BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c100209_g1_i1 len=219 path=[1:0-218]

Length=219
                                                                      Score     E

ref|XP_009608808.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  69.7    4e-12   
ref|XP_009608807.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  70.1    5e-12   
gb|EPS59156.1|  hypothetical protein M569_15654                       67.0    9e-12   
ref|XP_010667675.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  67.8    1e-11   
gb|KDO47755.1|  hypothetical protein CISIN_1g011424mg                 67.8    2e-11   
ref|XP_006471270.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  67.4    3e-11   
ref|XP_004230051.2|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  68.2    3e-11   
gb|KDO47751.1|  hypothetical protein CISIN_1g011424mg                 67.4    4e-11   
ref|XP_006471269.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  67.0    5e-11   
gb|KDO47759.1|  hypothetical protein CISIN_1g011424mg                 67.0    5e-11   
gb|KDO47752.1|  hypothetical protein CISIN_1g011424mg                 67.0    5e-11   
ref|XP_009608806.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  66.2    6e-11   
gb|KDO47758.1|  hypothetical protein CISIN_1g011424mg                 66.6    6e-11   
ref|XP_008354839.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  66.2    7e-11   
ref|XP_008346195.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  66.2    7e-11   
ref|XP_011086111.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  66.6    7e-11   
ref|XP_009355076.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  66.2    7e-11   
ref|XP_006432309.1|  hypothetical protein CICLE_v10001373mg           66.2    8e-11   
ref|XP_006347685.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  66.6    8e-11   
ref|XP_008344548.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  65.1    9e-11   
ref|XP_006432311.1|  hypothetical protein CICLE_v10001373mg           65.9    9e-11   
gb|KDO47760.1|  hypothetical protein CISIN_1g011424mg                 65.9    1e-10   
gb|KDO47763.1|  hypothetical protein CISIN_1g011424mg                 65.9    1e-10   
gb|KDO47762.1|  hypothetical protein CISIN_1g011424mg                 65.9    1e-10   
ref|XP_009608804.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  66.2    1e-10   
ref|XP_008354840.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.9    1e-10   
ref|XP_006347689.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.9    1e-10   
ref|XP_004230048.2|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.9    1e-10   
ref|XP_008346199.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.9    1e-10   
ref|XP_008346187.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.9    1e-10   
ref|XP_010091305.1|  hypothetical protein L484_012198                 65.5    1e-10   
ref|XP_009355075.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.9    1e-10   
gb|KDO47761.1|  hypothetical protein CISIN_1g011424mg                 65.5    2e-10   
ref|XP_009776346.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.5    2e-10   
ref|XP_006347688.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.5    2e-10   
ref|XP_009776347.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.1    2e-10   
ref|XP_004230052.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.1    2e-10   
ref|XP_009776345.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.1    2e-10   
ref|XP_009776344.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.1    3e-10   
ref|XP_006347687.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  65.1    3e-10   
ref|XP_009608805.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  64.3    3e-10   
gb|KDO47764.1|  hypothetical protein CISIN_1g011424mg                 64.3    3e-10   
gb|KCW65123.1|  hypothetical protein EUGRSUZ_G02629                   64.7    3e-10   
ref|XP_009776348.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  64.3    3e-10   
ref|XP_006347684.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  64.7    4e-10   
gb|EMS63644.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1               64.7    4e-10   
ref|XP_006347686.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  64.3    4e-10   
emb|CBX25334.1|  hypothetical_protein                                 62.8    5e-10   
emb|CBX25425.1|  hypothetical_protein                                 63.9    6e-10   
emb|CBX24389.1|  hypothetical_protein                                 63.9    6e-10   
emb|CDY09863.1|  BnaC09g42980D                                        62.4    6e-10   
ref|XP_007217932.1|  hypothetical protein PRUPE_ppa004919mg           63.9    7e-10   
gb|ABA95719.2|  major facilitator superfamily antiporter, putative    63.5    7e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52720.1|  hypothetical protein OsJ_35131                        63.5    7e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662712.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  63.5    8e-10   
ref|XP_006663792.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  63.5    8e-10   
ref|XP_010067060.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  63.5    8e-10   
ref|XP_009410441.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  63.5    8e-10   
gb|EMT23954.1|  Metacaspase-9                                         63.9    8e-10   
gb|EMT05811.1|  Putative membrane protein                             63.5    9e-10   
ref|XP_006663793.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  63.5    9e-10   
emb|CBX25237.1|  hypothetical_protein                                 63.5    9e-10   
gb|KCW65127.1|  hypothetical protein EUGRSUZ_G02630                   63.5    9e-10   
ref|XP_010067061.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  63.5    1e-09   
ref|NP_001066082.1|  Os12g0132500                                     63.2    1e-09   Oryza sativa Japonica Group [Japonica rice]
tpd|FAA00732.1|  TPA: DMA efflux transporter                          63.2    1e-09   
ref|XP_010492151.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  63.2    1e-09   
ref|XP_010237967.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  63.2    1e-09   
ref|NP_001065681.1|  Os11g0134900                                     63.2    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|ABR17390.1|  unknown                                               63.2    1e-09   Picea sitchensis
ref|XP_009355073.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  63.2    1e-09   
ref|XP_009355074.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  63.2    1e-09   
ref|XP_003577876.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  63.2    1e-09   
gb|KCW65124.1|  hypothetical protein EUGRSUZ_G02629                   62.8    1e-09   
ref|XP_010067057.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  62.8    1e-09   
emb|CDY09868.1|  BnaC09g42930D                                        62.8    1e-09   
ref|XP_010237968.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  62.8    2e-09   
ref|XP_010237969.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  62.8    2e-09   
gb|KCW65125.1|  hypothetical protein EUGRSUZ_G02629                   62.4    2e-09   
ref|XP_008796954.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  60.8    2e-09   
dbj|BAK02262.1|  predicted protein                                    62.8    2e-09   
ref|XP_007028171.1|  Zinc induced facilitator-like 1 isoform 3        62.4    2e-09   
ref|XP_008231756.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  62.4    2e-09   
gb|EEC67611.1|  hypothetical protein OsI_34993                        62.4    2e-09   Oryza sativa Indica Group [Indian rice]
tpg|DAA39263.1|  TPA: hypothetical protein ZEAMMB73_384773            60.5    2e-09   
ref|XP_009763181.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  62.4    2e-09   
ref|XP_002307932.2|  hypothetical protein POPTR_0006s02710g           62.4    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010492152.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  62.4    3e-09   
ref|XP_009619333.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  62.4    3e-09   
ref|XP_002527379.1|  carbohydrate transporter, putative               62.0    3e-09   Ricinus communis
ref|XP_007028169.1|  Zinc induced facilitator-like 1 isoform 1        62.0    3e-09   
ref|XP_007028170.1|  Zinc induced facilitator-like 1 isoform 2        61.6    4e-09   
ref|XP_004977470.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  61.6    4e-09   
gb|EEC68817.1|  hypothetical protein OsI_37381                        61.2    4e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_004289280.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.1    4e-09   
ref|XP_011016745.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  59.3    4e-09   
ref|XP_004977466.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  61.6    4e-09   
ref|XP_009121732.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  61.2    4e-09   
ref|XP_009383253.1|  PREDICTED: probable peptide/nitrate transpor...  61.2    5e-09   
ref|XP_010492148.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  61.6    5e-09   
ref|XP_010453469.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  61.6    5e-09   
ref|XP_010419976.1|  PREDICTED: protein ZINC INDUCED FACILITATOR 1    61.6    5e-09   
ref|XP_010068811.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  61.6    5e-09   
ref|XP_006399873.1|  hypothetical protein EUTSA_v10013417mg           61.6    5e-09   
ref|XP_010653665.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  61.6    5e-09   
dbj|BAJ94369.1|  predicted protein                                    61.6    5e-09   
ref|XP_011041314.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  61.2    5e-09   
ref|XP_010419978.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  61.2    5e-09   
gb|EYU20856.1|  hypothetical protein MIMGU_mgv1a005872mg              61.2    5e-09   
ref|XP_007028172.1|  Zinc induced facilitator-like 1 isoform 4        60.5    5e-09   
ref|XP_010453471.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  61.2    5e-09   
ref|XP_003578972.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  61.2    6e-09   
ref|XP_009763182.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  60.8    6e-09   
ref|XP_009776342.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  61.2    6e-09   
ref|XP_009776343.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  61.2    6e-09   
ref|XP_003632620.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  61.2    6e-09   
gb|KFK25600.1|  hypothetical protein AALP_AA8G135600                  60.8    7e-09   
ref|XP_004977469.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.8    7e-09   
ref|XP_009121734.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.8    7e-09   
ref|XP_004977468.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.8    8e-09   
ref|XP_004977467.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.8    8e-09   
gb|ABG21870.1|  major facilitator superfamily antiporter, putativ...  60.1    8e-09   
gb|EYU26916.1|  hypothetical protein MIMGU_mgv1a008860mg              60.5    8e-09   
ref|XP_003577879.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.8    8e-09   
tpd|FAA01135.1|  TPA: efflux transporter of phytosiderophore (mug...  60.8    8e-09   
ref|XP_008676450.1|  PREDICTED: uncharacterized protein LOC100191...  60.8    9e-09   
gb|AFO67942.1|  YS3                                                   60.8    9e-09   
ref|XP_009121731.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.8    9e-09   
ref|XP_004960719.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  60.8    9e-09   
ref|XP_008674224.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.5    9e-09   
gb|ABG21869.1|  major facilitator superfamily antiporter, putativ...  60.5    9e-09   
emb|CDX85629.1|  BnaA02g01840D                                        60.5    1e-08   
ref|XP_009121733.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.5    1e-08   
ref|XP_010453473.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.1    1e-08   
ref|XP_009125940.1|  PREDICTED: protein ZINC INDUCED FACILITATOR 1    60.5    1e-08   
gb|AAN33182.1|  major facilitator superfamily antiporter              60.5    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91322.2|  major facilitator superfamily antiporter, putativ...  60.5    1e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CDY65961.1|  BnaA10g29810D                                        60.5    1e-08   
gb|EEC68818.1|  hypothetical protein OsI_37382                        60.1    1e-08   Oryza sativa Indica Group [Indian rice]
emb|CDY65960.1|  BnaA10g29800D                                        60.5    1e-08   
emb|CDY09820.1|  BnaC09g43410D                                        60.5    1e-08   
emb|CBX24393.1|  hypothetical_protein                                 59.3    1e-08   
ref|XP_011041313.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.5    1e-08   
ref|NP_001066084.1|  Os12g0132800                                     60.5    1e-08   Oryza sativa Japonica Group [Japonica rice]
gb|KHN06906.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1               60.1    1e-08   
ref|XP_010419977.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.5    1e-08   
ref|XP_008364744.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  60.5    1e-08   
ref|NP_568290.3|  zinc induced facilitator-like 1 protein             60.1    1e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63809.1|  transporter-like protein                              60.1    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414365.1|  PREDICTED: probable peptide/nitrate transpor...  60.1    1e-08   
ref|XP_006399872.1|  hypothetical protein EUTSA_v10013388mg           60.1    1e-08   
ref|NP_001130680.1|  uncharacterized protein LOC100191783             60.1    1e-08   Zea mays [maize]
emb|CBX25426.1|  hypothetical_protein                                 60.1    1e-08   
dbj|BAG89474.1|  unnamed protein product                              58.9    1e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CBX25239.1|  hypothetical_protein                                 60.1    1e-08   
gb|ACG25327.1|  carbohydrate transporter/ sugar porter/ transporter   60.1    1e-08   Zea mays [maize]
emb|CDX91099.1|  BnaC02g04980D                                        60.5    1e-08   
emb|CDY65709.1|  BnaC09g54760D                                        59.7    1e-08   
ref|XP_004978595.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  60.1    1e-08   
ref|XP_008667080.1|  PREDICTED: carbohydrate transporter/ sugar p...  59.7    1e-08   
gb|EMS51903.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1               60.1    2e-08   
gb|ABA91323.2|  major facilitator superfamily antiporter, putativ...  59.3    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|ABA91324.2|  major facilitator superfamily antiporter, putativ...  58.9    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006582395.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  60.1    2e-08   
ref|XP_002322579.2|  hypothetical protein POPTR_0016s02500g           60.1    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008667079.1|  PREDICTED: carbohydrate transporter/ sugar p...  59.7    2e-08   
ref|XP_009383252.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  59.7    2e-08   
emb|CDX70517.1|  BnaC03g06010D                                        59.7    2e-08   
emb|CDX78535.1|  BnaA03g04470D                                        59.7    2e-08   
ref|NP_001130901.1|  carbohydrate transporter/ sugar porter/ tran...  59.7    2e-08   Zea mays [maize]
gb|EMT28258.1|  Putative membrane protein                             59.3    2e-08   
ref|XP_010492179.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  59.7    2e-08   
ref|XP_004249093.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  59.7    2e-08   
ref|XP_010492149.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  59.7    2e-08   
ref|XP_009131357.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  59.7    2e-08   
ref|XP_004978596.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  59.7    2e-08   
ref|XP_010453472.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  59.7    2e-08   
ref|XP_003598367.1|  hypothetical protein MTR_3g010820                57.8    2e-08   
dbj|BAJ99531.1|  predicted protein                                    59.7    2e-08   
ref|XP_006582394.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  59.7    2e-08   
ref|XP_008777369.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  59.3    2e-08   
gb|AAM12978.1|  transporter-like protein                              59.3    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006832881.1|  hypothetical protein AMTR_s00095p00099600        59.3    2e-08   
ref|XP_010111301.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1          59.3    2e-08   
ref|XP_010067056.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  59.3    2e-08   
ref|XP_002871582.1|  hypothetical protein ARALYDRAFT_488195           59.3    2e-08   
ref|XP_006286669.1|  hypothetical protein CARUB_v10002619mg           59.3    2e-08   
emb|CDP18958.1|  unnamed protein product                              59.3    3e-08   
gb|EEC67612.1|  hypothetical protein OsI_34994                        59.3    3e-08   Oryza sativa Indica Group [Indian rice]
ref|NP_196878.2|  zinc induced facilitator 1 proetin                  59.3    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006662715.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.9    3e-08   
dbj|BAB10596.1|  transporter-like protein                             59.3    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001065682.1|  Os11g0135000                                     59.3    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008777370.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  59.3    3e-08   
ref|XP_010251716.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  59.7    3e-08   
ref|XP_004978597.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  59.3    3e-08   
ref|XP_006663797.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.9    3e-08   
dbj|BAL15698.1|  DMA efflux transporter                               59.3    3e-08   
ref|XP_007010372.1|  Zinc induced facilitator-like 1 isoform 2        59.3    3e-08   
ref|NP_851036.1|  zinc induced facilitator-like 1 protein             59.3    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453500.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  59.3    3e-08   
ref|XP_007010373.1|  Zinc induced facilitator-like 1 isoform 3        58.9    3e-08   
ref|XP_006287795.1|  hypothetical protein CARUB_v10001006mg           58.9    3e-08   
gb|KHG08311.1|  protein zinc induced facilitator-like 1               59.3    3e-08   
ref|XP_003598370.1|  Membrane protein, putative                       59.3    3e-08   
ref|XP_010557807.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  59.3    3e-08   
ref|XP_007010371.1|  Zinc induced facilitator-like 1 isoform 1        59.3    3e-08   
ref|XP_006662713.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.9    3e-08   
gb|KEH32901.1|  zinc induced facilitator-like protein                 58.9    3e-08   
ref|XP_006663795.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.9    3e-08   
ref|XP_010547293.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  58.9    3e-08   
emb|CDP11656.1|  unnamed protein product                              58.9    3e-08   
gb|EEE66677.1|  hypothetical protein OsJ_23324                        58.5    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004517218.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  57.8    3e-08   
ref|XP_007148766.1|  hypothetical protein PHAVU_005G012400g           58.9    4e-08   
gb|EAZ02981.1|  hypothetical protein OsI_25122                        58.5    4e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_010420011.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  58.9    4e-08   
ref|XP_006662714.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.9    4e-08   
ref|XP_006663796.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.9    4e-08   
dbj|BAB10595.1|  transporter-like protein                             58.9    4e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CBX25238.1|  hypothetical_protein                                 58.9    4e-08   
ref|XP_002871583.1|  hypothetical protein ARALYDRAFT_488196           58.9    4e-08   
emb|CDX70518.1|  BnaC03g06020D                                        58.9    4e-08   
ref|XP_006578391.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.9    4e-08   
ref|XP_009131358.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.5    4e-08   
emb|CDX78536.1|  BnaA03g04480D                                        58.5    4e-08   
ref|XP_006578392.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.5    4e-08   
ref|NP_001031877.1|  zinc induced facilitator-like 1 protein          58.5    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011079138.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.5    5e-08   
gb|EMS67726.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1               58.5    5e-08   
ref|XP_006582392.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.5    5e-08   
dbj|BAH56812.1|  AT5G13750                                            58.2    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010251709.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.5    5e-08   
gb|ABG21873.1|  transporter, putative, expressed                      58.5    5e-08   
ref|XP_011079140.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.5    6e-08   
ref|XP_011079141.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.2    6e-08   
gb|ABG21872.1|  transporter, putative, expressed                      58.2    6e-08   
gb|AFK38823.1|  unknown                                               58.2    6e-08   
ref|XP_006364750.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  58.5    6e-08   
ref|XP_010922100.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  58.2    6e-08   
ref|XP_010922099.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.2    7e-08   
ref|XP_002277598.2|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  58.2    7e-08   Vitis vinifera
ref|XP_009608809.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.4    7e-08   
ref|XP_002455465.1|  hypothetical protein SORBIDRAFT_03g011240        58.2    8e-08   Sorghum bicolor [broomcorn]
ref|NP_196898.5|  aminopeptidase                                      58.5    8e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006582391.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.8    8e-08   
gb|KEH19210.1|  zinc induced facilitator-like protein                 57.8    9e-08   
ref|XP_011032990.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.8    9e-08   
gb|KEH19211.1|  zinc induced facilitator-like protein                 57.8    9e-08   
gb|ABG22349.1|  transporter, putative, expressed                      57.8    1e-07   
ref|XP_010041137.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.8    1e-07   
ref|XP_004516556.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.4    1e-07   
ref|XP_011079142.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.4    1e-07   
gb|EEC67617.1|  hypothetical protein OsI_35001                        57.0    1e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010659034.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.4    1e-07   
ref|XP_011079143.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.4    1e-07   
ref|XP_003526355.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.4    1e-07   
ref|XP_006582390.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.4    1e-07   
gb|KDP27074.1|  hypothetical protein JCGZ_22071                       57.4    1e-07   
gb|EEC67623.1|  hypothetical protein OsI_35010                        55.8    1e-07   Oryza sativa Indica Group [Indian rice]
emb|CBI29168.3|  unnamed protein product                              57.4    1e-07   
ref|XP_004967681.1|  PREDICTED: probable peptide/nitrate transpor...  57.4    1e-07   
ref|XP_010067055.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.4    1e-07   
ref|XP_008664521.1|  PREDICTED: probable peptide/nitrate transpor...  57.4    1e-07   
ref|XP_008775054.1|  PREDICTED: probable peptide/nitrate transpor...  57.0    1e-07   
ref|XP_011079139.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.4    1e-07   
ref|XP_002310957.2|  hypothetical protein POPTR_0008s01110g           57.4    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010492150.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.0    1e-07   
ref|XP_007133566.1|  hypothetical protein PHAVU_011G189800g           57.0    2e-07   
ref|XP_010419980.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.0    2e-07   
emb|CBX25337.1|  hypothetical_protein                                 56.6    2e-07   
ref|NP_001148164.1|  carbohydrate transporter/ sugar porter/ tran...  57.0    2e-07   Zea mays [maize]
ref|XP_008775052.1|  PREDICTED: probable peptide/nitrate transpor...  57.0    2e-07   
ref|XP_010909586.1|  PREDICTED: probable peptide/nitrate transpor...  57.0    2e-07   
ref|XP_003542784.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.0    2e-07   
ref|XP_010909585.1|  PREDICTED: probable peptide/nitrate transpor...  57.0    2e-07   
gb|KHN10321.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1               57.0    2e-07   
ref|XP_007133567.1|  hypothetical protein PHAVU_011G189900g           57.0    2e-07   
tpg|DAA48434.1|  TPA: hypothetical protein ZEAMMB73_437680            57.0    2e-07   
tpg|DAA39260.1|  TPA: carbohydrate transporter/ sugar porter/ tra...  57.0    2e-07   
ref|XP_003542782.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  57.0    2e-07   
gb|KHN10319.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1               56.6    2e-07   
emb|CBI29172.3|  unnamed protein product                              56.6    2e-07   
ref|XP_006594343.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  56.6    2e-07   
ref|XP_006594344.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  56.6    2e-07   
ref|XP_002277751.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  56.6    2e-07   
ref|XP_010557810.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  56.6    3e-07   
gb|ABA95731.1|  hypothetical protein LOC_Os12g03950                   55.5    3e-07   
gb|EEC68819.1|  hypothetical protein OsI_37385                        56.2    3e-07   
gb|ABG21874.1|  transporter, putative, expressed                      56.2    3e-07   
ref|XP_010673233.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  56.2    3e-07   
ref|XP_002457625.1|  hypothetical protein SORBIDRAFT_03g010620        56.2    3e-07   
ref|XP_006471308.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  55.8    3e-07   
gb|EEE51613.1|  hypothetical protein OsJ_32882                        55.5    3e-07   
ref|XP_008775051.1|  PREDICTED: probable peptide/nitrate transpor...  56.2    3e-07   
ref|XP_008775053.1|  PREDICTED: probable peptide/nitrate transpor...  56.2    3e-07   
ref|XP_006832888.1|  hypothetical protein AMTR_s00095p00107410        55.8    3e-07   
ref|XP_008775046.1|  PREDICTED: probable peptide/nitrate transpor...  56.2    3e-07   
emb|CBI29171.3|  unnamed protein product                              55.1    3e-07   
ref|XP_010036425.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.8    4e-07   
ref|XP_004515446.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.8    4e-07   
ref|XP_010036424.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.8    4e-07   
ref|XP_004516554.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.8    4e-07   
ref|XP_010036423.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.8    4e-07   
gb|KCW47973.1|  hypothetical protein EUGRSUZ_K01705                   55.8    4e-07   
ref|XP_010909584.1|  PREDICTED: probable peptide/nitrate transpor...  55.8    4e-07   
emb|CDY27960.1|  BnaCnng05450D                                        54.3    4e-07   
ref|XP_010909581.1|  PREDICTED: probable peptide/nitrate transpor...  55.8    4e-07   
ref|XP_004515445.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.8    4e-07   
gb|EEE51608.1|  hypothetical protein OsJ_32873                        55.5    4e-07   
ref|XP_003542783.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.8    4e-07   
ref|XP_006598055.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.8    4e-07   
ref|XP_004516549.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.8    4e-07   
gb|KHN10156.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1               55.8    4e-07   
ref|XP_010557818.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.8    5e-07   
ref|XP_004978937.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.8    5e-07   
ref|XP_010673232.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.5    6e-07   
gb|ABA91341.1|  major facilitator superfamily antiporter, putativ...  55.1    6e-07   
ref|XP_004515444.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  55.1    7e-07   
ref|NP_001150835.1|  carbohydrate transporter/ sugar porter/ tran...  55.1    7e-07   
tpg|DAA54146.1|  TPA: carbohydrate transporter/ sugar porter/ tra...  55.1    7e-07   
gb|KCW87278.1|  hypothetical protein EUGRSUZ_B03776                   55.1    7e-07   
ref|NP_001065685.1|  Os11g0135900                                     55.1    7e-07   
gb|ACN27407.1|  unknown                                               55.1    8e-07   
ref|XP_010045122.1|  PREDICTED: probable peptide/nitrate transpor...  54.7    8e-07   
ref|NP_001065689.1|  Os11g0136400                                     55.1    8e-07   
ref|XP_007133367.1|  hypothetical protein PHAVU_011G173300g           55.1    9e-07   
ref|XP_007133563.1|  hypothetical protein PHAVU_011G189500g           55.1    9e-07   
ref|XP_004502380.1|  PREDICTED: protein ZINC INDUCED FACILITATOR ...  55.1    9e-07   
ref|XP_006832882.1|  hypothetical protein AMTR_s00095p00101800        53.9    9e-07   
ref|XP_010673231.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  54.7    9e-07   
ref|XP_010045121.1|  PREDICTED: probable peptide/nitrate transpor...  54.7    1e-06   
ref|XP_002457661.1|  hypothetical protein SORBIDRAFT_03g011330        55.1    1e-06   
ref|XP_010909590.1|  PREDICTED: probable peptide/nitrate transpor...  54.7    1e-06   
ref|XP_010045119.1|  PREDICTED: probable peptide/nitrate transpor...  54.7    1e-06   
ref|XP_010237965.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  54.7    1e-06   
ref|XP_002974343.1|  hypothetical protein SELMODRAFT_101350           54.7    1e-06   
gb|KHN10320.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1               54.7    1e-06   
ref|XP_003542780.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  54.7    1e-06   
gb|KCW87280.1|  hypothetical protein EUGRSUZ_B03776                   54.3    1e-06   
ref|NP_001042690.1|  Os01g0268100                                     54.3    1e-06   
gb|KEH19209.1|  zinc induced facilitator-like protein                 54.3    1e-06   
gb|EEE54296.1|  hypothetical protein OsJ_01228                        53.9    2e-06   
ref|XP_008445955.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  53.9    2e-06   
emb|CBX25240.1|  hypothetical_protein                                 53.5    2e-06   
ref|XP_006662716.1|  PREDICTED: probable peptide/nitrate transpor...  53.9    2e-06   
ref|XP_006662717.1|  PREDICTED: probable peptide/nitrate transpor...  53.9    2e-06   
gb|KHG29235.1|  putative peptide/nitrate transporter -like protein    53.5    2e-06   
ref|XP_010045120.1|  PREDICTED: probable peptide/nitrate transpor...  53.5    2e-06   
gb|AES68618.2|  zinc induced facilitator-like protein                 53.5    2e-06   
ref|XP_007133564.1|  hypothetical protein PHAVU_011G189600g           53.5    2e-06   
gb|KEH19212.1|  MFS transporter                                       52.8    3e-06   
ref|XP_010251715.1|  PREDICTED: probable peptide/nitrate transpor...  53.5    3e-06   
emb|CDY69241.1|  BnaAnng29740D                                        52.4    3e-06   
ref|XP_010251713.1|  PREDICTED: probable peptide/nitrate transpor...  53.5    3e-06   
ref|XP_007016707.1|  Zinc induced facilitator-like 2                  53.5    3e-06   
ref|XP_006645747.1|  PREDICTED: probable peptide/nitrate transpor...  53.1    3e-06   
ref|XP_007133369.1|  hypothetical protein PHAVU_011G173400g           53.1    3e-06   
ref|XP_003576348.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  53.1    4e-06   
ref|NP_001141824.1|  major facilitator superfamily defense1           53.1    4e-06   
ref|XP_010251712.1|  PREDICTED: probable peptide/nitrate transpor...  53.1    4e-06   
ref|XP_002967298.1|  hypothetical protein SELMODRAFT_408218           53.1    4e-06   
ref|XP_007133565.1|  hypothetical protein PHAVU_011G189700g           53.1    4e-06   
ref|XP_009108316.1|  PREDICTED: probable peptide/nitrate transpor...  52.8    4e-06   
emb|CDY59529.1|  BnaCnng35110D                                        52.8    4e-06   
tpg|DAA54200.1|  TPA: hypothetical protein ZEAMMB73_141781            52.8    4e-06   
gb|KEH19214.1|  zinc induced facilitator-like protein                 52.8    5e-06   
ref|XP_002986402.1|  hypothetical protein SELMODRAFT_157948           52.8    5e-06   
ref|XP_009403835.1|  PREDICTED: probable peptide/nitrate transpor...  52.8    5e-06   
ref|XP_002960420.1|  hypothetical protein SELMODRAFT_164091           52.8    5e-06   
ref|XP_004516552.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  52.8    5e-06   
ref|XP_010557819.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  52.4    6e-06   
ref|XP_004516553.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  52.4    6e-06   
ref|XP_009108317.1|  PREDICTED: probable peptide/nitrate transpor...  52.4    6e-06   
ref|XP_002313476.2|  transporter-related family protein               52.4    6e-06   
ref|XP_009403837.1|  PREDICTED: probable peptide/nitrate transpor...  52.4    6e-06   
gb|EMT29587.1|  Putative membrane protein                             52.4    6e-06   
emb|CDM82722.1|  unnamed protein product                              52.4    6e-06   
ref|XP_011042021.1|  PREDICTED: probable peptide/nitrate transpor...  52.4    6e-06   
ref|XP_004516551.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  52.4    7e-06   
ref|XP_003577878.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  52.4    7e-06   
dbj|BAE71198.1|  putative transporter-like protein                    52.4    7e-06   
ref|XP_007133368.1|  hypothetical protein PHAVU_011G173400g           52.0    8e-06   
gb|EMS56417.1|  hypothetical protein TRIUR3_14593                     50.4    9e-06   
ref|XP_004967684.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  52.0    9e-06   
ref|XP_004135359.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  52.0    9e-06   
ref|XP_004967683.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  52.0    1e-05   
ref|XP_002457667.1|  hypothetical protein SORBIDRAFT_03g011360        52.0    1e-05   
dbj|BAJ97721.1|  predicted protein                                    51.6    1e-05   
emb|CDP20757.1|  unnamed protein product                              50.1    1e-05   
ref|XP_010067052.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  51.2    1e-05   
emb|CBX25335.1|  hypothetical_protein                                 50.8    2e-05   
ref|XP_002442059.1|  hypothetical protein SORBIDRAFT_08g008410        51.2    2e-05   
ref|XP_010319112.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  48.9    2e-05   
ref|XP_010557815.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  51.2    2e-05   
gb|KCW65117.1|  hypothetical protein EUGRSUZ_G02625                   50.8    2e-05   
ref|XP_010067054.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  50.8    2e-05   
ref|XP_002988668.1|  hypothetical protein SELMODRAFT_184037           50.8    2e-05   
ref|XP_002457663.1|  hypothetical protein SORBIDRAFT_03g011340        50.8    2e-05   
emb|CBX25336.1|  hypothetical_protein                                 50.4    3e-05   
ref|NP_001055049.2|  Os05g0268400                                     50.1    3e-05   
dbj|BAJ87168.1|  predicted protein                                    50.4    3e-05   
gb|EAZ11441.1|  hypothetical protein OsJ_01308                        50.4    3e-05   
ref|XP_006664311.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  50.4    3e-05   
tpg|DAA54224.1|  TPA: hypothetical protein ZEAMMB73_986961            50.4    3e-05   
ref|XP_008677778.1|  PREDICTED: LOC541978 isoform X1                  50.4    3e-05   
gb|AAV32178.1|  hypothetical protein                                  49.7    4e-05   
ref|XP_003567304.1|  PREDICTED: probable peptide/nitrate transpor...  50.1    5e-05   
ref|NP_001105101.1|  LOC541978                                        49.7    5e-05   
ref|NP_001042748.1|  Os01g0279400                                     49.7    6e-05   
emb|CDM82928.1|  unnamed protein product                              49.7    6e-05   
gb|ACN28887.1|  unknown                                               49.7    6e-05   
ref|XP_002972052.1|  hypothetical protein SELMODRAFT_96275            49.3    7e-05   
ref|XP_004308184.1|  PREDICTED: LOW QUALITY PROTEIN: protein ZINC...  49.3    7e-05   
ref|XP_002972599.1|  hypothetical protein SELMODRAFT_97863            49.3    7e-05   
ref|XP_008657261.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  49.3    8e-05   
gb|EMT27514.1|  Putative membrane protein                             49.3    9e-05   
ref|XP_010425832.1|  PREDICTED: probable peptide/nitrate transpor...  48.9    9e-05   
gb|EEC78872.1|  hypothetical protein OsI_19229                        48.9    1e-04   
ref|XP_006290345.1|  hypothetical protein CARUB_v10017130mg           48.9    1e-04   
gb|AET03120.2|  zinc induced facilitator-like protein                 48.9    1e-04   
ref|XP_006290344.1|  hypothetical protein CARUB_v10017130mg           48.9    1e-04   
gb|ABG21871.1|  major facilitator superfamily antiporter, putativ...  48.1    1e-04   
ref|XP_003628644.1|  hypothetical protein MTR_8g062990                48.9    1e-04   
dbj|BAJ34036.1|  unnamed protein product                              48.1    1e-04   
ref|XP_006293241.1|  hypothetical protein CARUB_v10019572mg           48.5    1e-04   
ref|XP_010425830.1|  PREDICTED: probable peptide/nitrate transpor...  48.1    2e-04   
ref|XP_010514733.1|  PREDICTED: probable peptide/nitrate transpor...  48.1    2e-04   
gb|EMT23026.1|  Putative membrane protein                             48.1    2e-04   
ref|XP_001766859.1|  predicted protein                                48.1    2e-04   
ref|XP_008673934.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  48.1    2e-04   
ref|XP_010238772.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  48.1    2e-04   
ref|XP_006645771.1|  PREDICTED: probable peptide/nitrate transpor...  48.1    2e-04   
emb|CBX25427.1|  hypothetical_protein                                 47.0    2e-04   
gb|EEE53418.1|  hypothetical protein OsJ_36493                        47.8    3e-04   
emb|CDX91098.1|  BnaC02g04990D                                        47.4    3e-04   
gb|ABA91327.1|  major facilitator superfamily antiporter, putative    47.4    3e-04   
ref|XP_001754748.1|  predicted protein                                47.4    3e-04   
gb|EMS63645.1|  Protein ZINC INDUCED FACILITATOR-LIKE 1               47.4    4e-04   
ref|NP_189965.2|  probable peptide/nitrate transporter                47.4    4e-04   
ref|XP_003578976.1|  PREDICTED: protein ZINC INDUCED FACILITATOR-...  47.4    4e-04   
ref|XP_006832870.1|  hypothetical protein AMTR_s00095p00084980        47.4    4e-04   
ref|NP_974382.1|  probable peptide/nitrate transporter                47.4    4e-04   
gb|ACU24358.1|  unknown                                               45.8    4e-04   
emb|CBX25429.1|  hypothetical_protein                                 47.0    5e-04   
gb|EMT31005.1|  hypothetical protein F775_20914                       47.0    5e-04   
ref|XP_003565633.2|  PREDICTED: uncharacterized protein LOC100824896  47.0    5e-04   
gb|ACU17941.1|  unknown                                               45.4    6e-04   
emb|CAB83151.1|  transporter-like protein                             46.6    7e-04   
ref|XP_002457677.1|  hypothetical protein SORBIDRAFT_03g011490        46.6    7e-04   



>ref|XP_009608808.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=392

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++NP++  +KNWPLMS+IIIYC+F L+D+AYSE FSLW  SP
Sbjct  176  ESNPKENLFKNWPLMSSIIIYCIFALHDMAYSEIFSLWAVSP  217



>ref|XP_009608807.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=481

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++NP++  +KNWPLMS+IIIYC+F L+D+AYSE FSLW  SP
Sbjct  265  ESNPKENLFKNWPLMSSIIIYCIFALHDMAYSEIFSLWAVSP  306



>gb|EPS59156.1| hypothetical protein M569_15654, partial [Genlisea aurea]
Length=248

 Score = 67.0 bits (162),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 2/44 (5%)
 Frame = +2

Query  92   DTNPQKEH--YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            DT  +K    +KNWPLMS+I+IYCVF L+D+AY+E FSLW ESP
Sbjct  31   DTKGEKSESLFKNWPLMSSILIYCVFSLHDMAYTEIFSLWAESP  74



>ref|XP_010667675.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Beta vulgaris 
subsp. vulgaris]
Length=335

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 3/52 (6%)
 Frame = +2

Query  62   GCTSSSRG**DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            G     RG    NP+K  YKNWPL+S+II+YCVF L+D+AY+E FSLW  SP
Sbjct  113  GIEDKERG---VNPEKSLYKNWPLISSIIVYCVFSLHDMAYTEIFSLWAVSP  161



>gb|KDO47755.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
 gb|KDO47756.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
 gb|KDO47757.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=420

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  205  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  246



>ref|XP_006471270.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Citrus sinensis]
Length=395

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  180  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  221



>ref|XP_004230051.2| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 [Solanum lycopersicum]
Length=506

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P K  +KNWPLMSAII+YCVF L+D+AYSE FSLW  +P
Sbjct  289  ESTPTKSLFKNWPLMSAIILYCVFALHDMAYSEIFSLWAVTP  330



>gb|KDO47751.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=477

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  262  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  303



>ref|XP_006471269.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Citrus sinensis]
Length=486

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  271  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  312



>gb|KDO47759.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=442

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  271  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  312



>gb|KDO47752.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
 gb|KDO47753.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
 gb|KDO47754.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=486

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  271  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  312



>ref|XP_009608806.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Nicotiana tomentosiformis]
Length=347

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  131  ESTPKENLFKNWPLMSSIILYCVFSLHDMAYTEIFSLWAVSP  172



>gb|KDO47758.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=473

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  271  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  312



>ref|XP_008354839.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Malus domestica]
Length=385

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  171  EQTPKENLFKNWPLMSSIIVYCVFSLHDMAYAEIFSLWAVSP  212



>ref|XP_008346195.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Malus domestica]
Length=385

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  171  EQTPKENLFKNWPLMSSIIVYCVFSLHDMAYAEIFSLWAVSP  212



>ref|XP_011086111.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Sesamum indicum]
Length=489

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            T  ++  +KNWPLMS+II+YCVF L+D+AY+E FSLW ESP
Sbjct  274  TTSKQSLFKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAESP  314



>ref|XP_009355076.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=385

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  171  EQTPKENLFKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  212



>ref|XP_006432309.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 ref|XP_006432310.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 ref|XP_006432313.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 ref|XP_006432314.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 gb|ESR45549.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 gb|ESR45550.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 gb|ESR45553.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 gb|ESR45554.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
Length=371

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  271  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  312



>ref|XP_006347685.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Solanum tuberosum]
Length=481

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  +KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  264  ESAPKENLFKNWPLMSSIILYCVFSLHDMAYSEIFSLWAVSP  305



>ref|XP_008344548.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Malus domestica]
Length=295

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  81   EQTPKENLFKNWPLMSSIIVYCVFSLHDMAYAEIFSLWAVSP  122



>ref|XP_006432311.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 ref|XP_006432312.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 ref|XP_006432315.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 gb|ESR45551.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 gb|ESR45552.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
 gb|ESR45555.1| hypothetical protein CICLE_v10001373mg [Citrus clementina]
Length=399

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  271  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  312



>gb|KDO47760.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=407

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  271  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  312



>gb|KDO47763.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=371

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  271  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  312



>gb|KDO47762.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=399

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  271  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  312



>ref|XP_009608804.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=482

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  266  ESTPKENLFKNWPLMSSIILYCVFSLHDMAYTEIFSLWAVSP  307



>ref|XP_008354840.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Malus domestica]
Length=483

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  269  EQTPKENLFKNWPLMSSIIVYCVFSLHDMAYAEIFSLWAVSP  310



>ref|XP_006347689.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Solanum tuberosum]
Length=418

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  +KNWPLMS+II+YCVF L+D+AY+E FSLWT SP
Sbjct  202  ESVPKENLFKNWPLMSSIILYCVFSLHDMAYTEIFSLWTVSP  243



>ref|XP_004230048.2| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Solanum 
lycopersicum]
Length=416

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  + NWPLMS+II+YCVF L+D+AY+E FSLWT SP
Sbjct  202  ESAPKENLFNNWPLMSSIILYCVFSLHDMAYTEIFSLWTVSP  243



>ref|XP_008346199.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Malus domestica]
Length=483

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  269  EQTPKENLFKNWPLMSSIIVYCVFSLHDMAYAEIFSLWAVSP  310



>ref|XP_008346187.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Malus 
domestica]
Length=483

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  269  EQTPKENLFKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  310



>ref|XP_010091305.1| hypothetical protein L484_012198 [Morus notabilis]
 gb|EXB44279.1| hypothetical protein L484_012198 [Morus notabilis]
Length=371

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N  K  +KNWPLMS+II YCVF L+D+AYSE FSLW  SP
Sbjct  194  ERNSNKSLFKNWPLMSSIIAYCVFALHDMAYSEIFSLWAVSP  235



>ref|XP_009355075.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=483

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  269  EQTPKENLFKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  310



>gb|KDO47761.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=432

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  271  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  312



>ref|XP_009776346.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Nicotiana sylvestris]
Length=417

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  201  ESAPKENLFKNWPLMSSIILYCVFSLHDMAYNEIFSLWAVSP  242



>ref|XP_006347688.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Solanum tuberosum]
Length=432

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P++  +KNWPLMS+II+YCVF L+D+AY+E FSLWT SP
Sbjct  219  PKENLFKNWPLMSSIILYCVFSLHDMAYTEIFSLWTVSP  257



>ref|XP_009776347.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X4 [Nicotiana sylvestris]
Length=405

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  189  ESAPKENLFKNWPLMSSIILYCVFSLHDMAYNEIFSLWAVSP  230



>ref|XP_004230052.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 [Solanum lycopersicum]
Length=484

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  +KNWPLMS+II YCVF L+D+AYSE FSLW  SP
Sbjct  267  ESAPKENLFKNWPLMSSIISYCVFALHDMAYSEIFSLWAVSP  308



>ref|XP_009776345.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Nicotiana sylvestris]
Length=432

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  216  ESAPKENLFKNWPLMSSIILYCVFSLHDMAYNEIFSLWAVSP  257



>ref|XP_009776344.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nicotiana sylvestris]
Length=500

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  284  ESAPKENLFKNWPLMSSIILYCVFSLHDMAYNEIFSLWAVSP  325



>ref|XP_006347687.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Solanum tuberosum]
Length=480

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P++  +KNWPLMS+II+YCVF L+D+AY+E FSLWT SP
Sbjct  267  PKENLFKNWPLMSSIILYCVFSLHDMAYTEIFSLWTVSP  305



>ref|XP_009608805.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=350

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  266  ESTPKENLFKNWPLMSSIILYCVFSLHDMAYTEIFSLWAVSP  307



>gb|KDO47764.1| hypothetical protein CISIN_1g011424mg [Citrus sinensis]
Length=351

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P+K   KNWPLMS+II+YCVF L+D+AYSE FSLW  SP
Sbjct  271  EATPKKSLLKNWPLMSSIIVYCVFSLHDMAYSEIFSLWANSP  312



>gb|KCW65123.1| hypothetical protein EUGRSUZ_G02629 [Eucalyptus grandis]
Length=455

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P+K  ++NWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  244  PKKSLFRNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  282



>ref|XP_009776348.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X5 [Nicotiana sylvestris]
Length=403

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++ P++  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  187  ESAPKENLFKNWPLMSSIILYCVFSLHDMAYNEIFSLWAVSP  228



>ref|XP_006347684.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Solanum tuberosum]
Length=481

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + P K  +KNWPL+SAII+YCVF L+D+AYSE FSLW  +P
Sbjct  265  STPAKSLFKNWPLISAIILYCVFALHDMAYSEIFSLWAVTP  305



>gb|EMS63644.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Triticum urartu]
Length=575

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 38/61 (62%), Gaps = 4/61 (7%)
 Frame = +2

Query  32   FGLRLRQGFRGCTSSSRG**DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTE  211
            F +R      G T  S      +P+K  +KNWPLMS+II YCVF L+D AYSE FSLWT 
Sbjct  228  FEMRAETAEAGTTQES----TESPKKSLWKNWPLMSSIITYCVFSLHDTAYSEIFSLWTV  283

Query  212  S  214
            S
Sbjct  284  S  284



>ref|XP_006347686.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Solanum tuberosum]
Length=480

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + P K  +KNWPL+SAII+YCVF L+D+AYSE FSLW  +P
Sbjct  264  STPAKSLFKNWPLISAIILYCVFALHDMAYSEIFSLWAVTP  304



>emb|CBX25334.1| hypothetical_protein [Oryza brachyantha]
Length=283

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  166  DSHKQKNLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  206



>emb|CBX25425.1| hypothetical_protein [Oryza glaberrima]
Length=430

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  245  DSHKQKSLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  285



>emb|CBX24389.1| hypothetical_protein [Oryza glaberrima]
Length=453

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  262  DSHKQKSLYKNWPLISSIIAYCVFTLHDTAYSEVFSLWAVS  302



>emb|CDY09863.1| BnaC09g42980D [Brassica napus]
Length=278

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            N +   +KNWPLMS+I++YCV CL+D  YSE F+LW  SP
Sbjct  101  NKRASLFKNWPLMSSILVYCVLCLHDTVYSEIFALWANSP  140



>ref|XP_007217932.1| hypothetical protein PRUPE_ppa004919mg [Prunus persica]
 gb|EMJ19131.1| hypothetical protein PRUPE_ppa004919mg [Prunus persica]
Length=485

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P++  +KNWPLMSAII+YCV+ L+D+AY+E FSLW  SP
Sbjct  273  PKENLFKNWPLMSAIIVYCVYSLHDMAYTEIFSLWAVSP  311



>gb|ABA95719.2| major facilitator superfamily antiporter, putative [Oryza sativa 
Japonica Group]
Length=410

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  219  DSHKQKSLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  259



>gb|EEE52720.1| hypothetical protein OsJ_35131 [Oryza sativa Japonica Group]
Length=423

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  232  DSHKQKSLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  272



>ref|XP_006662712.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Oryza brachyantha]
Length=476

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  262  DSHKQKNLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  302



>ref|XP_006663792.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X1 
[Oryza brachyantha]
Length=476

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  262  DSHKQKNLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  302



>ref|XP_010067060.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Eucalyptus grandis]
Length=484

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P+K  ++NWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  273  PKKSLFRNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  311



>ref|XP_009410441.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Musa 
acuminata subsp. malaccensis]
Length=485

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            DT P+   +KNWPLMS++I+YC+F L+D+AY+E FSLW  S
Sbjct  270  DTQPKANLFKNWPLMSSVIVYCIFSLHDMAYTEIFSLWAVS  310



>gb|EMT23954.1| Metacaspase-9 [Aegilops tauschii]
Length=571

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +P+K  +KNWPLMS+II YCVF L+D AYSE FSLWT S
Sbjct  232  SPKKSLWKNWPLMSSIITYCVFSLHDTAYSEIFSLWTVS  270



>gb|EMT05811.1| Putative membrane protein [Aegilops tauschii]
Length=481

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +P+K  YKNWPLMS+II YCVF L+D AYSE FSLW  S
Sbjct  264  HPEKSLYKNWPLMSSIIAYCVFTLHDTAYSEIFSLWAVS  302



>ref|XP_006663793.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X2 
[Oryza brachyantha]
Length=440

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  262  DSHKQKNLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  302



>emb|CBX25237.1| hypothetical_protein [Oryza brachyantha]
Length=456

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  270  DSHKQKNLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  310



>gb|KCW65127.1| hypothetical protein EUGRSUZ_G02630 [Eucalyptus grandis]
Length=461

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P+K   +NWPLMSAII YCVF L+D+AYSE FSLW  SP
Sbjct  273  PKKSLLRNWPLMSAIIAYCVFSLHDMAYSEIFSLWAVSP  311



>ref|XP_010067061.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Eucalyptus grandis]
 gb|KCW65126.1| hypothetical protein EUGRSUZ_G02630 [Eucalyptus grandis]
Length=485

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P+K   +NWPLMSAII YCVF L+D+AYSE FSLW  SP
Sbjct  273  PKKSLLRNWPLMSAIIAYCVFSLHDMAYSEIFSLWAVSP  311



>ref|NP_001066082.1| Os12g0132500 [Oryza sativa Japonica Group]
 dbj|BAF29101.1| Os12g0132500 [Oryza sativa Japonica Group]
Length=382

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  191  DSHKQKSLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  231



>tpd|FAA00732.1| TPA: DMA efflux transporter [Oryza sativa Japonica Group]
Length=473

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  259  DSHKQKSLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  299



>ref|XP_010492151.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Camelina 
sativa]
Length=477

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +K  +KNWPLMS+II+YC+F L+++AY+E FSLW  SP
Sbjct  262  ERNEKKSLWKNWPLMSSIIVYCIFSLHNMAYTEIFSLWANSP  303



>ref|XP_010237967.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Brachypodium distachyon]
Length=498

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            + + +K  +KNWPLMS+IIIYCVF  +D+AY+E FSLW ES
Sbjct  279  NVDTKKSLFKNWPLMSSIIIYCVFSFHDMAYTEVFSLWAES  319



>ref|NP_001065681.1| Os11g0134900 [Oryza sativa Japonica Group]
 gb|ABA91320.1| major facilitator superfamily antiporter, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27526.1| Os11g0134900 [Oryza sativa Japonica Group]
 gb|EEE51602.1| hypothetical protein OsJ_32857 [Oryza sativa Japonica Group]
Length=473

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  259  DSHKQKSLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  299



>gb|ABR17390.1| unknown [Picea sitchensis]
Length=512

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +K  ++NWP+MS+II+YCVF L+++AYSE FSLW ESP
Sbjct  276  RKSLFRNWPVMSSIIVYCVFSLHEVAYSEIFSLWAESP  313



>ref|XP_009355073.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=487

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P++  +KNWPL+S+I++YCVF L+D+AY E FSLW  SP
Sbjct  273  EQTPKENLFKNWPLISSIVVYCVFSLHDMAYGEIFSLWAVSP  314



>ref|XP_009355074.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=483

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P++  +KNWPL+S+I++YCVF L+D+AY E FSLW  SP
Sbjct  269  EQTPKENLFKNWPLISSIVVYCVFSLHDMAYGEIFSLWAVSP  310



>ref|XP_003577876.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Brachypodium distachyon]
Length=494

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            + + +K  +KNWPLMS+IIIYCVF  +D+AY+E FSLW ES
Sbjct  275  NVDTKKSLFKNWPLMSSIIIYCVFSFHDMAYTEVFSLWAES  315



>gb|KCW65124.1| hypothetical protein EUGRSUZ_G02629 [Eucalyptus grandis]
Length=441

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P+K  ++NWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  273  PKKSLFRNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  311



>ref|XP_010067057.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010067058.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010067059.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW65121.1| hypothetical protein EUGRSUZ_G02629 [Eucalyptus grandis]
 gb|KCW65122.1| hypothetical protein EUGRSUZ_G02629 [Eucalyptus grandis]
Length=484

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P+K  ++NWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  273  PKKSLFRNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  311



>emb|CDY09868.1| BnaC09g42930D [Brassica napus]
Length=482

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            N +   +KNWPLMS+I++YCV CL+D AYSE F+LW  SP
Sbjct  267  NKRTSLFKNWPLMSSILVYCVLCLHDTAYSEIFALWANSP  306



>ref|XP_010237968.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Brachypodium distachyon]
Length=491

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            + + +K  +KNWPLMS+IIIYCVF  +D+AY+E FSLW ES
Sbjct  272  NVDTKKSLFKNWPLMSSIIIYCVFSFHDMAYTEVFSLWAES  312



>ref|XP_010237969.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X4 [Brachypodium distachyon]
Length=480

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            + + +K  +KNWPLMS+IIIYCVF  +D+AY+E FSLW ES
Sbjct  261  NVDTKKSLFKNWPLMSSIIIYCVFSFHDMAYTEVFSLWAES  301



>gb|KCW65125.1| hypothetical protein EUGRSUZ_G02629 [Eucalyptus grandis]
Length=407

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P+K  ++NWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  273  PKKSLFRNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  311



>ref|XP_008796954.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Phoenix dactylifera]
Length=248

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            P +  +KNWPLMS+II+YCVF L+D+AY+E FSLW  S
Sbjct  36   PTENLFKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVS  73



>dbj|BAK02262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=502

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +N +K  +KNWPLMS+II+YC+F  +D+AY+E FSLW ES
Sbjct  284  SNTKKSLFKNWPLMSSIIVYCIFSFHDMAYTEVFSLWAES  323



>ref|XP_007028171.1| Zinc induced facilitator-like 1 isoform 3 [Theobroma cacao]
 gb|EOY08673.1| Zinc induced facilitator-like 1 isoform 3 [Theobroma cacao]
Length=436

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q+  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  222  QQNLWKNWPLMSSIIVYCVFQLHDMAYAEIFSLWAVSP  259



>ref|XP_008231756.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Prunus 
mume]
Length=485

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P++  +KNWPLMS+II+YCV+ L+D+AY+E FSLW  SP
Sbjct  273  PKENLFKNWPLMSSIIVYCVYSLHDMAYTEIFSLWAVSP  311



>gb|EEC67611.1| hypothetical protein OsI_34993 [Oryza sativa Indica Group]
Length=463

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ QK  YKNWPL+S+II YCVF L+D AY+E FSLW  S
Sbjct  249  DSHKQKSLYKNWPLISSIIAYCVFTLHDTAYTEIFSLWAVS  289



>tpg|DAA39263.1| TPA: hypothetical protein ZEAMMB73_384773 [Zea mays]
Length=244

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  ++NWPLMS+II+YC+F  +D+AY+E FSLW ES
Sbjct  29   KKSLFRNWPLMSSIIVYCIFSFHDMAYTEVFSLWAES  65



>ref|XP_009763181.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X1 
[Nicotiana sylvestris]
Length=453

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            N  K   KNWPL+SAII+YCVF L+DIAY E FSLW  SP
Sbjct  213  NSHKSLLKNWPLVSAIIVYCVFQLHDIAYLEIFSLWAVSP  252



>ref|XP_002307932.2| hypothetical protein POPTR_0006s02710g [Populus trichocarpa]
 gb|EEE91455.2| hypothetical protein POPTR_0006s02710g [Populus trichocarpa]
Length=478

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +P+K   KNWPL+S+II+YCVF L+D+AY+E FSLW  SP
Sbjct  262  SPRKSLLKNWPLISSIIVYCVFQLHDMAYAEIFSLWAVSP  301



>ref|XP_010492152.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Camelina 
sativa]
Length=471

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +K   KNWPLMS+II+YC+F L+++AY+E FSLW  SP
Sbjct  256  EKNEKKSLLKNWPLMSSIIVYCIFSLHNMAYTEIFSLWANSP  297



>ref|XP_009619333.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Nicotiana 
tomentosiformis]
Length=517

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            N QK   KNWPL+SAI +YCVF L+DIAY E FSLW  SP
Sbjct  277  NSQKSLLKNWPLVSAIFVYCVFQLHDIAYLEIFSLWAVSP  316



>ref|XP_002527379.1| carbohydrate transporter, putative [Ricinus communis]
 gb|EEF35004.1| carbohydrate transporter, putative [Ricinus communis]
Length=500

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + P++   KNWPLMS+II+YC+F L+D+AY+E FSLW  SP
Sbjct  286  STPEESLLKNWPLMSSIIVYCIFQLHDMAYTEIFSLWAVSP  326



>ref|XP_007028169.1| Zinc induced facilitator-like 1 isoform 1 [Theobroma cacao]
 gb|EOY08671.1| Zinc induced facilitator-like 1 isoform 1 [Theobroma cacao]
Length=490

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q+  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  276  QQNLWKNWPLMSSIIVYCVFQLHDMAYAEIFSLWAVSP  313



>ref|XP_007028170.1| Zinc induced facilitator-like 1 isoform 2 [Theobroma cacao]
 gb|EOY08672.1| Zinc induced facilitator-like 1 isoform 2 [Theobroma cacao]
Length=458

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q+  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  276  QQNLWKNWPLMSSIIVYCVFQLHDMAYAEIFSLWAVSP  313



>ref|XP_004977470.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X5 [Setaria italica]
Length=479

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K  +KNWPLMS+I+IYC+F  +D+AY+E FSLW ES
Sbjct  258  NTKKSLFKNWPLMSSIVIYCIFSFHDMAYTEVFSLWAES  296



>gb|EEC68817.1| hypothetical protein OsI_37381 [Oryza sativa Indica Group]
Length=382

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D++ Q   YKNWPL+S+II YCVF L+D AYSE FSLW  S
Sbjct  211  DSHKQNSLYKNWPLISSIIAYCVFTLHDTAYSEIFSLWAVS  251



>ref|XP_004289280.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Fragaria 
vesca subsp. vesca]
Length=251

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P++   KNWPL+S+I++YCVF L+D+AYSE FSLW ESP
Sbjct  93   PKENLMKNWPLISSILVYCVFSLHDMAYSEIFSLWAESP  131



>ref|XP_011016745.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Populus 
euphratica]
Length=203

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
              +P+K   KNWPL+S+II+YCVF L+D+AY+E FSLW  SP
Sbjct  132  SNSPRKSLLKNWPLISSIIVYCVFQLHDMAYAEIFSLWAVSP  173



>ref|XP_004977466.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Setaria italica]
Length=497

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K  +KNWPLMS+I+IYC+F  +D+AY+E FSLW ES
Sbjct  276  NTKKSLFKNWPLMSSIVIYCIFSFHDMAYTEVFSLWAES  314



>ref|XP_009121732.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 isoform X2 
[Brassica rapa]
Length=397

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +    KNWPL+S+II+YC+F L+D+AY+E FSLW  SP
Sbjct  182  ERNEKTSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSP  223



>ref|XP_009383253.1| PREDICTED: probable peptide/nitrate transporter At3g43790 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=434

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = +2

Query  101  PQKEH-YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            P+KE+ +KNWPLMS+II+YC+F L+D+AYSE FSLW  S
Sbjct  220  PRKENLFKNWPLMSSIIVYCIFSLHDMAYSEIFSLWAVS  258



>ref|XP_010492148.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
Length=487

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            D    +   KNWPLMS+I +YCV CL+D AYSE F+LW  SP
Sbjct  271  DRKASQSLLKNWPLMSSIFVYCVLCLHDTAYSEIFALWANSP  312



>ref|XP_010453469.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
 ref|XP_010453470.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
Length=487

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            D    +   KNWPLMS+I +YCV CL+D AYSE F+LW  SP
Sbjct  271  DRKASQSLLKNWPLMSSIFVYCVLCLHDTAYSEIFALWANSP  312



>ref|XP_010419976.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 [Camelina sativa]
Length=487

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            D    +   KNWPLMS+I +YCV CL+D AYSE F+LW  SP
Sbjct  271  DRKASQSLLKNWPLMSSIFVYCVLCLHDTAYSEIFALWANSP  312



>ref|XP_010068811.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Eucalyptus 
grandis]
 gb|KCW65128.1| hypothetical protein EUGRSUZ_G02631 [Eucalyptus grandis]
Length=493

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = +2

Query  44   LRQGFRGCTSSSRG**DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            L  G +  T   +G     P+K   +NWPLMS II YCVF L D AYSE FSLW ESP
Sbjct  257  LESGVKCKTEKVKG---KAPKKSLIRNWPLMSTIIAYCVFALYDTAYSEIFSLWAESP  311



>ref|XP_006399873.1| hypothetical protein EUTSA_v10013417mg [Eutrema salsugineum]
 gb|ESQ41326.1| hypothetical protein EUTSA_v10013417mg [Eutrema salsugineum]
Length=479

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +    KNWPL+S+II+YC+F L+D+AY+E FSLW  SP
Sbjct  264  ERNEKSSLLKNWPLLSSIIVYCIFSLHDMAYTEIFSLWANSP  305



>ref|XP_010653665.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 isoform X2 [Vitis 
vinifera]
Length=488

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            N Q+   KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  272  NQQQSLLKNWPLMSSIIVYCVFQLHDMAYAEIFSLWAISP  311



>dbj|BAJ94369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
             +N +K  +KNWPLMS+II+YC+F  +D+AY+E FSLW ES
Sbjct  275  SSNTKKSLFKNWPLMSSIIVYCIFSFHDMAYTEVFSLWAES  315



>ref|XP_011041314.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X2 
[Populus euphratica]
Length=415

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            T+ QK   KNWPL+S+II YCVF L+D+AY+E FSLW  SP
Sbjct  198  TSSQKSLLKNWPLISSIIAYCVFQLHDMAYAEIFSLWAVSP  238



>ref|XP_010419978.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Camelina sativa]
Length=433

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            N +K   KNWPLMS++I+YC+F L+++AY+E FSLW  SP
Sbjct  220  NEKKSLLKNWPLMSSMIVYCIFSLHNMAYTEIFSLWANSP  259



>gb|EYU20856.1| hypothetical protein MIMGU_mgv1a005872mg [Erythranthe guttata]
Length=466

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + P +   +NWPLMSAI++YC+F L+D+AYSE FSLW  SP
Sbjct  274  STPHRSLLRNWPLMSAIMVYCIFQLHDMAYSEIFSLWALSP  314



>ref|XP_007028172.1| Zinc induced facilitator-like 1 isoform 4 [Theobroma cacao]
 gb|EOY08674.1| Zinc induced facilitator-like 1 isoform 4 [Theobroma cacao]
Length=329

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q+  +KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  276  QQNLWKNWPLMSSIIVYCVFQLHDMAYAEIFSLWAVSP  313



>ref|XP_010453471.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Camelina 
sativa]
Length=476

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +    KNWPLMS+II+YC+F L+++AYSE FSLW  SP
Sbjct  261  EKNEKSSLLKNWPLMSSIIVYCIFSLHNMAYSEIFSLWANSP  302



>ref|XP_003578972.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Brachypodium 
distachyon]
Length=485

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = +2

Query  41   RLRQGFRGCTSSSRG**DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +L++G     +S+       P+K   KNWPLMS+II YCVF L+D AYSE FSLWT S
Sbjct  251  KLQKGVETAQASTSPESADPPKKSLLKNWPLMSSIITYCVFSLHDTAYSEIFSLWTVS  308



>ref|XP_009763182.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X2 
[Nicotiana sylvestris]
Length=394

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            N  K   KNWPL+SAII+YCVF L+DIAY E FSLW  SP
Sbjct  213  NSHKSLLKNWPLVSAIIVYCVFQLHDIAYLEIFSLWAVSP  252



>ref|XP_009776342.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nicotiana sylvestris]
Length=481

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P++  +KNW LMS+II+YC+F L+D+AYSE FSLW  SP
Sbjct  268  PKENLFKNWALMSSIILYCIFALHDMAYSEIFSLWAVSP  306



>ref|XP_009776343.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Nicotiana sylvestris]
Length=450

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P++  +KNW LMS+II+YC+F L+D+AYSE FSLW  SP
Sbjct  237  PKENLFKNWALMSSIILYCIFALHDMAYSEIFSLWAVSP  275



>ref|XP_003632620.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 isoform X1 [Vitis 
vinifera]
 emb|CBI32850.3| unnamed protein product [Vitis vinifera]
Length=490

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            N Q+   KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  274  NQQQSLLKNWPLMSSIIVYCVFQLHDMAYAEIFSLWAISP  313



>gb|KFK25600.1| hypothetical protein AALP_AA8G135600 [Arabis alpina]
Length=479

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +    KNWPL+S+II+YC+F L+D+AY+E FSLW  SP
Sbjct  263  ERNEESSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSP  304



>ref|XP_004977469.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X4 [Setaria italica]
Length=488

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K  +KNWPLMS+I+IYC+F  +D+AY+E FSLW ES
Sbjct  271  NTKKSLFKNWPLMSSIVIYCIFSFHDMAYTEVFSLWAES  309



>ref|XP_009121734.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Brassica rapa]
Length=460

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +    KNWPL+S+II+YC+F L+D+AY+E FSLW  SP
Sbjct  245  ERNERPSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSP  286



>ref|XP_004977468.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Setaria italica]
Length=492

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K  +KNWPLMS+I+IYC+F  +D+AY+E FSLW ES
Sbjct  271  NTKKSLFKNWPLMSSIVIYCIFSFHDMAYTEVFSLWAES  309



>ref|XP_004977467.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Setaria italica]
Length=493

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K  +KNWPLMS+I+IYC+F  +D+AY+E FSLW ES
Sbjct  276  NTKKSLFKNWPLMSSIVIYCIFSFHDMAYTEVFSLWAES  314



>gb|ABG21870.1| major facilitator superfamily antiporter, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAH01053.1| unnamed protein product [Oryza sativa Japonica Group]
Length=343

 Score = 60.1 bits (144),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            QK  ++NWPLMS+I+ YCVF L+D AYSE FSLWT S
Sbjct  130  QKSLFRNWPLMSSIVTYCVFSLHDTAYSEIFSLWTVS  166



>gb|EYU26916.1| hypothetical protein MIMGU_mgv1a008860mg [Erythranthe guttata]
Length=360

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +N ++   KNWPLMS+I +YC+F L+D+AY+E FSLW ESP
Sbjct  160  SNSKENLLKNWPLMSSIFVYCIFSLHDMAYTEIFSLWAESP  200



>ref|XP_003577879.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Brachypodium 
distachyon]
Length=497

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 28/40 (70%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +2

Query  101  PQKEH--YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            P KE   YKNWPLMSAI+ YCVF LND AYSE  SLW  S
Sbjct  279  PHKEKSIYKNWPLMSAILAYCVFTLNDTAYSEILSLWAVS  318



>tpd|FAA01135.1| TPA: efflux transporter of phytosiderophore (mugineic acids) 
[Zea mays]
Length=476

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D +  K  YKNWPLMS+II YCVF L+D AY+E  SLWT S
Sbjct  259  DVDAGKSLYKNWPLMSSIIAYCVFTLHDTAYTEILSLWTVS  299



>ref|XP_008676450.1| PREDICTED: uncharacterized protein LOC100191783 isoform X1 [Zea 
mays]
 gb|AFW64731.1| hypothetical protein ZEAMMB73_729659 [Zea mays]
Length=506

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            + +K  ++NWPLMS+II+YCVF  +D+AY+E FSLW ES
Sbjct  289  DSKKSLFRNWPLMSSIIVYCVFSFHDMAYTEVFSLWAES  327



>gb|AFO67942.1| YS3 [Zea mays]
Length=476

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D +  K  YKNWPLMS+II YCVF L+D AY+E  SLWT S
Sbjct  259  DVDAGKSLYKNWPLMSSIIAYCVFTLHDTAYTEILSLWTVS  299



>ref|XP_009121731.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 isoform X1 
[Brassica rapa]
Length=483

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +    KNWPL+S+II+YC+F L+D+AY+E FSLW  SP
Sbjct  268  ERNEKTSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSP  309



>ref|XP_004960719.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Setaria italica]
Length=487

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            DT+  K  YKNWPLMS+II YCVF ++D AYSE  SLWT S
Sbjct  268  DTHGGKSLYKNWPLMSSIIAYCVFTVHDTAYSEILSLWTIS  308



>ref|XP_008674224.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Zea 
mays]
Length=476

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            D +  K  YKNWPLMS+II YCVF L+D AY+E  SLWT S
Sbjct  259  DVDAGKSLYKNWPLMSSIIAYCVFTLHDTAYTEILSLWTVS  299



>gb|ABG21869.1| major facilitator superfamily antiporter, putative, expressed 
[Oryza sativa Japonica Group]
Length=388

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            QK  ++NWPLMS+I+ YCVF L+D AYSE FSLWT S
Sbjct  175  QKSLFRNWPLMSSIVTYCVFSLHDTAYSEIFSLWTVS  211



>emb|CDX85629.1| BnaA02g01840D [Brassica napus]
Length=483

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +   Q    KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  268  EKTSQGSLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  309



>ref|XP_009121733.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Brassica rapa]
Length=483

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +    KNWPL+S+II+YC+F L+D+AY+E FSLW  SP
Sbjct  268  ERNERPSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSP  309



>ref|XP_010453473.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Camelina sativa]
Length=389

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +     NWPL+S+II+YC+F L+D+AYSE FSLW  SP
Sbjct  174  EKNEKSSLLNNWPLVSSIIVYCIFSLHDMAYSEIFSLWANSP  215



>ref|XP_009125940.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 [Brassica rapa]
 ref|XP_009125941.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 [Brassica rapa]
 ref|XP_009125942.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1 [Brassica rapa]
Length=483

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +   Q    KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  268  EKTSQGSLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  309



>gb|AAN33182.1| major facilitator superfamily antiporter [Oryza sativa Japonica 
Group]
Length=470

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            QK  ++NWPLMS+I+ YCVF L+D AYSE FSLWT S
Sbjct  257  QKSLFRNWPLMSSIVTYCVFSLHDTAYSEIFSLWTVS  293



>gb|ABA91322.2| major facilitator superfamily antiporter, putative, expressed 
[Oryza sativa Japonica Group]
Length=428

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  ++NWPLMS+II YCVF L+D AYSE FSLWT S
Sbjct  215  KKSLFRNWPLMSSIITYCVFSLHDTAYSEIFSLWTVS  251



>emb|CDY65961.1| BnaA10g29810D [Brassica napus]
Length=477

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +    KNWPL+S+II+YC+F L+D+AY+E FSLW  SP
Sbjct  262  ERNERTSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSP  303



>gb|EEC68818.1| hypothetical protein OsI_37382 [Oryza sativa Indica Group]
Length=390

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            QK  ++NWPLMS+I+ YCVF L+D AYSE FSLWT S
Sbjct  192  QKSLFRNWPLMSSIVTYCVFSLHDTAYSEIFSLWTVS  228



>emb|CDY65960.1| BnaA10g29800D [Brassica napus]
Length=471

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            N +    KNWPL+S+II+YC+F L+D+AY+E FSLW  SP
Sbjct  258  NEKTSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSP  297



>emb|CDY09820.1| BnaC09g43410D [Brassica napus]
Length=443

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  77   SRG**DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            S G    N +    KNWPLMS+I++YCV CL+D AYSE F+LW  SP
Sbjct  259  STGKTGNNKKGSLLKNWPLMSSILVYCVLCLHDTAYSEIFALWANSP  305



>emb|CBX24393.1| hypothetical_protein [Oryza glaberrima]
Length=301

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K   +NWPLMS+II+YCVF  +D+AY+E FSLW ES
Sbjct  98   KKSLLRNWPLMSSIILYCVFSFHDMAYTEIFSLWAES  134



>ref|XP_011041313.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Populus euphratica]
Length=478

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            T+ QK   KNWPL+S+II YCVF L+D+AY+E FSLW  SP
Sbjct  261  TSSQKSLLKNWPLISSIIAYCVFQLHDMAYAEIFSLWAVSP  301



>ref|NP_001066084.1| Os12g0132800 [Oryza sativa Japonica Group]
 gb|ABA95722.1| major facilitator superfamily antiporter, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF29103.1| Os12g0132800 [Oryza sativa Japonica Group]
 gb|EEE52721.1| hypothetical protein OsJ_35134 [Oryza sativa Japonica Group]
Length=470

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            QK  ++NWPLMS+I+ YCVF L+D AYSE FSLWT S
Sbjct  257  QKSLFRNWPLMSSIVTYCVFSLHDTAYSEIFSLWTVS  293



>gb|KHN06906.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Glycine soja]
Length=416

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  KEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            K  ++NWPLMS+II+YC+F L+D+AY E FSLW  SP
Sbjct  207  KSIFRNWPLMSSIIVYCIFSLHDVAYQEVFSLWALSP  243



>ref|XP_010419977.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Camelina sativa]
Length=478

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            N +K   KNWPLMS++I+YC+F L+++AY+E FSLW  SP
Sbjct  265  NEKKSLLKNWPLMSSMIVYCIFSLHNMAYTEIFSLWANSP  304



>ref|XP_008364744.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Malus domestica]
Length=483

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +  P++  +KNWPLMS+II+Y +F L D+AY+E FSLW  SP
Sbjct  269  EQTPKENLFKNWPLMSSIIVYSIFALYDMAYTEIFSLWAVSP  310



>ref|NP_568290.3| zinc induced facilitator-like 1 protein [Arabidopsis thaliana]
 gb|AED91936.1| zinc induced facilitator-like 1 protein [Arabidopsis thaliana]
Length=392

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +     NWPL+S+II+YCVF L+D+AY+E FSLW  SP
Sbjct  177  ERNGKSSLLNNWPLISSIIVYCVFSLHDMAYTEIFSLWANSP  218



>gb|AAM63809.1| transporter-like protein [Arabidopsis thaliana]
Length=392

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +     NWPL+S+II+YCVF L+D+AY+E FSLW  SP
Sbjct  177  ERNGKSSLLNNWPLISSIIVYCVFSLHDMAYTEIFSLWANSP  218



>ref|XP_009414365.1| PREDICTED: probable peptide/nitrate transporter At3g43790 [Musa 
acuminata subsp. malaccensis]
Length=403

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  107  KEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            K   KNWPLMSAII+YCVF L D+AYSE FSLW  S
Sbjct  180  KSLIKNWPLMSAIIVYCVFSLQDMAYSEIFSLWAVS  215



>ref|XP_006399872.1| hypothetical protein EUTSA_v10013388mg [Eutrema salsugineum]
 gb|ESQ41325.1| hypothetical protein EUTSA_v10013388mg [Eutrema salsugineum]
Length=487

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
              Q    KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  274  GSQGSLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  313



>ref|NP_001130680.1| uncharacterized protein LOC100191783 [Zea mays]
 gb|ACF78992.1| unknown [Zea mays]
 gb|ACG43528.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
 gb|ACL54562.1| unknown [Zea mays]
 gb|AFW64733.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
Length=501

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            + +K  ++NWPLMS+II+YCVF  +D+AY+E FSLW ES
Sbjct  284  DSKKSLFRNWPLMSSIIVYCVFSFHDMAYTEVFSLWAES  322



>emb|CBX25426.1| hypothetical_protein [Oryza glaberrima]
Length=410

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  ++NWPLMS+II YCVF L+D AYSE FSLWT S
Sbjct  226  KKSLFRNWPLMSSIITYCVFSLHDTAYSEIFSLWTVS  262



>dbj|BAG89474.1| unnamed protein product [Oryza sativa Japonica Group]
Length=281

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
             K  +KNWPLMS+II+YC+ C +D+AY+E FSLW+ES
Sbjct  96   NKNLFKNWPLMSSIILYCIICFDDMAYTEIFSLWSES  132



>emb|CBX25239.1| hypothetical_protein [Oryza brachyantha]
Length=529

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K    NWPLMS+II+YCVF  +D+AY+E FSLW ES
Sbjct  328  NSKKSLLSNWPLMSSIILYCVFSFHDMAYTEIFSLWAES  366



>gb|ACG25327.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
Length=499

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  ++NWPLMS+II+YC+F  +D+AY+E FSLW ES
Sbjct  284  KKSLFRNWPLMSSIIVYCIFSFHDMAYTEVFSLWAES  320



>emb|CDX91099.1| BnaC02g04980D [Brassica napus]
Length=583

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            +   Q    KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  368  EKTSQGSLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  409



>emb|CDY65709.1| BnaC09g54760D [Brassica napus]
Length=403

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            N +    KNWPL+S+II+YC+F L+D+AY+E FSLW  SP
Sbjct  258  NEKSSLLKNWPLISSIIVYCIFSLHDMAYTEIFSLWANSP  297



>ref|XP_004978595.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Setaria 
italica]
Length=480

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            P+K   KNWPLMS+II YCVF L+D AY+E FSLWT S
Sbjct  266  PKKSLLKNWPLMSSIITYCVFSLHDTAYAEIFSLWTVS  303



>ref|XP_008667080.1| PREDICTED: carbohydrate transporter/ sugar porter/ transporter 
isoform X2 [Zea mays]
Length=413

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  ++NWPLMS+II+YC+F  +D+AY+E FSLW ES
Sbjct  198  KKSLFRNWPLMSSIIVYCIFSFHDMAYTEVFSLWAES  234



>gb|EMS51903.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Triticum urartu]
Length=492

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  YKNWPLMS+II YCVF L+D AYSE FSLW  S
Sbjct  277  KKSLYKNWPLMSSIIAYCVFTLHDTAYSEIFSLWAVS  313



>gb|ABA91323.2| major facilitator superfamily antiporter, putative, expressed 
[Oryza sativa Japonica Group]
Length=343

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  ++NWPLMS+II YCVF L+D AYSE FSLWT S
Sbjct  130  KKSLFRNWPLMSSIITYCVFSLHDTAYSEIFSLWTVS  166



>gb|ABA91324.2| major facilitator superfamily antiporter, putative, expressed 
[Oryza sativa Japonica Group]
Length=275

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  ++NWPLMS+II YCVF L+D AYSE FSLWT S
Sbjct  62   KKSLFRNWPLMSSIITYCVFSLHDTAYSEIFSLWTVS  98



>ref|XP_006582395.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X2 
[Glycine max]
Length=475

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +2

Query  92   DTNPQKEH--YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            D   QK+   ++NWPLMS+II+YCVF L+D+AY E FSLW  SP
Sbjct  255  DKTIQKDKSIFQNWPLMSSIIVYCVFSLHDVAYQEVFSLWALSP  298



>ref|XP_002322579.2| hypothetical protein POPTR_0016s02500g [Populus trichocarpa]
 gb|EEF04340.2| hypothetical protein POPTR_0016s02500g [Populus trichocarpa]
Length=479

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            QK   KNWPL+S+II+YCVF L+D+AY+E FSLW  SP
Sbjct  264  QKSLLKNWPLISSIIVYCVFQLHDMAYAEIFSLWAVSP  301



>ref|XP_008667079.1| PREDICTED: carbohydrate transporter/ sugar porter/ transporter 
isoform X1 [Zea mays]
 tpg|DAA39262.1| TPA: hypothetical protein ZEAMMB73_384773 [Zea mays]
Length=454

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  ++NWPLMS+II+YC+F  +D+AY+E FSLW ES
Sbjct  287  KKSLFRNWPLMSSIIVYCIFSFHDMAYTEVFSLWAES  323



>ref|XP_009383252.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=487

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = +2

Query  101  PQKEH-YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            P+KE+ +KNWPLMS+II+YC+F L+D+AYSE FSLW  S
Sbjct  273  PRKENLFKNWPLMSSIIVYCIFSLHDMAYSEIFSLWAVS  311



>emb|CDX70517.1| BnaC03g06010D [Brassica napus]
Length=487

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q    KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  276  QGPLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  313



>emb|CDX78535.1| BnaA03g04470D [Brassica napus]
Length=487

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q    KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  276  QGPLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  313



>ref|NP_001130901.1| carbohydrate transporter/ sugar porter/ transporter [Zea mays]
 gb|ACF79285.1| unknown [Zea mays]
 tpg|DAA39261.1| TPA: carbohydrate transporter/ sugar porter/ transporter [Zea 
mays]
Length=502

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  ++NWPLMS+II+YC+F  +D+AY+E FSLW ES
Sbjct  287  KKSLFRNWPLMSSIIVYCIFSFHDMAYTEVFSLWAES  323



>gb|EMT28258.1| Putative membrane protein [Aegilops tauschii]
Length=414

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  YKNWPLMS+II YCVF L+D AYSE FSLW  S
Sbjct  199  KKSLYKNWPLMSSIIAYCVFTLHDTAYSEIFSLWAVS  235



>ref|XP_010492179.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
Length=483

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q    KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  272  QVSLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  309



>ref|XP_004249093.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Solanum lycopersicum]
Length=512

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            QK    NWPLMS+II+YCVF L+DIAY E FSLW  SP
Sbjct  273  QKSLLMNWPLMSSIIVYCVFQLHDIAYLEIFSLWAVSP  310



>ref|XP_010492149.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 [Camelina 
sativa]
Length=478

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +     NWPL+S+II+YC+F L+D+AYSE FSLW  SP
Sbjct  263  EKNEKSSLLNNWPLVSSIIVYCIFSLHDMAYSEIFSLWANSP  304



>ref|XP_009131357.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Brassica 
rapa]
Length=484

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q    KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  273  QGPLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  310



>ref|XP_004978596.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Setaria italica]
Length=462

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K  +KNWPLMS+II+YC+F  +D+AY E FSLW ES
Sbjct  245  NTKKSLFKNWPLMSSIIVYCIFSFHDMAYIEVFSLWAES  283



>ref|XP_010453472.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Camelina sativa]
Length=475

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +     NWPL+S+II+YC+F L+D+AYSE FSLW  SP
Sbjct  260  EKNEKSSLLNNWPLVSSIIVYCIFSLHDMAYSEIFSLWANSP  301



>ref|XP_003598367.1| hypothetical protein MTR_3g010820 [Medicago truncatula]
Length=245

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  116  YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + NWPLMS+I++YC+F L DI+Y E FSLW  SP
Sbjct  31   FLNWPLMSSIVVYCIFSLYDISYQEVFSLWAVSP  64



>dbj|BAJ99531.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=504

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            P K   KNWPLMS+I++YC+FC +D+AY+E  SLW+ES
Sbjct  288  PTKNLLKNWPLMSSIVLYCIFCFDDMAYTEIVSLWSES  325



>ref|XP_006582394.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X1 
[Glycine max]
 gb|KHN26426.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Glycine soja]
Length=520

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +2

Query  92   DTNPQKEH--YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            D   QK+   ++NWPLMS+II+YCVF L+D+AY E FSLW  SP
Sbjct  300  DKTIQKDKSIFQNWPLMSSIIVYCVFSLHDVAYQEVFSLWALSP  343



>ref|XP_008777369.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Phoenix dactylifera]
Length=484

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            P +  +KNWPLMS+II+YCVF L+D+AY+E FSLW  S
Sbjct  272  PTENLFKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVS  309



>gb|AAM12978.1| transporter-like protein [Arabidopsis thaliana]
 gb|AAM91200.1| transporter-like protein [Arabidopsis thaliana]
Length=460

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  119  KNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  254  KNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  286



>ref|XP_006832881.1| hypothetical protein AMTR_s00095p00099600, partial [Amborella 
trichopoda]
 gb|ERM98159.1| hypothetical protein AMTR_s00095p00099600, partial [Amborella 
trichopoda]
Length=442

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            QK  +KNWPLMS IIIYC+F L DI+Y+E F LW  SP
Sbjct  276  QKSLWKNWPLMSNIIIYCIFSLFDISYTEIFCLWAVSP  313



>ref|XP_010111301.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Morus notabilis]
 gb|EXC30779.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Morus notabilis]
Length=455

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q+   KNWPLMS+II+YCVF L+D+AYSE F LW  SP
Sbjct  230  QQSLLKNWPLMSSIIVYCVFQLHDMAYSEIFPLWAVSP  267



>ref|XP_010067056.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW65119.1| hypothetical protein EUGRSUZ_G02628 [Eucalyptus grandis]
Length=485

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P+K   +NWPLMS+II+YCVF  +D+AY+E FSLW  SP
Sbjct  273  PKKCLIRNWPLMSSIILYCVFSFHDMAYTEIFSLWAVSP  311



>ref|XP_002871582.1| hypothetical protein ARALYDRAFT_488195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47841.1| hypothetical protein ARALYDRAFT_488195 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  119  KNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  279  KNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  311



>ref|XP_006286669.1| hypothetical protein CARUB_v10002619mg [Capsella rubella]
 gb|EOA19567.1| hypothetical protein CARUB_v10002619mg [Capsella rubella]
Length=479

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +     NWPL+S+II+YC+F L+D+AYSE FSLW  SP
Sbjct  264  ERNEKSSLLNNWPLISSIIVYCIFSLHDMAYSEIFSLWANSP  305



>emb|CDP18958.1| unnamed protein product [Coffea canephora]
Length=490

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/54 (54%), Positives = 35/54 (65%), Gaps = 1/54 (2%)
 Frame = +2

Query  56   FRGCTSSSRG**DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            F G T +  G  +    K   KNWPLMS+II YC+F L+D+AYSE  SLW ESP
Sbjct  259  FNGKTETKDGR-EAASAKSLLKNWPLMSSIIAYCIFSLHDMAYSEICSLWAESP  311



>gb|EEC67612.1| hypothetical protein OsI_34994 [Oryza sativa Indica Group]
Length=470

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  ++NWPLMS+II YCVF L+D AYSE FSLWT S
Sbjct  257  KKSLFRNWPLMSSIITYCVFSLHDTAYSEIFSLWTVS  293



>ref|NP_196878.2| zinc induced facilitator 1 proetin [Arabidopsis thaliana]
 sp|Q8RWN2.2|ZIF1_ARATH RecName: Full=Protein ZINC INDUCED FACILITATOR 1 [Arabidopsis 
thaliana]
 gb|AED91934.1| zinc induced facilitator 1 proetin [Arabidopsis thaliana]
Length=486

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  119  KNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  280  KNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  312



>ref|XP_006662715.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Oryza brachyantha]
Length=400

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K    NWPLMS+II+YCVF  +D+AY+E FSLW ES
Sbjct  183  NSKKSLLSNWPLMSSIILYCVFSFHDMAYTEIFSLWAES  221



>dbj|BAB10596.1| transporter-like protein [Arabidopsis thaliana]
Length=441

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +     NWPL+S+II+YCVF L+D+AY+E FSLW  SP
Sbjct  238  ERNGKSSLLNNWPLISSIIVYCVFSLHDMAYTEIFSLWANSP  279



>ref|NP_001065682.1| Os11g0135000 [Oryza sativa Japonica Group]
 gb|ABA91321.2| major facilitator superfamily antiporter, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF27527.1| Os11g0135000 [Oryza sativa Japonica Group]
 gb|EEE51603.1| hypothetical protein OsJ_32858 [Oryza sativa Japonica Group]
Length=470

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  ++NWPLMS+II YCVF L+D AYSE FSLWT S
Sbjct  257  KKSLFRNWPLMSSIITYCVFSLHDTAYSEIFSLWTVS  293



>ref|XP_008777370.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Phoenix dactylifera]
Length=483

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  101  PQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            P +  +KNWPLMS+II+YCVF L+D+AY+E FSLW  S
Sbjct  271  PTENLFKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVS  308



>ref|XP_010251716.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X5 [Nelumbo nucifera]
Length=918

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  101  PQKEHY-KNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P KE   +NWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  272  PSKESLLRNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  311


 Score = 54.3 bits (129),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  119  KNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +NWPLMS II+YC+F L++IAY+E FSLW  S
Sbjct  714  RNWPLMSTIIVYCIFSLHEIAYAEVFSLWAVS  745



>ref|XP_004978597.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Setaria italica]
Length=459

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K  +KNWPLMS+II+YC+F  +D+AY E FSLW ES
Sbjct  257  NTKKSLFKNWPLMSSIIVYCIFSFHDMAYIEVFSLWAES  295



>ref|XP_006663797.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Oryza brachyantha]
Length=400

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K    NWPLMS+II+YCVF  +D+AY+E FSLW ES
Sbjct  183  NSKKSLLSNWPLMSSIILYCVFSFHDMAYTEIFSLWAES  221



>dbj|BAL15698.1| DMA efflux transporter [Hordeum vulgare]
Length=460

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  YKNWPLMS+II YCVF L+D AYSE FSLW  S
Sbjct  278  KKSLYKNWPLMSSIIAYCVFTLHDTAYSEIFSLWAVS  314



>ref|XP_007010372.1| Zinc induced facilitator-like 1 isoform 2, partial [Theobroma 
cacao]
 gb|EOY19182.1| Zinc induced facilitator-like 1 isoform 2, partial [Theobroma 
cacao]
Length=466

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++  ++   KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  272  ESTSKQSLLKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  313



>ref|NP_851036.1| zinc induced facilitator-like 1 protein [Arabidopsis thaliana]
 sp|Q94BZ1.1|ZIFL1_ARATH RecName: Full=Protein ZINC INDUCED FACILITATOR-LIKE 1; AltName: 
Full=Protein ZIF-LIKE 1 [Arabidopsis thaliana]
 gb|AAK62597.1| AT5g13750/MXE10_2 [Arabidopsis thaliana]
 gb|AAL32945.1| transporter-like protein [Arabidopsis thaliana]
 gb|AAM26717.1| AT5g13750/MXE10_2 [Arabidopsis thaliana]
 gb|AED91935.1| zinc induced facilitator-like 1 protein [Arabidopsis thaliana]
Length=478

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +     NWPL+S+II+YCVF L+D+AY+E FSLW  SP
Sbjct  263  ERNGKSSLLNNWPLISSIIVYCVFSLHDMAYTEIFSLWANSP  304



>ref|XP_010453500.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
Length=483

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q    KNWPLMS+II+YC+ CL+D AYSE F+LW  SP
Sbjct  272  QVSLLKNWPLMSSIIVYCILCLHDTAYSEIFALWANSP  309



>ref|XP_007010373.1| Zinc induced facilitator-like 1 isoform 3 [Theobroma cacao]
 gb|EOY19183.1| Zinc induced facilitator-like 1 isoform 3 [Theobroma cacao]
Length=418

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++  ++   KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  272  ESTSKQSLLKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  313



>ref|XP_006287795.1| hypothetical protein CARUB_v10001006mg [Capsella rubella]
 gb|EOA20693.1| hypothetical protein CARUB_v10001006mg [Capsella rubella]
Length=432

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  119  KNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  280  KNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  312



>gb|KHG08311.1| protein zinc induced facilitator-like 1 [Gossypium arboreum]
Length=511

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++  ++   KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  272  ESTSKQSLLKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  313



>ref|XP_003598370.1| Membrane protein, putative [Medicago truncatula]
 gb|AES68621.1| zinc induced facilitator-like protein [Medicago truncatula]
Length=481

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  119  KNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            KNWPLMS+II+YCVF ++D+A++E FSLW ESP
Sbjct  269  KNWPLMSSIIVYCVFAIHDVAFAEIFSLWAESP  301



>ref|XP_010557807.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Tarenaya 
hassleriana]
 ref|XP_010557808.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Tarenaya 
hassleriana]
 ref|XP_010557809.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Tarenaya 
hassleriana]
Length=477

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  119  KNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  272  KNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  304



>ref|XP_007010371.1| Zinc induced facilitator-like 1 isoform 1 [Theobroma cacao]
 gb|EOY19181.1| Zinc induced facilitator-like 1 isoform 1 [Theobroma cacao]
Length=487

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++  ++   KNWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  272  ESTSKQSLLKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  313



>ref|XP_006662713.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Oryza 
brachyantha]
Length=473

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  +KNWPLMS+I+ YCVF L+D AYSE FSLWT S
Sbjct  260  KKSLFKNWPLMSSILTYCVFSLHDTAYSEIFSLWTVS  296



>gb|KEH32901.1| zinc induced facilitator-like protein [Medicago truncatula]
Length=469

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 2/40 (5%)
 Frame = +2

Query  104  QKEH--YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            QK+    KNWPLMS+II+YCVF ++D+A++E FSLW ESP
Sbjct  250  QKDESLLKNWPLMSSIIVYCVFAIHDVAFAEIFSLWAESP  289



>ref|XP_006663795.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Oryza 
brachyantha]
Length=473

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  +KNWPLMS+I+ YCVF L+D AYSE FSLWT S
Sbjct  260  KKSLFKNWPLMSSILTYCVFSLHDTAYSEIFSLWTVS  296



>ref|XP_010547293.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Tarenaya 
hassleriana]
 ref|XP_010547294.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Tarenaya 
hassleriana]
Length=473

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 2/52 (4%)
 Frame = +2

Query  62   GCTSSSRG**DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            G   +++G  D+N      KNWPLMS+I++YCV CL+D AYSE F+LW  SP
Sbjct  251  GNKENNKGNKDSN--GSLLKNWPLMSSIMVYCVLCLHDTAYSEIFALWANSP  300



>emb|CDP11656.1| unnamed protein product [Coffea canephora]
Length=504

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q    KNWPLMS+II YCVF L+D+AYSE FSLW  SP
Sbjct  279  QSSLLKNWPLMSSIITYCVFQLHDMAYSEIFSLWAISP  316



>gb|EEE66677.1| hypothetical protein OsJ_23324 [Oryza sativa Japonica Group]
Length=374

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
             K  +KNWPLMS+II+YC+ C +D+AY+E FSLW+ES
Sbjct  222  NKNLFKNWPLMSSIILYCIICFDDMAYTEIFSLWSES  258



>ref|XP_004517218.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like, partial [Cicer 
arietinum]
Length=274

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +2

Query  116  YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + NWPLMS+II YC+F L+DIAY E FSLW  SP
Sbjct  60   FMNWPLMSSIIAYCIFALHDIAYQEVFSLWAVSP  93



>ref|XP_007148766.1| hypothetical protein PHAVU_005G012400g [Phaseolus vulgaris]
 gb|ESW20760.1| hypothetical protein PHAVU_005G012400g [Phaseolus vulgaris]
Length=479

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  KEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            K  ++NWPLMS+II+YCVF L+D+AY E FSLW  SP
Sbjct  270  KSIFQNWPLMSSIIVYCVFSLHDVAYQEVFSLWALSP  306



>gb|EAZ02981.1| hypothetical protein OsI_25122 [Oryza sativa Indica Group]
Length=375

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
             K  +KNWPLMS+II+YC+ C +D+AY+E FSLW+ES
Sbjct  258  NKNLFKNWPLMSSIILYCIICFDDMAYTEIFSLWSES  294



>ref|XP_010420011.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
 ref|XP_010420012.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Camelina 
sativa]
Length=483

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            Q    KNWPLMS+II+YC+ CL+D AYSE F+LW  SP
Sbjct  272  QVSLLKNWPLMSSIIVYCILCLHDTAYSEIFALWANSP  309



>ref|XP_006662714.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Oryza brachyantha]
Length=488

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K    NWPLMS+II+YCVF  +D+AY+E FSLW ES
Sbjct  271  NSKKSLLSNWPLMSSIILYCVFSFHDMAYTEIFSLWAES  309



>ref|XP_006663796.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Oryza brachyantha]
Length=486

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  98   NPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            N +K    NWPLMS+II+YCVF  +D+AY+E FSLW ES
Sbjct  269  NSKKSLLSNWPLMSSIILYCVFSFHDMAYTEIFSLWAES  307



>dbj|BAB10595.1| transporter-like protein [Arabidopsis thaliana]
Length=515

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  119  KNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            KNWPLMS+II+YCV CL+D AYSE F+LW  SP
Sbjct  297  KNWPLMSSIIVYCVLCLHDTAYSEIFALWANSP  329



>emb|CBX25238.1| hypothetical_protein [Oryza brachyantha]
Length=453

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K  +KNWPLMS+I+ YCVF L+D AYSE FSLWT S
Sbjct  301  KKSLFKNWPLMSSILTYCVFSLHDTAYSEIFSLWTVS  337



>ref|XP_002871583.1| hypothetical protein ARALYDRAFT_488196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47842.1| hypothetical protein ARALYDRAFT_488196 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +     NWPL+S+II+YCVF L+D+AY+E FSLW  SP
Sbjct  264  ERNEKSSLLNNWPLISSIIVYCVFSLHDMAYTEIFSLWANSP  305



>emb|CDX70518.1| BnaC03g06020D [Brassica napus]
Length=481

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +    KNWPL+S+II+YC+  L+D+AY+E FSLW  SP
Sbjct  266  ERNEKNSLLKNWPLISSIIVYCILSLHDMAYTEVFSLWANSP  307



>ref|XP_006578391.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Glycine max]
Length=478

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
             K  ++NWPLMS+II+YC+F L+D+AY E FSLW  SP
Sbjct  268  DKSIFRNWPLMSSIIVYCIFSLHDVAYQEVFSLWALSP  305



>ref|XP_009131358.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Brassica 
rapa]
Length=481

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +    KNWPL+S+II+YC+  L+D+AY+E FSLW  SP
Sbjct  266  ERNEKNSLLKNWPLISSIIVYCILSLHDMAYTEVFSLWANSP  307



>emb|CDX78536.1| BnaA03g04480D [Brassica napus]
Length=481

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +    KNWPL+S+II+YC+  L+D+AY+E FSLW  SP
Sbjct  266  ERNEKNSLLKNWPLISSIIVYCILSLHDMAYTEVFSLWANSP  307



>ref|XP_006578392.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Glycine max]
Length=427

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
             K  ++NWPLMS+II+YC+F L+D+AY E FSLW  SP
Sbjct  268  DKSIFRNWPLMSSIIVYCIFSLHDVAYQEVFSLWALSP  305



>ref|NP_001031877.1| zinc induced facilitator-like 1 protein [Arabidopsis thaliana]
 gb|AED91937.1| zinc induced facilitator-like 1 protein [Arabidopsis thaliana]
Length=411

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +     NWPL+S+II+YCVF L+D+AY+E FSLW  SP
Sbjct  263  ERNGKSSLLNNWPLISSIIVYCVFSLHDMAYTEIFSLWANSP  304



>ref|XP_011079138.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Sesamum indicum]
Length=503

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            T  Q+  ++NWPL+SAII+YC+F L+D+AYSE FSLW  S
Sbjct  275  TVSQRSLFRNWPLVSAIIVYCIFQLHDMAYSEIFSLWAVS  314



>gb|EMS67726.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Triticum urartu]
Length=440

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
              + +K  +KNWPLMS+II+YC+F  +D+AY+E FSLW ES
Sbjct  221  SVDTKKSLFKNWPLMSSIIVYCIFSYHDMAYTEVFSLWAES  261



>ref|XP_006582392.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Glycine max]
 ref|XP_006582393.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X2 [Glycine max]
 gb|KHN26425.1| Protein ZINC INDUCED FACILITATOR-LIKE 1 [Glycine soja]
Length=478

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  107  KEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            K  ++NWPLMS+II+YC+F L+D+AY E FSLW  SP
Sbjct  269  KSIFRNWPLMSSIIVYCIFSLHDVAYQEIFSLWALSP  305



>dbj|BAH56812.1| AT5G13750 [Arabidopsis thaliana]
Length=392

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + N +     NWPL+S+II+YCVF L+D+AY+E FSLW  SP
Sbjct  263  ERNGKSSLLNNWPLISSIIVYCVFSLHDMAYTEIFSLWANSP  304



>ref|XP_010251709.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010251711.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Nelumbo nucifera]
Length=503

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = +2

Query  101  PQKEHY-KNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            P KE   +NWPLMS+II+YCVF L+D+AY+E FSLW  SP
Sbjct  272  PSKESLLRNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVSP  311



>gb|ABG21873.1| transporter, putative, expressed [Oryza sativa Japonica Group]
Length=502

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K   +NWPLMS+II+YCVF  +D+AY+E FSLW ES
Sbjct  287  KKSLLRNWPLMSSIILYCVFSFHDMAYTEIFSLWAES  323



>ref|XP_011079140.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Sesamum indicum]
Length=473

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            T  Q+  ++NWPL+SAII+YC+F L+D+AYSE FSLW  S
Sbjct  275  TVSQRSLFRNWPLVSAIIVYCIFQLHDMAYSEIFSLWAVS  314



>ref|XP_011079141.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X4 [Sesamum indicum]
Length=464

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            T  Q+  ++NWPL+SAII+YC+F L+D+AYSE FSLW  S
Sbjct  275  TVSQRSLFRNWPLVSAIIVYCIFQLHDMAYSEIFSLWAVS  314



>gb|ABG21872.1| transporter, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAG94813.1| unnamed protein product [Oryza sativa Japonica Group]
Length=425

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K   +NWPLMS+II+YCVF  +D+AY+E FSLW ES
Sbjct  210  KKSLLRNWPLMSSIILYCVFSFHDMAYTEIFSLWAES  246



>gb|AFK38823.1| unknown [Lotus japonicus]
Length=486

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  95   TNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            T   +   KNWPLMS+II+YC+F L+D+AY+E FSLW  SP
Sbjct  265  TQKNENLLKNWPLMSSIIVYCIFSLHDMAYTEVFSLWAVSP  305



>ref|XP_006364750.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like [Solanum tuberosum]
Length=514

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            QK   KNWPL+S+II+YCVF L+DIAY E FSLW  SP
Sbjct  275  QKSLLKNWPLVSSIIVYCVFQLHDIAYLEIFSLWAVSP  312



>ref|XP_010922100.1| PREDICTED: protein ZINC INDUCED FACILITATOR 1-like isoform X2 
[Elaeis guineensis]
Length=439

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +  P +  +KNWPLMS+II+YCVF L+D+AY+E FSLW  S
Sbjct  268  ERAPTENLFKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVS  308



>ref|XP_010922099.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X1 [Elaeis guineensis]
Length=483

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +  P +  +KNWPLMS+II+YCVF L+D+AY+E FSLW  S
Sbjct  268  ERAPTENLFKNWPLMSSIIVYCVFSLHDMAYTEIFSLWAVS  308



>ref|XP_002277598.2| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1 [Vitis vinifera]
Length=548

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  116  YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + NWPLMS+IIIYCVF L+DIAY E FSLW  SP
Sbjct  341  FMNWPLMSSIIIYCVFSLHDIAYIEIFSLWAVSP  374



>ref|XP_009608809.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Nicotiana tomentosiformis]
Length=304

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +2

Query  92   DTNPQKEHYKNWPLMSAIIIYCVFCLNDIAYSETF  196
            ++NP++  +KNWPLMS+IIIYC+F L+D+AYSE F
Sbjct  265  ESNPKENLFKNWPLMSSIIIYCIFALHDMAYSEMF  299



>ref|XP_002455465.1| hypothetical protein SORBIDRAFT_03g011240 [Sorghum bicolor]
 gb|EES00585.1| hypothetical protein SORBIDRAFT_03g011240 [Sorghum bicolor]
Length=489

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  107  KEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            K   KNW LMSA+IIYC+FCL+D AY ETFSLW  S
Sbjct  279  KNLLKNWQLMSAVIIYCIFCLHDTAYLETFSLWAVS  314



>ref|NP_196898.5| aminopeptidase [Arabidopsis thaliana]
 gb|AED91962.1| aminopeptidase [Arabidopsis thaliana]
Length=809

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  122  NWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            NWPLMS+II+YC+ CL++ AYSE F+LW  SP
Sbjct  162  NWPLMSSIIVYCILCLHETAYSEIFALWANSP  193



>ref|XP_006582391.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like isoform 
X3 [Glycine max]
Length=390

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +2

Query  116  YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            ++NWPLMS+II+YCVF L+D AYSE FSLW  SP
Sbjct  177  FRNWPLMSSIIVYCVFSLHDNAYSEVFSLWAVSP  210



>gb|KEH19210.1| zinc induced facilitator-like protein [Medicago truncatula]
Length=480

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  116  YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + NWPLMS+II+YCVF L+DIAY E FSLW  SP
Sbjct  266  FMNWPLMSSIIVYCVFSLHDIAYHEVFSLWATSP  299



>ref|XP_011032990.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Populus 
euphratica]
 ref|XP_011032991.1| PREDICTED: protein ZINC INDUCED FACILITATOR-LIKE 1-like [Populus 
euphratica]
Length=495

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = +2

Query  119  KNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            KNWPLMS+II+YC+F L+D+AY+E FSLW ES
Sbjct  282  KNWPLMSSIIVYCIFSLHDMAYTEIFSLWAES  313



>gb|KEH19211.1| zinc induced facilitator-like protein [Medicago truncatula]
Length=434

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  116  YKNWPLMSAIIIYCVFCLNDIAYSETFSLWTESP  217
            + NWPLMS+II+YCVF L+DIAY E FSLW  SP
Sbjct  266  FMNWPLMSSIIVYCVFSLHDIAYHEVFSLWATSP  299



>gb|ABG22349.1| transporter, putative, expressed [Oryza sativa Japonica Group]
Length=504

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  104  QKEHYKNWPLMSAIIIYCVFCLNDIAYSETFSLWTES  214
            +K    NWPLMS+II+YCVF  +D+AY+E FSLW ES
Sbjct  289  KKSLLSNWPLMSSIILYCVFSFHDMAYTEIFSLWAES  325



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520545476836