  putative homeobox/lipid-binding domain family pro...  52.8    1e-05   
ref|XP_002452898.1|  hypothetical protein SORBIDRAFT_04g034580        52.8    1e-05   Sorghum bicolor [broomcorn]
ref|XP_004964922.1|  PREDICTED: homeobox-leucine zipper protein R...  52.8    2e-05   
ref|XP_004964921.1|  PREDICTED: homeobox-leucine zipper protein R...  52.8    2e-05   
gb|ABA70759.1|  baby boom interacting protein 1B                      52.8    2e-05   Brassica napus [oilseed rape]
emb|CDX72984.1|  BnaC06g34320D                                        52.8    2e-05   
gb|ABA54874.1|  baby boom interacting protein 1A                      52.4    2e-05   Brassica napus [oilseed rape]
ref|NP_001142912.1|  uncharacterized protein LOC100275344             52.4    2e-05   Zea mays [maize]
emb|CDX96471.1|  BnaA07g30820D                                        52.4    2e-05   
tpg|DAA34962.1|  TPA: homeodomain leucine zipper family IV protein    52.4    2e-05   
ref|XP_008457114.1|  PREDICTED: homeobox-leucine zipper protein H...  52.4    2e-05   
ref|XP_008457113.1|  PREDICTED: homeobox-leucine zipper protein H...  52.4    2e-05   
gb|KGN57450.1|  hypothetical protein Csa_3G187250                     52.4    2e-05   
ref|XP_004140733.1|  PREDICTED: homeobox-leucine zipper protein H...  52.4    2e-05   
gb|KHN02685.1|  Homeobox-leucine zipper protein MERISTEM L1           52.4    2e-05   
ref|XP_006589605.1|  PREDICTED: homeobox-leucine zipper protein M...  52.4    2e-05   
ref|XP_006589608.1|  PREDICTED: homeobox-leucine zipper protein M...  52.4    2e-05   
ref|XP_002268272.1|  PREDICTED: homeobox-leucine zipper protein ROC8  52.4    2e-05   Vitis vinifera
ref|XP_009403550.1|  PREDICTED: homeobox-leucine zipper protein R...  52.0    3e-05   
ref|XP_009409108.1|  PREDICTED: homeobox-leucine zipper protein R...  52.0    3e-05   
ref|XP_009381006.1|  PREDICTED: homeobox-leucine zipper protein R...  52.0    3e-05   
ref|XP_002975525.1|  hypothetical protein SELMODRAFT_450555           51.2    5e-05   
ref|XP_008649207.1|  PREDICTED: homeobox-leucine zipper protein R...  50.8    6e-05   
gb|AFW76670.1|  putative homeobox/lipid-binding domain family pro...  50.8    6e-05   
ref|XP_002438026.1|  hypothetical protein SORBIDRAFT_10g006820        50.8    6e-05   Sorghum bicolor [broomcorn]
ref|XP_006421085.1|  hypothetical protein CICLE_v10006467mg           50.8    7e-05   
ref|XP_003524332.1|  PREDICTED: homeobox-leucine zipper protein H...  50.8    7e-05   
ref|XP_006493518.1|  PREDICTED: homeobox-leucine zipper protein R...  50.8    7e-05   
gb|AFW85378.1|  hypothetical protein ZEAMMB73_822854                  50.4    7e-05   
tpg|DAA34966.1|  TPA: homeodomain leucine zipper family IV protein    50.8    7e-05   
ref|XP_002526595.1|  Homeobox protein GLABRA2, putative               50.4    7e-05   Ricinus communis
ref|XP_010091553.1|  Homeobox-leucine zipper protein ANTHOCYANINL...  50.8    7e-05   
ref|XP_004306832.1|  PREDICTED: homeobox-leucine zipper protein A...  50.8    8e-05   
tpg|DAA05771.1|  TPA: class IV HD-Zip protein HDZ41                   50.8    8e-05   
ref|XP_004954073.1|  PREDICTED: homeobox-leucine zipper protein R...  50.4    8e-05   
ref|XP_004954072.1|  PREDICTED: homeobox-leucine zipper protein R...  50.4    8e-05   
ref|XP_009388746.1|  PREDICTED: homeobox-leucine zipper protein R...  50.4    9e-05   
tpg|DAA05775.1|  TPA: class IV HD-Zip protein HDZ41                   50.4    1e-04   
ref|XP_011091721.1|  PREDICTED: homeobox-leucine zipper protein A...  50.4    1e-04   
gb|KDO75529.1|  hypothetical protein CISIN_1g045292mg                 50.1    1e-04   
ref|XP_002988402.1|  hypothetical protein SELMODRAFT_450553           50.4    1e-04   
gb|EYU17789.1|  hypothetical protein MIMGU_mgv1a002049mg              50.1    1e-04   
ref|XP_009380061.1|  PREDICTED: homeobox-leucine zipper protein R...  50.1    1e-04   
ref|XP_002979015.1|  hypothetical protein SELMODRAFT_450554           50.1    1e-04   
tpg|DAA05774.1|  TPA: class IV HD-Zip protein HDZ44                   50.1    1e-04   
ref|XP_006390565.1|  hypothetical protein EUTSA_v10018189mg           50.1    1e-04   
gb|EYU28567.1|  hypothetical protein MIMGU_mgv1a017824mg              50.1    1e-04   
gb|EPS72360.1|  hypothetical protein M569_02398                       50.1    1e-04   
ref|XP_009793614.1|  PREDICTED: homeobox-leucine zipper protein M...  50.1    1e-04   
ref|XP_009609608.1|  PREDICTED: homeobox-leucine zipper protein M...  50.1    1e-04   
ref|XP_009609606.1|  PREDICTED: homeobox-leucine zipper protein P...  50.1    1e-04   
ref|XP_008787891.1|  PREDICTED: homeobox-leucine zipper protein R...  50.1    1e-04   
ref|XP_008787892.1|  PREDICTED: homeobox-leucine zipper protein R...  50.1    1e-04   
ref|XP_006352605.1|  PREDICTED: homeobox-leucine zipper protein M...  49.7    1e-04   
emb|CAN76162.1|  hypothetical protein VITISV_016297                   46.6    2e-04   Vitis vinifera
ref|XP_006396268.1|  hypothetical protein EUTSA_v10028440mg           49.3    2e-04   
emb|CDX91894.1|  BnaC03g31960D                                        49.3    2e-04   
dbj|BAJ34339.1|  unnamed protein product                              49.3    2e-04   
ref|XP_009340632.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    2e-04   
emb|CDX74347.1|  BnaA03g27000D                                        49.3    2e-04   
ref|XP_009104812.1|  PREDICTED: homeobox-leucine zipper protein H...  49.3    2e-04   
ref|XP_009134533.1|  PREDICTED: LOW QUALITY PROTEIN: homeobox-leu...  49.3    2e-04   
ref|XP_007132557.1|  hypothetical protein PHAVU_011G104700g           49.3    2e-04   
ref|XP_010255501.1|  PREDICTED: homeobox-leucine zipper protein A...  49.3    2e-04   
emb|CDX68229.1|  BnaA07g22690D                                        49.3    2e-04   
emb|CDY11109.1|  BnaC06g23610D                                        49.3    2e-04   
gb|KHN36536.1|  Homeobox-leucine zipper protein HDG2                  49.3    2e-04   
ref|XP_010038600.1|  PREDICTED: homeobox-leucine zipper protein H...  48.9    3e-04   
gb|KHN30455.1|  Homeobox-leucine zipper protein PROTODERMAL FACTOR 2  48.9    3e-04   
ref|XP_010089514.1|  hypothetical protein L484_000624                 48.9    3e-04   
ref|XP_003528880.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    3e-04   
ref|XP_003581542.1|  PREDICTED: homeobox-leucine zipper protein ROC4  48.9    3e-04   
ref|XP_006576359.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    3e-04   
ref|XP_003555330.2|  PREDICTED: homeobox-leucine zipper protein M...  48.9    3e-04   
ref|XP_006583340.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    3e-04   
emb|CAN61351.1|  hypothetical protein VITISV_023503                   48.9    3e-04   Vitis vinifera
ref|XP_010278578.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    3e-04   
tpg|DAA05777.1|  TPA: class IV HD-Zip protein HDZ43                   48.9    3e-04   
ref|XP_006594896.1|  PREDICTED: homeobox-leucine zipper protein H...  48.9    3e-04   
gb|KHN15800.1|  Homeobox-leucine zipper protein MERISTEM L1           48.9    3e-04   
ref|XP_003543387.1|  PREDICTED: homeobox-leucine zipper protein H...  48.9    3e-04   
ref|XP_003521284.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    3e-04   
ref|NP_177479.1|  homeobox-leucine zipper protein HDG11               48.9    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010278577.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    3e-04   
gb|AAC79430.1|  homeodomain protein                                   48.9    3e-04   Malus domestica [apple tree]
ref|XP_011035097.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    3e-04   
emb|CBI38766.3|  unnamed protein product                              48.9    3e-04   
ref|XP_002272264.2|  PREDICTED: homeobox-leucine zipper protein A...  48.9    3e-04   Vitis vinifera
ref|XP_010657313.1|  PREDICTED: homeobox-leucine zipper protein H...  48.9    3e-04   
ref|XP_010661562.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    3e-04   
ref|XP_009382297.1|  PREDICTED: homeobox-leucine zipper protein R...  48.9    3e-04   
ref|XP_010657309.1|  PREDICTED: homeobox-leucine zipper protein H...  48.9    3e-04   
ref|XP_010939971.1|  PREDICTED: homeobox-leucine zipper protein R...  48.9    3e-04   
ref|XP_010657310.1|  PREDICTED: homeobox-leucine zipper protein H...  48.9    3e-04   
ref|XP_008460172.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    3e-04   
gb|KHN44879.1|  Homeobox-leucine zipper protein HDG2                  48.9    3e-04   
ref|XP_004144982.1|  PREDICTED: homeobox-leucine zipper protein A...  48.9    3e-04   
emb|CDP08876.1|  unnamed protein product                              48.9    3e-04   
ref|XP_002511801.1|  homeobox protein, putative                       48.9    3e-04   Ricinus communis
gb|KFK41777.1|  hypothetical protein AALP_AA2G170800                  48.5    3e-04   
ref|XP_010657312.1|  PREDICTED: homeobox-leucine zipper protein H...  48.5    3e-04   
gb|KHG16285.1|  Homeobox-leucine zipper ANTHOCYANINLESS 2 -like p...  48.5    3e-04   
ref|XP_008385703.1|  PREDICTED: homeobox-leucine zipper protein A...  48.5    3e-04   
gb|KDP28682.1|  hypothetical protein JCGZ_14453                       48.5    3e-04   
ref|XP_008385704.1|  PREDICTED: homeobox-leucine zipper protein A...  48.5    3e-04   
ref|XP_004510857.1|  PREDICTED: homeobox-leucine zipper protein A...  48.5    4e-04   
ref|XP_007051912.1|  HD domain class transcription factor isoform 1   48.5    4e-04   
ref|XP_006851770.1|  hypothetical protein AMTR_s00040p00231210        48.5    4e-04   
ref|XP_002320755.1|  homeodomain family protein                       48.5    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_007134961.1|  hypothetical protein PHAVU_010G090300g           48.5    4e-04   
emb|CAH67034.1|  OSIGBa0139P06.7                                      48.5    4e-04   Oryza sativa [red rice]
ref|NP_001053595.1|  Os04g0569100                                     48.5    4e-04   Oryza sativa Japonica Group [Japonica rice]
gb|KEH18947.1|  homeobox leucine zipper protein                       48.5    4e-04   
ref|XP_007051913.1|  HD domain class transcription factor isoform 2   48.5    4e-04   
dbj|BAC77157.1|  GL2-type homeodomain protein                         48.5    4e-04   Oryza sativa Japonica Group [Japonica rice]
sp|Q7Y0V9.2|ROC4_ORYSJ  RecName: Full=Homeobox-leucine zipper pro...  48.5    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006287095.1|  hypothetical protein CARUB_v10000257mg           48.5    4e-04   
ref|XP_003570542.1|  PREDICTED: homeobox-leucine zipper protein R...  48.5    4e-04   
ref|XP_010416135.1|  PREDICTED: homeobox-leucine zipper protein H...  48.5    4e-04   
ref|XP_010053664.1|  PREDICTED: homeobox-leucine zipper protein A...  48.5    4e-04   
gb|EEE61524.1|  hypothetical protein OsJ_15826                        48.5    4e-04   Oryza sativa Japonica Group [Japonica rice]
gb|KHG01515.1|  Homeobox-leucine zipper ROC6                          48.5    4e-04   
ref|XP_009105998.1|  PREDICTED: homeobox-leucine zipper protein H...  48.5    4e-04   
gb|EEC77821.1|  hypothetical protein OsI_17027                        48.5    4e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010471396.1|  PREDICTED: homeobox-leucine zipper protein H...  48.5    4e-04   
gb|ACB73218.1|  homeodomain protein GL2-like 1                        48.5    4e-04   Gossypium hirsutum [American cotton]
gb|KDO41372.1|  hypothetical protein CISIN_1g0042941mg                46.2    4e-04   
ref|XP_011000687.1|  PREDICTED: homeobox-leucine zipper protein M...  48.1    4e-04   
ref|XP_004134971.1|  PREDICTED: homeobox-leucine zipper protein P...  48.1    4e-04   
ref|XP_008439968.1|  PREDICTED: homeobox-leucine zipper protein P...  48.1    4e-04   
ref|XP_007220256.1|  hypothetical protein PRUPE_ppa001436mg           48.5    4e-04   
ref|XP_010428260.1|  PREDICTED: homeobox-leucine zipper protein H...  48.1    4e-04   
gb|KFK30650.1|  hypothetical protein AALP_AA6G009600                  47.8    5e-04   
ref|XP_011093166.1|  PREDICTED: homeobox-leucine zipper protein A...  48.1    5e-04   
ref|XP_011093167.1|  PREDICTED: homeobox-leucine zipper protein A...  48.1    5e-04   
ref|XP_006468235.1|  PREDICTED: homeobox-leucine zipper protein M...  48.1    5e-04   
ref|XP_006582046.1|  PREDICTED: homeobox-leucine zipper protein H...  45.4    5e-04   
ref|XP_006449076.1|  hypothetical protein CICLE_v10014424mg           48.1    5e-04   
ref|XP_002305602.1|  PROTODERMAL FACTOR2 family protein               48.1    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010275996.1|  PREDICTED: homeobox-leucine zipper protein H...  48.1    6e-04   
ref|XP_006301097.1|  hypothetical protein CARUB_v10021491mg           48.1    6e-04   
ref|XP_011037708.1|  PREDICTED: homeobox-leucine zipper protein M...  48.1    6e-04   
ref|XP_008799024.1|  PREDICTED: homeobox-leucine zipper protein R...  48.1    6e-04   
tpg|DAA05776.1|  TPA: class IV HD-Zip protein HDZ42                   47.8    6e-04   
ref|XP_009802527.1|  PREDICTED: homeobox-leucine zipper protein H...  47.8    6e-04   
ref|XP_009802526.1|  PREDICTED: homeobox-leucine zipper protein H...  47.8    6e-04   
ref|XP_009802525.1|  PREDICTED: homeobox-leucine zipper protein H...  47.8    6e-04   
ref|XP_002301331.2|  homeodomain family protein                       47.8    6e-04   Populus trichocarpa [western balsam poplar]
ref|XP_009802524.1|  PREDICTED: homeobox-leucine zipper protein H...  47.8    6e-04   
ref|XP_010523728.1|  PREDICTED: homeobox-leucine zipper protein H...  47.8    6e-04   
ref|XP_004155671.1|  PREDICTED: homeobox-leucine zipper protein P...  47.8    6e-04   
ref|XP_004248397.1|  PREDICTED: homeobox-leucine zipper protein M...  47.8    7e-04   
ref|XP_002317205.1|  PROTODERMAL FACTOR2 family protein               47.8    7e-04   Populus trichocarpa [western balsam poplar]
gb|KDP20783.1|  hypothetical protein JCGZ_21254                       47.8    7e-04   
gb|AAC13617.1|  Arabidopsis thaliana homeodomain protein AHDP (SP...  47.8    7e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010051064.1|  PREDICTED: homeobox-leucine zipper protein HDG2  47.8    7e-04   
ref|XP_008343137.1|  PREDICTED: homeobox-leucine zipper protein R...  47.8    7e-04   
gb|AAB41901.1|  homeodomain protein AHDP                              47.8    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006573890.1|  PREDICTED: homeobox-leucine zipper protein M...  47.4    8e-04   
ref|XP_003564122.2|  PREDICTED: homeobox-leucine zipper protein R...  47.4    8e-04   
ref|XP_006826512.1|  hypothetical protein AMTR_s00004p00265170        47.4    8e-04   
ref|NP_567183.2|  homeobox-leucine zipper protein ANTHOCYANINLESS 2   47.4    8e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009602857.1|  PREDICTED: homeobox-leucine zipper protein A...  47.4    8e-04   
ref|XP_009111469.1|  PREDICTED: homeobox-leucine zipper protein A...  47.4    8e-04   
ref|XP_009602856.1|  PREDICTED: homeobox-leucine zipper protein A...  47.4    8e-04   
gb|KHN41209.1|  Homeobox-leucine zipper protein HDG2                  47.4    9e-04   
ref|XP_010427345.1|  PREDICTED: homeobox-leucine zipper protein A...  47.4    9e-04   
gb|AAD47139.1|AF077335_1  Anthocyaninless2                            47.4    9e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006582343.1|  PREDICTED: homeobox-leucine zipper protein H...  47.4    9e-04   
ref|XP_010456250.1|  PREDICTED: homeobox-leucine zipper protein A...  47.4    9e-04   
ref|XP_010419627.1|  PREDICTED: homeobox-leucine zipper protein A...  47.4    9e-04   
emb|CDY51143.1|  BnaA09g51780D                                        47.4    9e-04   
ref|XP_006339457.1|  PREDICTED: homeobox-leucine zipper protein A...  47.4    9e-04   
emb|CDX97309.1|  BnaA02g21000D                                        44.7    9e-04   
ref|XP_009782443.1|  PREDICTED: homeobox-leucine zipper protein A...  47.4    9e-04   
ref|NP_001063724.1|  Os09g0526200                                     46.6    9e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003527487.1|  PREDICTED: homeobox-leucine zipper protein H...  47.4    9e-04   
ref|XP_009782444.1|  PREDICTED: homeobox-leucine zipper protein A...  47.4    9e-04   
emb|CDY07201.1|  BnaCnng02160D                                        47.4    0.001   
ref|XP_008232741.1|  PREDICTED: homeobox-leucine zipper protein A...  47.4    0.001   
ref|XP_009401771.1|  PREDICTED: homeobox-leucine zipper protein ROC5  47.4    0.001   
ref|XP_007157166.1|  hypothetical protein PHAVU_002G048200g           47.4    0.001   
ref|XP_008232742.1|  PREDICTED: homeobox-leucine zipper protein A...  47.4    0.001   
ref|XP_006592816.1|  PREDICTED: homeobox-leucine zipper protein H...  47.4    0.001   
ref|XP_007149968.1|  hypothetical protein PHAVU_005G114600g           47.4    0.001   
gb|KDP35728.1|  hypothetical protein JCGZ_10500                       47.0    0.001   
ref|XP_006592818.1|  PREDICTED: homeobox-leucine zipper protein H...  47.4    0.001   
gb|KHN35197.1|  Homeobox-leucine zipper protein MERISTEM L1           47.4    0.001   



>ref|XP_006374213.1| homeobox-leucine zipper family protein [Populus trichocarpa]
 gb|ERP52010.1| homeobox-leucine zipper family protein [Populus trichocarpa]
Length=725

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +3

Query  27   SGCLLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            S C    +TSQNNMLIL+ESC+DS GSLVVY P+DLPAIN+AM
Sbjct  592  SDCFTAYNTSQNNMLILQESCVDSSGSLVVYCPVDLPAINIAM  634



>ref|XP_009110376.1| PREDICTED: homeobox-leucine zipper protein HDG12-like isoform 
X1 [Brassica rapa]
Length=684

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +SQNNMLIL+ESC+DS GSLVVY PLDLPA+NMAM
Sbjct  562  SSQNNMLILQESCVDSSGSLVVYTPLDLPALNMAM  596



>ref|XP_009778533.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Nicotiana 
sylvestris]
Length=717

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            L   +TSQNNMLIL+ESCIDS GSLV+Y+P+DLP+INMAM
Sbjct  583  LRAYNTSQNNMLILQESCIDSSGSLVIYSPVDLPSINMAM  622



>emb|CDX96744.1| BnaA08g22870D [Brassica napus]
Length=673

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +SQNNMLIL+ESC+DS GSLVVY PLDLPA+NMAM
Sbjct  562  SSQNNMLILQESCVDSSGSLVVYTPLDLPALNMAM  596



>ref|XP_009110377.1| PREDICTED: homeobox-leucine zipper protein HDG12-like isoform 
X2 [Brassica rapa]
Length=670

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +SQNNMLIL+ESC+DS GSLVVY PLDLPA+NMAM
Sbjct  548  SSQNNMLILQESCVDSSGSLVVYTPLDLPALNMAM  582



>emb|CDY26204.1| BnaA06g12130D [Brassica napus]
Length=637

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +SQNNMLIL+ESC+DS GSLVVY PLDLPA+NMAM
Sbjct  572  SSQNNMLILQESCVDSSGSLVVYTPLDLPALNMAM  606



>emb|CDX83884.1| BnaC08g17610D [Brassica napus]
Length=685

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +SQNNMLIL+ESC+DS GSLVVY PLDLPA+NMAM
Sbjct  562  SSQNNMLILQESCVDSSGSLVVYTPLDLPALNMAM  596



>ref|XP_006416656.1| hypothetical protein EUTSA_v10006969mg [Eutrema salsugineum]
 gb|ESQ35009.1| hypothetical protein EUTSA_v10006969mg [Eutrema salsugineum]
Length=695

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +SQNNMLIL+ESC+DS GSLVVY P+DLPA+NMAM
Sbjct  576  SSQNNMLILQESCVDSSGSLVVYTPVDLPALNMAM  610



>ref|XP_009355964.1| PREDICTED: homeobox-leucine zipper protein HDG11 isoform X1 [Pyrus 
x bretschneideri]
Length=710

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL++SCIDS GSLVVY+P+DLPAIN+AM
Sbjct  588  NTSQNNMLILQQSCIDSSGSLVVYSPVDLPAINIAM  623



>ref|XP_009355965.1| PREDICTED: homeobox-leucine zipper protein HDG11 isoform X2 [Pyrus 
x bretschneideri]
Length=674

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL++SCIDS GSLVVY+P+DLPAIN+AM
Sbjct  588  NTSQNNMLILQQSCIDSSGSLVVYSPVDLPAINIAM  623



>ref|XP_011072039.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Sesamum 
indicum]
Length=717

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/35 (86%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            TSQNNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  591  TSQNNMLILQESCIDSSGSLVVYCPIDLPAINIAM  625



>ref|XP_010069492.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Eucalyptus 
grandis]
 gb|KCW57856.1| hypothetical protein EUGRSUZ_H00609 [Eucalyptus grandis]
Length=712

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSL+VY P+DLPAIN+AM
Sbjct  583  NTSQNNMLILQESCIDSSGSLIVYCPVDLPAINLAM  618



>ref|XP_006478112.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Citrus 
sinensis]
Length=714

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  587  NTSQNNMLILQESCIDSSGSLVVYCPVDLPAINIAM  622



>ref|XP_007010890.1| Homeobox-leucine zipper protein HDG11 [Theobroma cacao]
 gb|EOY19700.1| Homeobox-leucine zipper protein HDG11 [Theobroma cacao]
Length=842

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  584  NTSQNNMLILQESCIDSSGSLVVYCPVDLPAINVAM  619



>ref|XP_006364383.1| PREDICTED: homeobox-leucine zipper protein HDG11-like, partial 
[Solanum tuberosum]
Length=705

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            L   +TSQNNMLIL+ESCIDS G+LVVY+P+D+PAIN+AM
Sbjct  572  LRAYNTSQNNMLILQESCIDSSGALVVYSPVDIPAINIAM  611



>gb|KDO46401.1| hypothetical protein CISIN_1g006760mg [Citrus sinensis]
Length=632

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  505  NTSQNNMLILQESCIDSSGSLVVYCPVDLPAINIAM  540



>ref|XP_004235382.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Solanum lycopersicum]
Length=721

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            L   +TSQNNMLIL+ESCIDS G+LVVY+P+D+PAIN+AM
Sbjct  588  LRAYNTSQNNMLILQESCIDSSGALVVYSPVDIPAINIAM  627



>ref|XP_009606250.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Nicotiana 
tomentosiformis]
Length=713

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            L   +TSQNNMLIL+ESCIDS GSLV+Y+P+DLP+IN+AM
Sbjct  579  LRAYNTSQNNMLILQESCIDSSGSLVIYSPVDLPSINIAM  618



>ref|XP_004299483.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Fragaria 
vesca subsp. vesca]
Length=709

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  582  NTSQNNMLILQESCIDSSGSLVVYCPVDLPAINIAM  617



>ref|XP_006441353.1| hypothetical protein CICLE_v10019153mg [Citrus clementina]
 gb|ESR54593.1| hypothetical protein CICLE_v10019153mg [Citrus clementina]
Length=680

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  553  NTSQNNMLILQESCIDSSGSLVVYCPVDLPAINIAM  588



>ref|XP_011086973.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Sesamum indicum]
Length=727

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  594  NTSQNNMLILQESCIDSSGSLVVYCPVDLPAINIAM  629



>ref|XP_007210460.1| hypothetical protein PRUPE_ppa015345m1g, partial [Prunus persica]
 gb|EMJ11659.1| hypothetical protein PRUPE_ppa015345m1g, partial [Prunus persica]
Length=434

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNML+L+ESCIDS GSLVVY+P+DLP+IN+AM
Sbjct  311  NTSQNNMLMLQESCIDSSGSLVVYSPVDLPSINIAM  346



>ref|XP_006374212.1| hypothetical protein POPTR_0015s05050g [Populus trichocarpa]
 gb|ERP52009.1| hypothetical protein POPTR_0015s05050g [Populus trichocarpa]
Length=707

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESC+DS GSLVVY P+DLPAIN+AM
Sbjct  581  NTSQNNMLILQESCVDSSGSLVVYCPVDLPAINIAM  616



>ref|XP_009587298.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Nicotiana 
tomentosiformis]
Length=717

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            L   +TSQNNMLIL+ESCIDS G+LVVY+P+D+PAIN+AM
Sbjct  585  LRAYNTSQNNMLILQESCIDSSGALVVYSPVDVPAINIAM  624



>ref|XP_011035552.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Populus euphratica]
Length=707

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESC+DS GSLVVY P+DLPAIN+AM
Sbjct  581  NTSQNNMLILQESCVDSSGSLVVYCPVDLPAINIAM  616



>ref|XP_009786509.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Nicotiana 
sylvestris]
Length=717

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            L   +TSQNNMLIL+ESCIDS G+LVVY+P+D+PAIN+AM
Sbjct  585  LRAYNTSQNNMLILQESCIDSSGALVVYSPVDVPAINIAM  624



>ref|XP_007152598.1| hypothetical protein PHAVU_004G143500g [Phaseolus vulgaris]
 gb|ESW24592.1| hypothetical protein PHAVU_004G143500g [Phaseolus vulgaris]
Length=715

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESC+DS GSLVVY P+DLPAIN+AM
Sbjct  588  NTSQNNMLILQESCVDSSGSLVVYCPVDLPAINIAM  623



>ref|XP_010663934.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X1 [Vitis vinifera]
 ref|XP_010663935.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X1 [Vitis vinifera]
Length=719

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSLV+Y P+DLPAIN+AM
Sbjct  593  NTSQNNMLILQESCIDSSGSLVIYCPVDLPAINIAM  628



>ref|XP_004515249.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Cicer 
arietinum]
Length=722

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESC+DS GSLVVY P+DLPAIN+AM
Sbjct  589  NTSQNNMLILQESCVDSSGSLVVYCPVDLPAINIAM  624



>ref|XP_002271012.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X2 [Vitis vinifera]
Length=715

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSLV+Y P+DLPAIN+AM
Sbjct  589  NTSQNNMLILQESCIDSSGSLVIYCPVDLPAINIAM  624



>emb|CAN83483.1| hypothetical protein VITISV_009450 [Vitis vinifera]
Length=717

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSLV+Y P+DLPAIN+AM
Sbjct  591  NTSQNNMLILQESCIDSSGSLVIYCPVDLPAINIAM  626



>emb|CBI35303.3| unnamed protein product [Vitis vinifera]
Length=674

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSLV+Y P+DLPAIN+AM
Sbjct  589  NTSQNNMLILQESCIDSSGSLVIYCPVDLPAINIAM  624



>ref|XP_008240378.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Prunus mume]
Length=709

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNML+L+ESCIDS GSLVVY+P+DLP+IN+AM
Sbjct  586  NTSQNNMLMLQESCIDSSGSLVVYSPVDLPSINIAM  621



>ref|XP_008375041.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X1 [Malus domestica]
Length=710

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL++SCIDS GSLVVY+P+DLP+IN+AM
Sbjct  588  NTSQNNMLILQQSCIDSSGSLVVYSPVDLPSINIAM  623



>ref|XP_002317722.2| hypothetical protein POPTR_0012s03550g [Populus trichocarpa]
 gb|EEE95942.2| hypothetical protein POPTR_0012s03550g [Populus trichocarpa]
Length=668

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESC+DS GSLVVY P+DLPAIN+AM
Sbjct  542  NTSQNNMLILQESCMDSSGSLVVYCPVDLPAINIAM  577



>ref|XP_008445879.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Cucumis 
melo]
Length=1107

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            TSQNNMLIL+ESCIDS GSLVVY P+DLPA+N+AM
Sbjct  583  TSQNNMLILQESCIDSSGSLVVYCPVDLPAMNVAM  617



>ref|XP_004137568.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Cucumis 
sativus]
 ref|XP_004165666.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Cucumis 
sativus]
 gb|KGN63951.1| hypothetical protein Csa_1G031750 [Cucumis sativus]
Length=705

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            TSQNNMLIL+ESCIDS GSLVVY P+DLPA+N+AM
Sbjct  583  TSQNNMLILQESCIDSSGSLVVYCPVDLPAMNVAM  617



>gb|KDP45798.1| hypothetical protein JCGZ_17405 [Jatropha curcas]
Length=710

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +T QNNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  583  NTGQNNMLILQESCIDSSGSLVVYCPVDLPAINIAM  618



>emb|CDY26205.1| BnaA06g12120D [Brassica napus]
Length=690

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +SQNNMLIL+ESC+DS GSLVVY PLDL A+NMAM
Sbjct  572  SSQNNMLILQESCVDSSGSLVVYTPLDLSALNMAM  606



>ref|XP_003549189.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Glycine 
max]
 gb|KHN24536.1| Homeobox-leucine zipper protein HDG11 [Glycine soja]
Length=718

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQNNMLIL+ESC+DS GSLVVY P+DLPAIN+AM
Sbjct  589  NSSQNNMLILQESCVDSSGSLVVYCPVDLPAINIAM  624



>ref|XP_006587436.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Glycine 
max]
 gb|KHN23587.1| Homeobox-leucine zipper protein HDG11 [Glycine soja]
Length=722

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQNNMLIL+ESC+DS GSLVVY P+DLPAIN+AM
Sbjct  589  NSSQNNMLILQESCVDSSGSLVVYCPVDLPAINIAM  624



>gb|AIA58892.1| homeodomain protein HOX3-D [Gossypium hirsutum]
Length=711

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TS NNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  586  NTSHNNMLILQESCIDSSGSLVVYCPVDLPAINVAM  621



>gb|AIA58891.1| homeodomain protein HOX3-A [Gossypium hirsutum]
Length=713

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TS NNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  588  NTSHNNMLILQESCIDSSGSLVVYCPVDLPAINVAM  623



>gb|AAU12247.1| homeodomain protein HOX3 [Gossypium hirsutum]
Length=713

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TS NNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  588  NTSHNNMLILQESCIDSSGSLVVYCPVDLPAINVAM  623



>emb|CDO98613.1| unnamed protein product [Coffea canephora]
Length=714

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +T+QNNMLIL+ESCID+ GSLVV+ P+DLPAIN+AM
Sbjct  586  NTNQNNMLILQESCIDASGSLVVFGPVDLPAINIAM  621



>ref|XP_009149243.1| PREDICTED: homeobox-leucine zipper protein HDG12 [Brassica rapa]
Length=694

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +SQNNMLIL+ESC+DS GSLVVY P+DL A+NMAM
Sbjct  572  SSQNNMLILQESCVDSSGSLVVYTPVDLSALNMAM  606



>ref|XP_002527933.1| homeobox protein, putative [Ricinus communis]
 gb|EEF34449.1| homeobox protein, putative [Ricinus communis]
Length=713

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 32/35 (91%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + QNNMLIL+ESCIDS GSLVVY P+DLPAIN+AM
Sbjct  588  SGQNNMLILQESCIDSSGSLVVYCPVDLPAINIAM  622



>ref|XP_004241474.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Solanum 
lycopersicum]
Length=717

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            L   +TSQNNMLIL+ESCIDS GSLVVY+P+DL +IN+AM
Sbjct  588  LRAYNTSQNNMLILQESCIDSSGSLVVYSPVDLQSINIAM  627



>ref|XP_006347370.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Solanum 
tuberosum]
Length=715

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS GSLVVY+P+DL +IN+AM
Sbjct  589  NTSQNNMLILQESCIDSSGSLVVYSPVDLQSINIAM  624



>ref|XP_011000766.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Populus 
euphratica]
Length=711

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESCIDS  +LVVY P+DLPAIN+AM
Sbjct  585  NTSQNNMLILQESCIDSSAALVVYCPVDLPAINIAM  620



>gb|EPS60199.1| hypothetical protein M569_14605, partial [Genlisea aurea]
Length=387

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            L   +TSQNNMLIL+ESCIDS G LVVY P+DLPAI++AM
Sbjct  255  LRAYNTSQNNMLILQESCIDSSGCLVVYCPVDLPAIHIAM  294



>emb|CDY19185.1| BnaC05g13860D [Brassica napus]
Length=682

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +SQNNMLIL+ESC+DS GSLVVY P DL A+NMAM
Sbjct  573  SSQNNMLILQESCVDSSGSLVVYTPADLSALNMAM  607



>ref|XP_010244428.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform 
X2 [Nelumbo nucifera]
Length=702

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQNNML+L+ESCIDS  SLVVY+P+DLPAIN+AM
Sbjct  576  NASQNNMLLLQESCIDSSESLVVYSPVDLPAINIAM  611



>ref|XP_010244355.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform 
X1 [Nelumbo nucifera]
Length=706

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQNNML+L+ESCIDS  SLVVY+P+DLPAIN+AM
Sbjct  580  NASQNNMLLLQESCIDSSESLVVYSPVDLPAINIAM  615



>gb|EYU22268.1| hypothetical protein MIMGU_mgv1a002027mg [Erythranthe guttata]
Length=725

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            L   +TSQNNMLIL+ESCIDS GS+VV+ P+DLP+IN+AM
Sbjct  591  LRAYNTSQNNMLILQESCIDSSGSIVVHCPVDLPSINVAM  630



>gb|EYU22269.1| hypothetical protein MIMGU_mgv1a002027mg [Erythranthe guttata]
Length=682

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            L   +TSQNNMLIL+ESCIDS GS+VV+ P+DLP+IN+AM
Sbjct  548  LRAYNTSQNNMLILQESCIDSSGSIVVHCPVDLPSINVAM  587



>ref|XP_010268321.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X1 [Nelumbo nucifera]
Length=706

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQNNMLIL+ESC DS GSLVVY+P+DL AIN+AM
Sbjct  581  NASQNNMLILQESCTDSSGSLVVYSPVDLTAINIAM  616



>ref|XP_010268322.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X2 [Nelumbo nucifera]
Length=667

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQNNMLIL+ESC DS GSLVVY+P+DL AIN+AM
Sbjct  542  NASQNNMLILQESCTDSSGSLVVYSPVDLTAINIAM  577



>ref|XP_010540046.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X2 [Tarenaya hassleriana]
Length=671

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQNNMLIL+ESCIDS G+LVVY+PL+LPA+ +AM
Sbjct  547  NSSQNNMLILQESCIDSSGALVVYSPLELPALQIAM  582



>ref|XP_010540042.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010540044.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010540045.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X1 [Tarenaya hassleriana]
Length=701

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQNNMLIL+ESCIDS G+LVVY+PL+LPA+ +AM
Sbjct  577  NSSQNNMLILQESCIDSSGALVVYSPLELPALQIAM  612



>ref|XP_010932508.1| PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein 
ROC8-like [Elaeis guineensis]
Length=722

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQNNMLIL+ESC D+ GSLVVY P+DLPAIN+ M
Sbjct  599  NASQNNMLILQESCTDASGSLVVYAPIDLPAINIVM  634



>ref|XP_010099679.1| Homeobox-leucine zipper protein HDG11 [Morus notabilis]
 gb|EXB80256.1| Homeobox-leucine zipper protein HDG11 [Morus notabilis]
Length=721

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ES ID+ GS+VVY P+DLPAIN+AM
Sbjct  589  NTSQNNMLILQESSIDASGSVVVYCPVDLPAINIAM  624



>tpg|DAA05772.1| TPA_inf: class IV HD-Zip protein HDZ42 [Selaginella moellendorffii]
Length=694

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQ+NMLIL+ESC D+ GSL+VY P+D+PA+N+ M
Sbjct  562  NTSQSNMLILQESCTDASGSLIVYAPVDIPAMNLVM  597



>ref|XP_002985242.1| hypothetical protein SELMODRAFT_234698 [Selaginella moellendorffii]
 gb|EFJ13736.1| hypothetical protein SELMODRAFT_234698 [Selaginella moellendorffii]
Length=695

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQ+NMLIL+ESC D+ GSL+VY P+D+PA+N+ M
Sbjct  563  NTSQSNMLILQESCTDASGSLIVYAPVDIPAMNLVM  598



>ref|XP_002970050.1| hypothetical protein SELMODRAFT_450564 [Selaginella moellendorffii]
 gb|EFJ29174.1| hypothetical protein SELMODRAFT_450564 [Selaginella moellendorffii]
Length=683

 Score = 56.6 bits (135),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQ+NMLIL+ESC D+ GSL+VY P+D+PA+N+ M
Sbjct  562  NTSQSNMLILQESCTDASGSLIVYAPVDIPAMNLVM  597



>ref|XP_008806630.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Phoenix 
dactylifera]
Length=697

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQNNMLIL+ESC D+ GSLV+Y P+DLP+IN+ M
Sbjct  574  NASQNNMLILQESCTDASGSLVIYAPIDLPSINIVM  609



>ref|XP_008789231.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform 
X1 [Phoenix dactylifera]
Length=722

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQN+MLIL+ESC D+ GSLVVY P+DLPAIN+ M
Sbjct  599  NASQNSMLILQESCTDASGSLVVYAPIDLPAINIVM  634



>ref|XP_008789233.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform 
X3 [Phoenix dactylifera]
Length=671

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQN+MLIL+ESC D+ GSLVVY P+DLPAIN+ M
Sbjct  574  NASQNSMLILQESCTDASGSLVVYAPIDLPAINIVM  609



>ref|XP_008789232.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform 
X2 [Phoenix dactylifera]
Length=697

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQN+MLIL+ESC D+ GSLVVY P+DLPAIN+ M
Sbjct  574  NASQNSMLILQESCTDASGSLVVYAPIDLPAINIVM  609



>ref|XP_010917295.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Elaeis 
guineensis]
Length=727

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQN+MLIL+ESC D+ GSLVVY P+DLPAIN+ M
Sbjct  604  NASQNSMLILQESCTDAWGSLVVYAPIDLPAINIVM  639



>ref|XP_002305259.2| hypothetical protein POPTR_0004s07310g, partial [Populus trichocarpa]
 gb|EEE85770.2| hypothetical protein POPTR_0004s07310g, partial [Populus trichocarpa]
Length=735

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 3/44 (7%)
 Frame = +3

Query  33   CLLLQHT---SQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            C+ + H    ++NNMLIL+ESC DS GS+VVY PLD+PA+NM +
Sbjct  599  CISITHPFIPTENNMLILQESCTDSSGSMVVYAPLDIPAMNMVI  642



>ref|XP_010537520.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Tarenaya hassleriana]
Length=725

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQNNMLIL+ESCIDS G+LVVY+P+DL A+++AM
Sbjct  595  NASQNNMLILQESCIDSSGALVVYSPVDLSALHIAM  630



>ref|XP_006849468.1| hypothetical protein AMTR_s00024p00094630 [Amborella trichopoda]
 gb|ERN11049.1| hypothetical protein AMTR_s00024p00094630 [Amborella trichopoda]
Length=701

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQNNMLIL+ESC DS GSLVVY P+D+ A N+AM
Sbjct  575  NSSQNNMLILQESCTDSSGSLVVYAPIDVTAANIAM  610



>ref|XP_011005937.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Populus 
euphratica]
Length=743

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++NNMLIL+ESC DS GS+VVY PLD+PA+NM +
Sbjct  617  TENNMLILQESCTDSSGSMVVYAPLDIPAMNMVI  650



>gb|KEH26844.1| homeobox leucine zipper protein [Medicago truncatula]
Length=728

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQNNMLIL+ESC+DS GS+VVY P++L ++N+AM
Sbjct  591  NTSQNNMLILQESCVDSSGSIVVYCPIELTSMNVAM  626



>ref|XP_010498166.1| PREDICTED: homeobox-leucine zipper protein HDG12-like [Camelina 
sativa]
 ref|XP_010498167.1| PREDICTED: homeobox-leucine zipper protein HDG12-like [Camelina 
sativa]
Length=691

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPG-SLVVYNPLDLPAINMAM  155
            ++QNNMLIL+ESCIDS G +LV+Y P+D+PA+N+AM
Sbjct  579  SAQNNMLILQESCIDSSGAALVIYTPVDIPALNIAM  614



>gb|EMT33784.1| Homeobox-leucine zipper protein ROC8 [Aegilops tauschii]
Length=622

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
             SQN+MLIL+ESC D+ GSLVVY P+DLPA N+ M
Sbjct  512  ASQNSMLILQESCADASGSLVVYAPIDLPAANVVM  546



>ref|XP_010476956.1| PREDICTED: homeobox-leucine zipper protein HDG12 [Camelina sativa]
Length=689

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPG-SLVVYNPLDLPAINMAM  155
            ++QNNMLIL+ESCIDS G +LV+Y P+D+PA+N+AM
Sbjct  580  SAQNNMLILQESCIDSSGAALVIYTPVDIPALNIAM  615



>ref|XP_010462761.1| PREDICTED: homeobox-leucine zipper protein HDG12-like [Camelina 
sativa]
Length=544

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPG-SLVVYNPLDLPAINMAM  155
            ++QNNMLIL+ESCIDS G +LV+Y P+D+PA+N+AM
Sbjct  432  SAQNNMLILQESCIDSSGAALVIYTPVDIPALNIAM  467



>dbj|BAK07849.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=685

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
             SQN+MLIL+ESC D+ GSLVVY P+DLPA N+ M
Sbjct  575  ASQNSMLILQESCADASGSLVVYAPIDLPAANVVM  609



>ref|XP_004170013.1| PREDICTED: homeobox-leucine zipper protein HDG12-like, partial 
[Cucumis sativus]
Length=307

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMA  152
            ++NNMLIL+ESCID  GSLV+Y P+D+PA+N+A
Sbjct  185  TENNMLILQESCIDPLGSLVIYAPIDMPAMNIA  217



>ref|XP_007160572.1| hypothetical protein PHAVU_002G333100g [Phaseolus vulgaris]
 gb|ESW32566.1| hypothetical protein PHAVU_002G333100g [Phaseolus vulgaris]
Length=709

 Score = 53.5 bits (127),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 33/36 (92%), Gaps = 1/36 (3%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQN MLIL+ESCIDS GSLVVY P+DLP++N+AM
Sbjct  585  NTSQN-MLILQESCIDSSGSLVVYCPVDLPSMNIAM  619



>ref|XP_006656750.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Oryza brachyantha]
Length=681

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQN+MLIL+ESC D+ GSLVVY+P+D+PA N+ M
Sbjct  579  NASQNSMLILQESCTDASGSLVVYSPIDIPAANVVM  614



>sp|Q69T58.2|ROC8_ORYSJ RecName: Full=Homeobox-leucine zipper protein ROC8; AltName: 
Full=GLABRA 2-like homeobox protein 8; AltName: Full=HD-ZIP 
protein ROC8; AltName: Full=Homeodomain transcription factor 
ROC8; AltName: Full=Protein RICE OUTERMOST CELL-SPECIFIC 8 
[Oryza sativa Japonica Group]
Length=710

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQN+MLIL+ESC D+ GSLVVY+P+D+PA N+ M
Sbjct  573  NASQNSMLILQESCTDASGSLVVYSPIDIPAANVVM  608



>ref|XP_003530982.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X1 [Glycine max]
 ref|XP_006584922.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X2 [Glycine max]
 ref|XP_006584923.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X3 [Glycine max]
 ref|XP_006584924.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X4 [Glycine max]
 ref|XP_006584925.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X5 [Glycine max]
 gb|KHN00122.1| Homeobox-leucine zipper protein HDG11-like protein [Glycine soja]
Length=721

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + S  NMLIL+ESCIDS GS VVY P+DLP+IN+AM
Sbjct  590  NNSTQNMLILQESCIDSYGSFVVYCPVDLPSINLAM  625



>ref|NP_564041.2| homeobox-leucine zipper protein HDG12 [Arabidopsis thaliana]
 sp|Q9LMT8.1|HDG12_ARATH RecName: Full=Homeobox-leucine zipper protein HDG12; AltName: 
Full=HD-ZIP protein HDG12; AltName: Full=Homeodomain GLABRA 
2-like protein 12; AltName: Full=Homeodomain transcription 
factor HDG12; AltName: Full=Protein HOMEODOMAIN GLABROUS 12 
[Arabidopsis thaliana]
 gb|AAF97271.1|AC034106_14 Strong similarity to meristem L1 layer homeobox protein (ATML1) 
from Arabidopsis thaliana gb|U37589 and contains Transposase 
PF|01527, Homeobox PF|00046, and START PF|01852 domains. 
EST gb|AI995645 comes from this gene [Arabidopsis thaliana]
 dbj|BAH30303.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29652.1| homeobox-leucine zipper protein HDG12 [Arabidopsis thaliana]
Length=687

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSP-GSLVVYNPLDLPAINMAM  155
            +SQNNMLIL+ESCIDS   +LV+Y P+DLPA+N+AM
Sbjct  577  SSQNNMLILQESCIDSSSAALVIYTPVDLPALNIAM  612



>gb|EYU32068.1| hypothetical protein MIMGU_mgv1a0015191mg, partial [Erythranthe 
guttata]
Length=122

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ++MLIL+E+CID+ G+LVVY P+D+PA+++ M
Sbjct  3    NSSQSSMLILQETCIDAAGALVVYAPVDIPAMHLVM  38



>dbj|BAD35894.1| putative homeobox [Oryza sativa Japonica Group]
Length=734

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
             SQN+MLIL+ESC D+ GSLVVY+P+D+PA N+ M
Sbjct  598  ASQNSMLILQESCTDASGSLVVYSPIDIPAANVVM  632



>ref|XP_006306921.1| hypothetical protein CARUB_v10008485mg [Capsella rubella]
 gb|EOA39819.1| hypothetical protein CARUB_v10008485mg [Capsella rubella]
Length=686

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 32/36 (89%), Gaps = 1/36 (3%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSP-GSLVVYNPLDLPAINMAM  155
            +SQNNMLIL+ESCIDS   +LV+Y P+DLPA+N+AM
Sbjct  576  SSQNNMLILQESCIDSSSAALVIYTPVDLPALNIAM  611



>tpg|DAA34963.1| TPA_exp: homeodomain leucine zipper family IV protein [Zea mays]
Length=692

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
             SQN+MLIL+ESC D+ GSLVVY P+D+PA N+ M
Sbjct  574  ASQNSMLILQESCTDASGSLVVYAPIDIPAANVVM  608



>gb|AFW73675.1| putative homeobox/lipid-binding domain family protein [Zea mays]
Length=701

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
             SQN+MLIL+ESC D+ GSLVVY P+D+PA N+ M
Sbjct  583  ASQNSMLILQESCTDASGSLVVYAPIDIPAANVVM  617



>gb|AFW73676.1| putative homeobox/lipid-binding domain family protein [Zea mays]
Length=735

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
             SQN+MLIL+ESC D+ GSLVVY P+D+PA N+ M
Sbjct  617  ASQNSMLILQESCTDASGSLVVYAPIDIPAANVVM  651



>ref|XP_002452898.1| hypothetical protein SORBIDRAFT_04g034580 [Sorghum bicolor]
 gb|EES05874.1| hypothetical protein SORBIDRAFT_04g034580 [Sorghum bicolor]
Length=707

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
             SQN+MLIL+ESC D+ GSLVVY P+D+PA N+ M
Sbjct  582  ASQNSMLILQESCTDASGSLVVYAPIDIPAANVVM  616



>ref|XP_004964922.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform 
X2 [Setaria italica]
Length=699

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +QN+MLIL+ESC D+ GSLVVY+P+DLPA N+ M
Sbjct  575  NANQNSMLILQESCTDASGSLVVYSPIDLPAANVVM  610



>ref|XP_004964921.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform 
X1 [Setaria italica]
Length=710

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +QN+MLIL+ESC D+ GSLVVY+P+DLPA N+ M
Sbjct  586  NANQNSMLILQESCTDASGSLVVYSPIDLPAANVVM  621



>gb|ABA70759.1| baby boom interacting protein 1B [Brassica napus]
Length=711

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  60   NNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            NNMLIL+E+ IDS G+LVVY+P+DLPA+N+AM
Sbjct  584  NNMLILQETSIDSSGALVVYSPVDLPALNIAM  615



>emb|CDX72984.1| BnaC06g34320D [Brassica napus]
Length=715

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  60   NNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            NNMLIL+E+ IDS G+LVVY+P+DLPA+N+AM
Sbjct  588  NNMLILQETSIDSSGALVVYSPVDLPALNIAM  619



>gb|ABA54874.1| baby boom interacting protein 1A [Brassica napus]
Length=718

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  60   NNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            NNMLIL+E+ IDS G+LVVY+P+DLPA+N+AM
Sbjct  591  NNMLILQETSIDSSGALVVYSPVDLPALNIAM  622



>ref|NP_001142912.1| uncharacterized protein LOC100275344 [Zea mays]
 gb|ACG27501.1| hypothetical protein [Zea mays]
Length=698

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
             SQN+MLIL+ESC D  GSLVVY P+D+PA N+ M
Sbjct  574  ASQNSMLILQESCTDGTGSLVVYAPIDIPAANVVM  608



>emb|CDX96471.1| BnaA07g30820D [Brassica napus]
Length=718

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +3

Query  60   NNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            NNMLIL+E+ IDS G+LVVY+P+DLPA+N+AM
Sbjct  591  NNMLILQETSIDSSGALVVYSPVDLPALNIAM  622



>tpg|DAA34962.1| TPA_exp: homeodomain leucine zipper family IV protein [Zea mays]
 gb|AFW64305.1| putative homeobox/lipid-binding domain family protein [Zea mays]
 gb|AIB06014.1| HB transcription factor, partial [Zea mays]
Length=698

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
             SQN+MLIL+ESC D  GSLVVY P+D+PA N+ M
Sbjct  574  ASQNSMLILQESCTDGTGSLVVYAPIDIPAANVVM  608



>ref|XP_008457114.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X2 [Cucumis melo]
Length=710

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMA  152
            ++NNMLIL+ESCID  GSLV+Y P+D+PA+N+A
Sbjct  588  TENNMLILQESCIDPLGSLVIYAPIDMPAMNIA  620



>ref|XP_008457113.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform 
X1 [Cucumis melo]
Length=711

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMA  152
            ++NNMLIL+ESCID  GSLV+Y P+D+PA+N+A
Sbjct  589  TENNMLILQESCIDPLGSLVIYAPIDMPAMNIA  621



>gb|KGN57450.1| hypothetical protein Csa_3G187250 [Cucumis sativus]
Length=710

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMA  152
            ++NNMLIL+ESCID  GSLV+Y P+D+PA+N+A
Sbjct  588  TENNMLILQESCIDPLGSLVIYAPIDMPAMNIA  620



>ref|XP_004140733.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Cucumis 
sativus]
Length=706

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMA  152
            ++NNMLIL+ESCID  GSLV+Y P+D+PA+N+A
Sbjct  584  TENNMLILQESCIDPLGSLVIYAPIDMPAMNIA  616



>gb|KHN02685.1| Homeobox-leucine zipper protein MERISTEM L1 [Glycine soja]
Length=777

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  45   QHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            Q+ +QNNMLIL+ESCID+ GS VVY P+DL ++N+ +
Sbjct  654  QNVAQNNMLILQESCIDATGSFVVYAPIDLASMNLVL  690



>ref|XP_006589605.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform 
X1 [Glycine max]
 ref|XP_006589606.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform 
X2 [Glycine max]
 ref|XP_006589607.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform 
X3 [Glycine max]
Length=778

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  45   QHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            Q+ +QNNMLIL+ESCID+ GS VVY P+DL ++N+ +
Sbjct  655  QNVAQNNMLILQESCIDATGSFVVYAPIDLASMNLVL  691



>ref|XP_006589608.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform 
X4 [Glycine max]
Length=777

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  45   QHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            Q+ +QNNMLIL+ESCID+ GS VVY P+DL ++N+ +
Sbjct  654  QNVAQNNMLILQESCIDATGSFVVYAPIDLASMNLVL  690



>ref|XP_002268272.1| PREDICTED: homeobox-leucine zipper protein ROC8 [Vitis vinifera]
 emb|CBI27350.3| unnamed protein product [Vitis vinifera]
Length=714

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMAMM*MKSFNIHV  185
            ++NNML+L+ESC++  G LVVY P+D+PAIN+A+   +S NI +
Sbjct  591  TENNMLMLQESCVEPLGGLVVYAPIDIPAINVAIRGEESGNIPI  634



>ref|XP_009403550.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Musa acuminata 
subsp. malaccensis]
Length=697

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +SQN ML+L+E C D+ GS+VVY+P+DLPAIN+ M
Sbjct  575  SSQNTMLLLQECCTDASGSVVVYSPIDLPAINIVM  609



>ref|XP_009409108.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Musa acuminata 
subsp. malaccensis]
Length=696

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++ QN MLIL+E C D+ GS+VVY+P+DLPAIN+ M
Sbjct  573  NSGQNTMLILQECCTDASGSVVVYSPIDLPAINIVM  608



>ref|XP_009381006.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Musa acuminata 
subsp. malaccensis]
Length=700

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++ QN MLIL+E C D+ GS+VVY+P+DLPAIN+ M
Sbjct  577  NSGQNTMLILQECCTDASGSVVVYSPVDLPAINIVM  612



>ref|XP_002975525.1| hypothetical protein SELMODRAFT_450555 [Selaginella moellendorffii]
 gb|EFJ23154.1| hypothetical protein SELMODRAFT_450555 [Selaginella moellendorffii]
Length=675

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQ+NMLIL+ES  D  GSL+VY P+D+PA+N+ M
Sbjct  553  NTSQSNMLILQESSTDESGSLIVYAPVDIPAMNLVM  588



>ref|XP_008649207.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Zea mays]
 tpg|DAA34964.1| TPA_exp: homeodomain leucine zipper family IV protein [Zea mays]
Length=687

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +QN+MLIL+ESC D+ G+LVVY+P+D+PA N+ M
Sbjct  570  NANQNSMLILQESCTDASGALVVYSPIDIPAANVVM  605



>gb|AFW76670.1| putative homeobox/lipid-binding domain family protein [Zea mays]
Length=732

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +QN+MLIL+ESC D+ G+LVVY+P+D+PA N+ M
Sbjct  615  NANQNSMLILQESCTDASGALVVYSPIDIPAANVVM  650



>ref|XP_002438026.1| hypothetical protein SORBIDRAFT_10g006820 [Sorghum bicolor]
 gb|EER89393.1| hypothetical protein SORBIDRAFT_10g006820 [Sorghum bicolor]
Length=700

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +QN+MLIL+ESC D+ G+LVVY+P+D+PA N+ M
Sbjct  576  NANQNSMLILQESCTDASGALVVYSPIDIPAANVVM  611



>ref|XP_006421085.1| hypothetical protein CICLE_v10006467mg [Citrus clementina]
 gb|ESR34325.1| hypothetical protein CICLE_v10006467mg [Citrus clementina]
Length=710

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMAMM*MKSFNI  179
            ++NNML+L+ESCID  GS+VVY P+D+P++N+A+    S NI
Sbjct  581  TENNMLMLQESCIDQLGSMVVYAPIDIPSMNLAISGDDSSNI  622



>ref|XP_003524332.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Glycine 
max]
 gb|KHN10515.1| Homeobox-leucine zipper protein HDG11 [Glycine soja]
Length=713

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +L    +  NMLIL+ESCIDS GSLVVY P+DLP+IN A+
Sbjct  583  VLRAFNNSQNMLILQESCIDSYGSLVVYCPVDLPSINTAV  622



>ref|XP_006493518.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Citrus 
sinensis]
Length=706

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMAMM*MKSFNI  179
            ++NNML+L+ESCID  GS+VVY P+D+P++N+A+    S NI
Sbjct  577  TENNMLMLQESCIDQLGSMVVYAPIDIPSMNLAISGDDSSNI  618



>gb|AFW85378.1| hypothetical protein ZEAMMB73_822854 [Zea mays]
Length=548

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +QN+MLIL+ESC D+ G+LVVY+P+D+PA N+ M
Sbjct  421  NANQNSMLILQESCADASGALVVYSPIDIPAANVVM  456



>tpg|DAA34966.1| TPA_exp: homeodomain leucine zipper family IV protein [Zea mays]
Length=699

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +QN+MLIL+ESC D+ G+LVVY+P+D+PA N+ M
Sbjct  572  NANQNSMLILQESCADASGALVVYSPIDIPAANVVM  607



>ref|XP_002526595.1| Homeobox protein GLABRA2, putative [Ricinus communis]
 gb|EEF35807.1| Homeobox protein GLABRA2, putative [Ricinus communis]
Length=546

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            S+NNML+L+ESC D  GSLVVY P+D+P++N+A+
Sbjct  418  SENNMLMLQESCTDPSGSLVVYAPVDIPSMNIAI  451



>ref|XP_010091553.1| Homeobox-leucine zipper protein ANTHOCYANINLESS 2 [Morus notabilis]
 gb|EXB44738.1| Homeobox-leucine zipper protein ANTHOCYANINLESS 2 [Morus notabilis]
Length=860

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +T+Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  726  NTNQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  761



>ref|XP_004306832.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
[Fragaria vesca subsp. vesca]
Length=830

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +QN+MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  699  NANQNSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  734



>tpg|DAA05771.1| TPA_inf: class IV HD-Zip protein HDZ41 [Selaginella moellendorffii]
Length=815

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +TSQ+NMLIL+ES  D  GSL+VY P+D+PA+N+ M
Sbjct  693  NTSQSNMLILQESSTDESGSLIVYAPVDIPAMNLVM  728



>ref|XP_004954073.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform 
X2 [Setaria italica]
Length=709

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
             SQN++LIL+ESC D+ GSLVVY P+D+PA N+ M
Sbjct  580  ASQNSILILQESCTDASGSLVVYAPIDVPAANVVM  614



>ref|XP_004954072.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform 
X1 [Setaria italica]
Length=711

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
             SQN++LIL+ESC D+ GSLVVY P+D+PA N+ M
Sbjct  582  ASQNSILILQESCTDASGSLVVYAPIDVPAANVVM  616



>ref|XP_009388746.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++ QN MLIL+E C D+ GS++VY+P+DLPAIN+ M
Sbjct  573  NSGQNTMLILQECCTDAYGSVIVYSPVDLPAINIVM  608



>tpg|DAA05775.1| TPA_inf: class IV HD-Zip protein HDZ41 [Physcomitrella patens]
Length=799

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC D  GSLV+Y P+D+PA+N+ +
Sbjct  672  NSSQSNMLILQESCTDVSGSLVIYAPVDIPAMNLVL  707



>ref|XP_011091721.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
[Sesamum indicum]
Length=828

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  703  NSSQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  738



>gb|KDO75529.1| hypothetical protein CISIN_1g045292mg [Citrus sinensis]
Length=673

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NML+L+ESC DS GS V+Y P+D+ A+NM +
Sbjct  552  NSSQSNMLVLQESCTDSTGSYVIYAPVDIVAMNMVL  587



>ref|XP_002988402.1| hypothetical protein SELMODRAFT_450553 [Selaginella moellendorffii]
 gb|EFJ10492.1| hypothetical protein SELMODRAFT_450553 [Selaginella moellendorffii]
Length=817

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAMM  158
            +++ +NMLIL+ESC D  GSLVVY P+D+PA+N+ M 
Sbjct  693  NSTHSNMLILQESCTDDSGSLVVYAPVDIPAMNLVMQ  729



>gb|EYU17789.1| hypothetical protein MIMGU_mgv1a002049mg [Erythranthe guttata]
Length=721

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+N LIL+ESC+DS GS VVY P+DL A+N+AM
Sbjct  589  NSSQSNTLILQESCMDSSGSTVVYCPVDLQAVNIAM  624



>ref|XP_009380061.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Musa acuminata 
subsp. malaccensis]
Length=696

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  60   NNMLILEESCIDSPGSLVVYNPLDLPAINMAMM*MKSFNIHV  185
            +NMLIL+ESC D+ GS+VVY+P+DLPA+N  M       IH+
Sbjct  577  HNMLILQESCTDASGSVVVYSPIDLPAMNTIMSGEDPSYIHI  618



>ref|XP_002979015.1| hypothetical protein SELMODRAFT_450554 [Selaginella moellendorffii]
 gb|EFJ19972.1| hypothetical protein SELMODRAFT_450554 [Selaginella moellendorffii]
Length=786

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAMM  158
            +++ +NMLIL+ESC D  GSLVVY P+D+PA+N+ M 
Sbjct  662  NSTHSNMLILQESCTDDSGSLVVYAPVDIPAMNLVMQ  698



>tpg|DAA05774.1| TPA_inf: class IV HD-Zip protein HDZ44 [Selaginella moellendorffii]
Length=786

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAMM  158
            +++ +NMLIL+ESC D  GSLVVY P+D+PA+N+ M 
Sbjct  662  NSTHSNMLILQESCTDDSGSLVVYAPVDIPAMNLVMQ  698



>ref|XP_006390565.1| hypothetical protein EUTSA_v10018189mg [Eutrema salsugineum]
 gb|ESQ27851.1| hypothetical protein EUTSA_v10018189mg [Eutrema salsugineum]
Length=726

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  60   NNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            NNMLIL+ES IDS G+LVVY+P+DL A+N+AM
Sbjct  595  NNMLILQESSIDSSGALVVYSPVDLAALNIAM  626



>gb|EYU28567.1| hypothetical protein MIMGU_mgv1a017824mg, partial [Erythranthe 
guttata]
Length=573

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ++MLIL+E+CID+ G+LVVY P+D+PA+++ M
Sbjct  447  NSSQSSMLILQETCIDAAGALVVYAPVDIPAMHLVM  482



>gb|EPS72360.1| hypothetical protein M569_02398 [Genlisea aurea]
Length=843

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q+NMLIL+E+C+D+ GSLVVY P+D+PA+++ M
Sbjct  688  NANQSNMLILQETCVDAAGSLVVYAPVDIPAMHVVM  723



>ref|XP_009793614.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana 
sylvestris]
 ref|XP_009793615.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana 
sylvestris]
 ref|XP_009793618.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana 
sylvestris]
Length=727

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQNNMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  606  NSSQNNMLILQESCTDSTGSYVIYAPVDIAAMNVVL  641



>ref|XP_009609608.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009609609.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009609610.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=727

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQNNMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  606  NSSQNNMLILQESCTDSTGSYVIYAPVDIAAMNVVL  641



>ref|XP_009609606.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 
2-like isoform X1 [Nicotiana tomentosiformis]
Length=758

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQNNMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  637  NSSQNNMLILQESCTDSTGSYVIYAPVDIAAMNVVL  672



>ref|XP_008787891.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform 
X1 [Phoenix dactylifera]
Length=698

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +++Q+NMLIL+ESCID+ GSLVVY  +DLP++N  M
Sbjct  576  NSAQSNMLILQESCIDASGSLVVYTSVDLPSLNNVM  611



>ref|XP_008787892.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform 
X2 [Phoenix dactylifera]
Length=687

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +++Q+NMLIL+ESCID+ GSLVVY  +DLP++N  M
Sbjct  565  NSAQSNMLILQESCIDASGSLVVYTSVDLPSLNNVM  600



>ref|XP_006352605.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006352606.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform 
X2 [Solanum tuberosum]
Length=712

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQNNMLIL+ESC+D+ GS V+Y P+D+ A+N+ +
Sbjct  597  NSSQNNMLILQESCLDTTGSYVIYAPVDIAAMNVVL  632



>emb|CAN76162.1| hypothetical protein VITISV_016297 [Vitis vinifera]
Length=120

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  66   MLILEESCIDSPGSLVVYNPLDLPAINMAMM*MKSFNIHV  185
            ML+L+ESC++  G LVVY P+D+PAIN+A+   +S NI +
Sbjct  1    MLMLQESCVEPLGGLVVYAPIDIPAINVAIRGEESGNIPI  40



>ref|XP_006396268.1| hypothetical protein EUTSA_v10028440mg [Eutrema salsugineum]
 gb|ESQ37721.1| hypothetical protein EUTSA_v10028440mg [Eutrema salsugineum]
Length=795

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ G+LVVY P+D+PA+N+ M
Sbjct  676  NANQSSMLILQETCIDASGALVVYAPVDIPAMNVVM  711



>emb|CDX91894.1| BnaC03g31960D [Brassica napus]
Length=794

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ G+LVVY P+D+PA+N+ M
Sbjct  679  NANQSSMLILQETCIDASGALVVYAPVDIPAMNVVM  714



>dbj|BAJ34339.1| unnamed protein product [Thellungiella halophila]
Length=795

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ G+LVVY P+D+PA+N+ M
Sbjct  676  NANQSSMLILQETCIDASGALVVYAPVDIPAMNVVM  711



>ref|XP_009340632.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like, 
partial [Pyrus x bretschneideri]
Length=427

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  57   QNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            Q +MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  296  QGSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  328



>emb|CDX74347.1| BnaA03g27000D [Brassica napus]
Length=793

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ G+LVVY P+D+PA+N+ M
Sbjct  678  NANQSSMLILQETCIDASGALVVYAPVDIPAMNVVM  713



>ref|XP_009104812.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Brassica 
rapa]
Length=705

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +  NNMLIL+E+ IDS G+LVVY+P+DL A+N+AM
Sbjct  576  SQSNNMLILQETSIDSSGALVVYSPVDLSALNIAM  610



>ref|XP_009134533.1| PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein 
ANTHOCYANINLESS 2 [Brassica rapa]
Length=793

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ G+LVVY P+D+PA+N+ M
Sbjct  678  NANQSSMLILQETCIDASGALVVYAPVDIPAMNVVM  713



>ref|XP_007132557.1| hypothetical protein PHAVU_011G104700g [Phaseolus vulgaris]
 gb|ESW04551.1| hypothetical protein PHAVU_011G104700g [Phaseolus vulgaris]
Length=719

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  606  NSSQSNMLILQESCTDSTGSFVIYAPVDIVAMNVVL  641



>ref|XP_010255501.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 
[Nelumbo nucifera]
Length=811

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q+NMLIL+E+C D+ GSLVVY P+D+PA+++ M
Sbjct  681  NANQSNMLILQETCFDASGSLVVYAPVDIPAMHVVM  716



>emb|CDX68229.1| BnaA07g22690D [Brassica napus]
Length=703

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +  NNMLIL+E+ IDS G+LVVY+P+DL A+N+AM
Sbjct  574  SQSNNMLILQETSIDSSGALVVYSPVDLSALNIAM  608



>emb|CDY11109.1| BnaC06g23610D [Brassica napus]
Length=710

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +  NNMLIL+E+ IDS G+LVVY+P+DL A+N+AM
Sbjct  581  SQSNNMLILQETSIDSSGALVVYSPVDLSALNIAM  615



>gb|KHN36536.1| Homeobox-leucine zipper protein HDG2 [Glycine soja]
Length=726

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  608  NSSQSNMLILQESCADSTGSFVIYAPVDIVAMNVVL  643



>ref|XP_010038600.1| PREDICTED: homeobox-leucine zipper protein HDG2-like [Eucalyptus 
grandis]
 gb|KCW46994.1| hypothetical protein EUGRSUZ_K00800 [Eucalyptus grandis]
Length=726

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC D+ GS VVY P+D+ A+N+ +
Sbjct  616  NSSQSNMLILQESCTDATGSFVVYAPVDIVAMNVVL  651



>gb|KHN30455.1| Homeobox-leucine zipper protein PROTODERMAL FACTOR 2 [Glycine 
soja]
Length=688

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  36   LLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + L ++SQ+NMLIL+ESC DS GS VVY P+D+ A+N+ +
Sbjct  564  IYLANSSQSNMLILQESCTDSTGSYVVYAPVDIVAMNVVL  603



>ref|XP_010089514.1| hypothetical protein L484_000624 [Morus notabilis]
 gb|EXC36259.1| hypothetical protein L484_000624 [Morus notabilis]
Length=526

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++NNML+L+ESCID  GSL+VY P+D+  +NMA+
Sbjct  400  TENNMLMLQESCIDRLGSLIVYAPIDVTTLNMAI  433



>ref|XP_003528880.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
isoform X1 [Glycine max]
Length=829

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +++Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  701  NSNQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  736



>ref|XP_003581542.1| PREDICTED: homeobox-leucine zipper protein ROC4 [Brachypodium 
distachyon]
Length=790

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +T QN +LIL+E+C D+ GS+VVY P+D+PA+++ M
Sbjct  675  NTQQNGILILQETCTDASGSMVVYAPVDIPAMHLVM  710



>ref|XP_006576359.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
isoform X2 [Glycine max]
Length=836

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +++Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  703  NSNQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  738



>ref|XP_003555330.2| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Glycine 
max]
Length=731

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  45   QHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            Q+  QNNMLIL+ES ID+ GS V+Y P+D+ AIN+ +
Sbjct  609  QNVGQNNMLILQESFIDATGSFVIYAPIDVAAINVVL  645



>ref|XP_006583340.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
isoform X2 [Glycine max]
Length=828

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +++Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  700  NSNQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  735



>emb|CAN61351.1| hypothetical protein VITISV_023503 [Vitis vinifera]
Length=784

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  660  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  695



>ref|XP_010278578.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
isoform X2 [Nelumbo nucifera]
Length=813

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  686  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHLVM  721



>tpg|DAA05777.1| TPA_inf: class IV HD-Zip protein HDZ43 [Physcomitrella patens]
Length=799

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +++Q+NMLIL+ESC D  GSLV+Y P+D+PA+N+ +
Sbjct  672  NSNQSNMLILQESCTDVSGSLVIYAPVDIPAMNLVL  707



>ref|XP_006594896.1| PREDICTED: homeobox-leucine zipper protein HDG2 isoform X3 [Glycine 
max]
Length=776

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  658  NSSQSNMLILQESCADSTGSFVIYAPVDIVAMNVVL  693



>gb|KHN15800.1| Homeobox-leucine zipper protein MERISTEM L1 [Glycine soja]
Length=729

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  45   QHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            Q+  QNNMLIL+ES ID+ GS V+Y P+D+ AIN+ +
Sbjct  607  QNVGQNNMLILQESFIDATGSFVIYAPIDVAAINVVL  643



>ref|XP_003543387.1| PREDICTED: homeobox-leucine zipper protein HDG2 isoform X1 [Glycine 
max]
 ref|XP_006594895.1| PREDICTED: homeobox-leucine zipper protein HDG2 isoform X2 [Glycine 
max]
Length=781

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  663  NSSQSNMLILQESCADSTGSFVIYAPVDIVAMNVVL  698



>ref|XP_003521284.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
isoform X1 [Glycine max]
Length=835

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +++Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  702  NSNQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  737



>ref|NP_177479.1| homeobox-leucine zipper protein HDG11 [Arabidopsis thaliana]
 sp|Q9FX31.1|HDG11_ARATH RecName: Full=Homeobox-leucine zipper protein HDG11; AltName: 
Full=HD-ZIP protein HDG11; AltName: Full=Homeodomain GLABRA 
2-like protein 11; AltName: Full=Homeodomain transcription 
factor HDG11; AltName: Full=Protein HOMEODOMAIN GLABROUS 11 
[Arabidopsis thaliana]
 gb|AAG30978.1|AC012396_14 homeobox protein, putative [Arabidopsis thaliana]
 gb|AAO42020.1| putative homeobox protein [Arabidopsis thaliana]
 gb|AAO50448.1| putative homeobox protein [Arabidopsis thaliana]
 gb|AEE35449.1| homeobox-leucine zipper protein HDG11 [Arabidopsis thaliana]
Length=722

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            T  NNMLIL+ES  DS G+ VVY+P+DL A+N+AM
Sbjct  595  THSNNMLILQESSTDSSGAFVVYSPVDLAALNIAM  629



>ref|XP_010278577.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
isoform X1 [Nelumbo nucifera]
Length=818

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  691  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHLVM  726



>gb|AAC79430.1| homeodomain protein [Malus domestica]
Length=653

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q +MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  519  NANQGSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  554



>ref|XP_011035097.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 
[Populus euphratica]
Length=823

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +++Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  692  NSNQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  727



>emb|CBI38766.3| unnamed protein product [Vitis vinifera]
Length=771

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  647  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  682



>ref|XP_002272264.2| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 
isoform X1 [Vitis vinifera]
 ref|XP_010661561.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 
isoform X1 [Vitis vinifera]
Length=811

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  687  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  722



>ref|XP_010657313.1| PREDICTED: homeobox-leucine zipper protein HDG2 isoform X5 [Vitis 
vinifera]
 ref|XP_010657315.1| PREDICTED: homeobox-leucine zipper protein HDG2 isoform X5 [Vitis 
vinifera]
Length=725

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS  S V+Y P+D+ A+NM +
Sbjct  607  NSSQSNMLILQESCTDSTASFVIYAPVDVVAMNMVL  642



>ref|XP_010661562.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 
isoform X2 [Vitis vinifera]
Length=810

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  686  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  721



>ref|XP_009382297.1| PREDICTED: homeobox-leucine zipper protein ROC5-like [Musa acuminata 
subsp. malaccensis]
Length=802

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/36 (53%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+C D+ GSLVVY P+D+PA+++ M
Sbjct  693  NATQSSMLILQETCTDASGSLVVYAPVDIPAMHLVM  728



>ref|XP_010657309.1| PREDICTED: homeobox-leucine zipper protein HDG2 isoform X1 [Vitis 
vinifera]
Length=790

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS  S V+Y P+D+ A+NM +
Sbjct  672  NSSQSNMLILQESCTDSTASFVIYAPVDVVAMNMVL  707



>ref|XP_010939971.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Elaeis 
guineensis]
Length=698

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +Q+NMLIL+ESCID+ GSLVVY  +DLP++N  M
Sbjct  578  AQSNMLILQESCIDASGSLVVYASIDLPSLNDVM  611



>ref|XP_010657310.1| PREDICTED: homeobox-leucine zipper protein HDG2 isoform X2 [Vitis 
vinifera]
Length=721

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS  S V+Y P+D+ A+NM +
Sbjct  603  NSSQSNMLILQESCTDSTASFVIYAPVDVVAMNMVL  638



>ref|XP_008460172.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 
[Cucumis melo]
Length=840

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  709  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  744



>gb|KHN44879.1| Homeobox-leucine zipper protein HDG2 [Glycine soja]
Length=732

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  614  NSSQSNMLILQESCADSTGSFVIYAPVDIVAMNVVL  649



>ref|XP_004144982.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
[Cucumis sativus]
 ref|XP_004153804.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
[Cucumis sativus]
 ref|XP_004168157.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
[Cucumis sativus]
 gb|KGN46199.1| hypothetical protein Csa_6G074030 [Cucumis sativus]
Length=841

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  710  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  745



>emb|CDP08876.1| unnamed protein product [Coffea canephora]
Length=830

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  706  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  741



>ref|XP_002511801.1| homeobox protein, putative [Ricinus communis]
 gb|EEF50470.1| homeobox protein, putative [Ricinus communis]
Length=825

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  698  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  733



>gb|KFK41777.1| hypothetical protein AALP_AA2G170800 [Arabis alpina]
Length=726

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +3

Query  60   NNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            NNMLIL+ES ID+ G+LVVY+P+DL ++N+AM
Sbjct  596  NNMLILQESSIDTSGALVVYSPVDLSSVNIAM  627



>ref|XP_010657312.1| PREDICTED: homeobox-leucine zipper protein HDG2 isoform X4 [Vitis 
vinifera]
Length=755

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS  S V+Y P+D+ A+NM +
Sbjct  637  NSSQSNMLILQESCTDSTASFVIYAPVDVVAMNMVL  672



>gb|KHG16285.1| Homeobox-leucine zipper ANTHOCYANINLESS 2 -like protein [Gossypium 
arboreum]
Length=820

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  691  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  726



>ref|XP_008385703.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
isoform X1 [Malus domestica]
Length=825

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q +MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  691  NANQGSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  726



>gb|KDP28682.1| hypothetical protein JCGZ_14453 [Jatropha curcas]
Length=819

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  690  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  725



>ref|XP_008385704.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
isoform X2 [Malus domestica]
Length=824

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q +MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  690  NANQGSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  725



>ref|XP_004510857.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like 
[Cicer arietinum]
Length=807

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +++Q++MLIL+E+CID  GSLVVY P+D+PA+++ M
Sbjct  684  NSNQSSMLILQETCIDEAGSLVVYAPVDIPAMHVVM  719



>ref|XP_007051912.1| HD domain class transcription factor isoform 1 [Theobroma cacao]
 gb|EOX96069.1| HD domain class transcription factor isoform 1 [Theobroma cacao]
Length=819

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  689  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  724



>ref|XP_006851770.1| hypothetical protein AMTR_s00040p00231210 [Amborella trichopoda]
 gb|ERN13237.1| hypothetical protein AMTR_s00040p00231210 [Amborella trichopoda]
Length=811

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ++MLIL+E+C D+ GSLVVY P+D+PA+++ M
Sbjct  682  NSSQSSMLILQETCTDAAGSLVVYAPVDIPAMHVVM  717



>ref|XP_002320755.1| homeodomain family protein [Populus trichocarpa]
 gb|EEE99070.1| homeodomain family protein [Populus trichocarpa]
Length=823

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  692  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  727



>ref|XP_007134961.1| hypothetical protein PHAVU_010G090300g [Phaseolus vulgaris]
 gb|ESW06955.1| hypothetical protein PHAVU_010G090300g [Phaseolus vulgaris]
Length=831

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +++Q++MLIL+E+CID  GSLVVY P+D+PA+++ M
Sbjct  703  NSNQSSMLILQETCIDEAGSLVVYAPVDIPAMHVVM  738



>emb|CAH67034.1| OSIGBa0139P06.7 [Oryza sativa Indica Group]
Length=805

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  57   QNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            QN+MLIL+E+C D+ GS+VVY P+D+PA+++ M
Sbjct  695  QNSMLILQETCADASGSMVVYAPVDIPAMHLVM  727



>ref|NP_001053595.1| Os04g0569100 [Oryza sativa Japonica Group]
 emb|CAD41424.2| OSJNBb0032E06.7 [Oryza sativa Japonica Group]
 dbj|BAF15509.1| Os04g0569100 [Oryza sativa Japonica Group]
Length=806

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  57   QNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            QN+MLIL+E+C D+ GS+VVY P+D+PA+++ M
Sbjct  696  QNSMLILQETCADASGSMVVYAPVDIPAMHLVM  728



>gb|KEH18947.1| homeobox leucine zipper protein [Medicago truncatula]
Length=810

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +++Q++MLIL+E+CID  GSLVVY P+D+PA+++ M
Sbjct  685  NSNQSSMLILQETCIDEAGSLVVYAPVDIPAMHVVM  720



>ref|XP_007051913.1| HD domain class transcription factor isoform 2 [Theobroma cacao]
 gb|EOX96070.1| HD domain class transcription factor isoform 2 [Theobroma cacao]
Length=818

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  688  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  723



>dbj|BAC77157.1| GL2-type homeodomain protein [Oryza sativa Japonica Group]
Length=813

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  57   QNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            QN+MLIL+E+C D+ GS+VVY P+D+PA+++ M
Sbjct  703  QNSMLILQETCADASGSMVVYAPVDIPAMHLVM  735



>sp|Q7Y0V9.2|ROC4_ORYSJ RecName: Full=Homeobox-leucine zipper protein ROC4; AltName: 
Full=GLABRA 2-like homeobox protein 4; AltName: Full=HD-ZIP 
protein ROC4; AltName: Full=Homeodomain transcription factor 
ROC4; AltName: Full=Protein RICE OUTERMOST CELL-SPECIFIC 4 
[Oryza sativa Japonica Group]
Length=813

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  57   QNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            QN+MLIL+E+C D+ GS+VVY P+D+PA+++ M
Sbjct  703  QNSMLILQETCADASGSMVVYAPVDIPAMHLVM  735



>ref|XP_006287095.1| hypothetical protein CARUB_v10000257mg [Capsella rubella]
 gb|EOA19993.1| hypothetical protein CARUB_v10000257mg [Capsella rubella]
Length=794

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q+ MLIL+E+CIDS G+LVVY P+D+PA+N+ M
Sbjct  674  NANQSCMLILQETCIDSSGALVVYAPVDIPAMNVVM  709



>ref|XP_003570542.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Brachypodium 
distachyon]
Length=713

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + SQN+MLIL+ES  D+ GS VVY P+DLPA N+ M
Sbjct  601  NASQNSMLILQESSTDATGSQVVYAPIDLPAANVVM  636



>ref|XP_010416135.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Camelina 
sativa]
Length=721

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +  NNMLIL+ES  DS G+LVVY+P+DL A+N+AM
Sbjct  595  SQSNNMLILQESSTDSSGALVVYSPVDLAALNIAM  629



>ref|XP_010053664.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 
[Eucalyptus grandis]
 gb|KCW78016.1| hypothetical protein EUGRSUZ_D02248 [Eucalyptus grandis]
Length=840

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  710  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  745



>gb|EEE61524.1| hypothetical protein OsJ_15826 [Oryza sativa Japonica Group]
Length=833

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  57   QNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            QN+MLIL+E+C D+ GS+VVY P+D+PA+++ M
Sbjct  723  QNSMLILQETCADASGSMVVYAPVDIPAMHLVM  755



>gb|KHG01515.1| Homeobox-leucine zipper ROC6 [Gossypium arboreum]
Length=737

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  610  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  645



>ref|XP_009105998.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Brassica rapa]
Length=717

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +  NNMLIL+E+ IDS  +LVVY+P+DLPA+N+AM
Sbjct  588  SQSNNMLILQETSIDSSVALVVYSPVDLPALNIAM  622



>gb|EEC77821.1| hypothetical protein OsI_17027 [Oryza sativa Indica Group]
Length=849

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  57   QNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            QN+MLIL+E+C D+ GS+VVY P+D+PA+++ M
Sbjct  739  QNSMLILQETCADASGSMVVYAPVDIPAMHLVM  771



>ref|XP_010471396.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Camelina 
sativa]
Length=724

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +  NNMLIL+ES  DS G+LVVY+P+DL A+N+AM
Sbjct  594  SQSNNMLILQESSTDSSGALVVYSPVDLAALNIAM  628



>gb|ACB73218.1| homeodomain protein GL2-like 1 [Gossypium hirsutum]
Length=772

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  645  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  680



>gb|KDO41372.1| hypothetical protein CISIN_1g0042941mg, partial [Citrus sinensis]
Length=156

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  33   CLLLQHTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            CL   ++SQ+NMLIL+ESC D   S V+Y P+D+ A+N+ +
Sbjct  33   CLQSANSSQSNMLILQESCTDPTASFVIYAPVDIVAMNVVL  73



>ref|XP_011000687.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Populus 
euphratica]
 ref|XP_011000688.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Populus 
euphratica]
 ref|XP_011000689.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Populus 
euphratica]
 ref|XP_011000690.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Populus 
euphratica]
Length=720

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS VVY P+D+ A+N+ +
Sbjct  602  NSSQSNMLILQESCTDSTGSYVVYAPVDISAMNIVL  637



>ref|XP_004134971.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 
2-like [Cucumis sativus]
 gb|KGN49126.1| hypothetical protein Csa_6G514870 [Cucumis sativus]
Length=721

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D  A+N+ +
Sbjct  600  NSSQSNMLILQESCTDSTGSYVIYAPVDTVAMNVVL  635



>ref|XP_008439968.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 
2 [Cucumis melo]
 ref|XP_008439969.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 
2 [Cucumis melo]
 ref|XP_008439970.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 
2 [Cucumis melo]
Length=721

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D  A+N+ +
Sbjct  600  NSSQSNMLILQESCTDSTGSYVIYAPVDTVAMNVVL  635



>ref|XP_007220256.1| hypothetical protein PRUPE_ppa001436mg [Prunus persica]
 gb|EMJ21455.1| hypothetical protein PRUPE_ppa001436mg [Prunus persica]
Length=829

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CIDS G LVVY P+D+PA+++ M
Sbjct  696  NANQSSMLILQETCIDSAGGLVVYAPVDIPAMHVVM  731



>ref|XP_010428260.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Camelina sativa]
Length=726

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  60   NNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            NNMLIL+ES  DS G+LVVY+P+DL A+N+AM
Sbjct  598  NNMLILQESSTDSSGALVVYSPVDLSALNIAM  629



>gb|KFK30650.1| hypothetical protein AALP_AA6G009600, partial [Arabis alpina]
Length=300

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ G+LVVY P+D+PA+++ M
Sbjct  184  NANQSSMLILQETCIDASGALVVYAPVDIPAMHVVM  219



>ref|XP_011093166.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 
isoform X1 [Sesamum indicum]
Length=835

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  711  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  746



>ref|XP_011093167.1| PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 
isoform X2 [Sesamum indicum]
Length=834

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D+PA+++ M
Sbjct  710  NANQSSMLILQETCIDAAGSLVVYAPVDIPAMHVVM  745



>ref|XP_006468235.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Citrus 
sinensis]
Length=718

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NML+L+ESC DS GS V+Y P+D+ A+NM +
Sbjct  597  NSSQSNMLVLQESCTDSTGSYVIYAPVDIVAMNMVL  632



>ref|XP_006582046.1| PREDICTED: homeobox-leucine zipper protein HDG2-like [Glycine 
max]
Length=122

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC +S GS V+Y P+D+ A+N+ +
Sbjct  23   NSSQSNMLILQESCTNSTGSFVIYAPVDIVAMNVVL  58



>ref|XP_006449076.1| hypothetical protein CICLE_v10014424mg [Citrus clementina]
 ref|XP_006449077.1| hypothetical protein CICLE_v10014424mg [Citrus clementina]
 gb|ESR62316.1| hypothetical protein CICLE_v10014424mg [Citrus clementina]
 gb|ESR62317.1| hypothetical protein CICLE_v10014424mg [Citrus clementina]
Length=718

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NML+L+ESC DS GS V+Y P+D+ A+NM +
Sbjct  597  NSSQSNMLVLQESCTDSTGSYVIYAPVDIVAMNMVL  632



>ref|XP_002305602.1| PROTODERMAL FACTOR2 family protein [Populus trichocarpa]
 gb|EEE86113.1| PROTODERMAL FACTOR2 family protein [Populus trichocarpa]
Length=725

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  607  NSSQSNMLILQESCTDSTGSYVIYAPVDISAMNIVL  642



>ref|XP_010275996.1| PREDICTED: homeobox-leucine zipper protein HDG2-like [Nelumbo 
nucifera]
 ref|XP_010275997.1| PREDICTED: homeobox-leucine zipper protein HDG2-like [Nelumbo 
nucifera]
Length=758

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GSLV+Y P+D+ A+N+ +
Sbjct  645  NSSQSNMLILQESCTDSTGSLVIYAPVDVVAMNVVL  680



>ref|XP_006301097.1| hypothetical protein CARUB_v10021491mg [Capsella rubella]
 gb|EOA33995.1| hypothetical protein CARUB_v10021491mg [Capsella rubella]
Length=724

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  60   NNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            NNMLIL+ES  DS G+LV+Y+P+DL A+N+AM
Sbjct  597  NNMLILQESSTDSAGALVIYSPVDLAALNIAM  628



>ref|XP_011037708.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Populus 
euphratica]
 ref|XP_011037709.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Populus 
euphratica]
 ref|XP_011037710.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Populus 
euphratica]
 ref|XP_011037711.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Populus 
euphratica]
Length=725

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  607  NSSQSNMLILQESCTDSTGSYVIYAPVDISAMNIVL  642



>ref|XP_008799024.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Phoenix 
dactylifera]
Length=821

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++S +NMLIL+ESCID+ GSL+ Y  +DLP++NM M
Sbjct  576  NSSPSNMLILQESCIDASGSLIAYASVDLPSLNMVM  611



>tpg|DAA05776.1| TPA_inf: class IV HD-Zip protein HDZ42 [Physcomitrella patens]
Length=794

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            +T+ +NMLIL+ESC D  GSLV+Y P+D+PA+N+ +
Sbjct  667  NTNNSNMLILQESCTDVSGSLVIYAPVDIPAMNLVL  702



>ref|XP_009802527.1| PREDICTED: homeobox-leucine zipper protein HDG2-like isoform 
X4 [Nicotiana sylvestris]
Length=750

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAIN  146
            +SQNNMLIL+ES  D  GS VVY P+D+PA+N
Sbjct  638  SSQNNMLILQESSTDPTGSFVVYAPVDVPAMN  669



>ref|XP_009802526.1| PREDICTED: homeobox-leucine zipper protein HDG2-like isoform 
X3 [Nicotiana sylvestris]
Length=751

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAIN  146
            +SQNNMLIL+ES  D  GS VVY P+D+PA+N
Sbjct  639  SSQNNMLILQESSTDPTGSFVVYAPVDVPAMN  670



>ref|XP_009802525.1| PREDICTED: homeobox-leucine zipper protein HDG2-like isoform 
X2 [Nicotiana sylvestris]
Length=751

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAIN  146
            +SQNNMLIL+ES  D  GS VVY P+D+PA+N
Sbjct  639  SSQNNMLILQESSTDPTGSFVVYAPVDVPAMN  670



>ref|XP_002301331.2| homeodomain family protein [Populus trichocarpa]
 gb|EEE80604.2| homeodomain family protein [Populus trichocarpa]
Length=820

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ GSLVVY P+D PA+++ M
Sbjct  692  NANQSSMLILQETCIDAAGSLVVYAPVDTPAMHVVM  727



>ref|XP_009802524.1| PREDICTED: homeobox-leucine zipper protein HDG2-like isoform 
X1 [Nicotiana sylvestris]
Length=752

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  51   TSQNNMLILEESCIDSPGSLVVYNPLDLPAIN  146
            +SQNNMLIL+ES  D  GS VVY P+D+PA+N
Sbjct  640  SSQNNMLILQESSTDPTGSFVVYAPVDVPAMN  671



>ref|XP_010523728.1| PREDICTED: homeobox-leucine zipper protein HDG1-like [Tarenaya 
hassleriana]
Length=806

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 36/49 (73%), Gaps = 5/49 (10%)
 Frame = +3

Query  24   LSGCLLLQHTS-----QNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            LS C+ L   S     Q++ML+L+E+CID+ G+LVVY P+D+PA+++ M
Sbjct  686  LSNCVSLLRASAMNANQSSMLVLQETCIDTAGALVVYAPVDIPAMHVVM  734



>ref|XP_004155671.1| PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 
2-like [Cucumis sativus]
Length=549

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D  A+N+ +
Sbjct  428  NSSQSNMLILQESCTDSTGSYVIYAPVDTVAMNVVL  463



>ref|XP_004248397.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Solanum 
lycopersicum]
 ref|XP_010327237.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Solanum 
lycopersicum]
 ref|XP_010327238.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Solanum 
lycopersicum]
Length=712

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQNNMLIL+ESC+D  GS V+Y P+D+ A+N+ +
Sbjct  597  NSSQNNMLILQESCLDITGSYVIYAPVDIAAMNVVL  632



>ref|XP_002317205.1| PROTODERMAL FACTOR2 family protein [Populus trichocarpa]
 gb|EEE97817.1| PROTODERMAL FACTOR2 family protein [Populus trichocarpa]
Length=720

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  602  NSSQSNMLILQESCTDSTGSYVIYAPVDISAMNIVL  637



>gb|KDP20783.1| hypothetical protein JCGZ_21254 [Jatropha curcas]
Length=723

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  604  NSSQSNMLILQESCTDSTGSYVIYAPVDIAAMNIVL  639



>gb|AAC13617.1| Arabidopsis thaliana homeodomain protein AHDP (SP:P93041) [Arabidopsis 
thaliana]
 emb|CAB80882.1| homeodomain protein AHDP [Arabidopsis thaliana]
Length=590

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ G+LVVY P+D+PA+++ M
Sbjct  470  NANQSSMLILQETCIDASGALVVYAPVDIPAMHVVM  505



>ref|XP_010051064.1| PREDICTED: homeobox-leucine zipper protein HDG2 [Eucalyptus grandis]
 ref|XP_010051072.1| PREDICTED: homeobox-leucine zipper protein HDG2 [Eucalyptus grandis]
 gb|KCW89415.1| hypothetical protein EUGRSUZ_A01715 [Eucalyptus grandis]
 gb|KCW89416.1| hypothetical protein EUGRSUZ_A01715 [Eucalyptus grandis]
 gb|KCW89417.1| hypothetical protein EUGRSUZ_A01715 [Eucalyptus grandis]
Length=772

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS V+Y P+D+ A+N+ +
Sbjct  652  NSSQSNMLILQESCTDSAGSFVIYAPVDIVAMNVVL  687



>ref|XP_008343137.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Malus domestica]
Length=667

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  54   SQNNMLILEESCIDSPGSLVVYNPLDLPAINMAMM*MKSFNIHV  185
            ++NNML+L+ES  D  GSLVVY P+D+PA+N+A+    S NI +
Sbjct  549  TENNMLMLQESYTDPLGSLVVYAPVDMPALNVAVSGKDSSNIPI  592



>gb|AAB41901.1| homeodomain protein AHDP [Arabidopsis thaliana]
Length=745

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            + +Q++MLIL+E+CID+ G+LVVY P+D+PA+++ M
Sbjct  642  NANQSSMLILQETCIDASGALVVYAPVDIPAMHVVM  677



>ref|XP_006573890.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like isoform 
X2 [Glycine max]
Length=615

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  48   HTSQNNMLILEESCIDSPGSLVVYNPLDLPAINMAM  155
            ++SQ+NMLIL+ESC DS GS VVY P+D+ A+N+ +
Sbjct  495  NSSQSNMLILQESCTDSTGSYVVYAPVDIVAMNVVL  530



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513730317888