BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c100116_g1_i1 len=322 path=[1:0-321]

Length=322
                                                                      Score     E

ref|XP_010315623.1|  PREDICTED: cation-chloride cotransporter 1 i...    188   2e-53   
ref|XP_010315621.1|  PREDICTED: cation-chloride cotransporter 1 i...    188   2e-53   
ref|XP_010315620.1|  PREDICTED: cation-chloride cotransporter 1 i...    188   3e-53   
ref|XP_006359094.1|  PREDICTED: cation-chloride cotransporter 1-like    188   5e-53   
ref|XP_004231552.1|  PREDICTED: cation-chloride cotransporter 1 i...    188   5e-53   
ref|XP_009628380.1|  PREDICTED: cation-chloride cotransporter 1 i...    187   6e-53   
ref|XP_009804716.1|  PREDICTED: cation-chloride cotransporter 1 i...    187   8e-53   
ref|XP_009628379.1|  PREDICTED: cation-chloride cotransporter 1 i...    187   8e-53   
ref|XP_009804715.1|  PREDICTED: cation-chloride cotransporter 1 i...    186   1e-52   
ref|XP_009628378.1|  PREDICTED: cation-chloride cotransporter 1 i...    187   2e-52   
ref|XP_009804713.1|  PREDICTED: cation-chloride cotransporter 1 i...    187   2e-52   
emb|CDY12056.1|  BnaC03g59720D                                          186   1e-51   
ref|XP_010275770.1|  PREDICTED: cation-chloride cotransporter 1-l...    184   2e-51   
ref|XP_010275768.1|  PREDICTED: cation-chloride cotransporter 1-l...    184   2e-51   
ref|XP_010265903.1|  PREDICTED: cation-chloride cotransporter 1-like    183   3e-51   
emb|CDX90250.1|  BnaA08g17340D                                          182   5e-51   
ref|XP_009109586.1|  PREDICTED: cation-chloride cotransporter 1         182   7e-51   
gb|KDP34959.1|  hypothetical protein JCGZ_09247                         182   8e-51   
ref|XP_010686647.1|  PREDICTED: cation-chloride cotransporter 1         181   2e-50   
gb|EYU43239.1|  hypothetical protein MIMGU_mgv1a000978mg                181   2e-50   
ref|XP_007213604.1|  hypothetical protein PRUPE_ppa002325mg             177   7e-50   
ref|XP_010928376.1|  PREDICTED: cation-chloride cotransporter 1-like    179   1e-49   
ref|XP_007138527.1|  hypothetical protein PHAVU_009G216800g             177   1e-49   
ref|XP_009386802.1|  PREDICTED: cation-chloride cotransporter 1-l...    178   2e-49   
ref|XP_010655723.1|  PREDICTED: cation-chloride cotransporter 1 i...    178   2e-49   
ref|XP_011085219.1|  PREDICTED: cation-chloride cotransporter 1         178   2e-49   
ref|XP_010463000.1|  PREDICTED: cation-chloride cotransporter 1-like    175   2e-49   
ref|XP_009386801.1|  PREDICTED: cation-chloride cotransporter 1-l...    178   2e-49   
ref|XP_010655720.1|  PREDICTED: cation-chloride cotransporter 1 i...    178   3e-49   
emb|CBI30989.3|  unnamed protein product                                178   3e-49   
ref|XP_004488270.1|  PREDICTED: cation-chloride cotransporter 1-like    177   4e-49   
ref|XP_008781081.1|  PREDICTED: cation-chloride cotransporter 1-l...    177   4e-49   
ref|XP_008781082.1|  PREDICTED: cation-chloride cotransporter 1-l...    177   4e-49   
gb|KHF99564.1|  Cation-chloride cotransporter 1                         177   5e-49   
ref|XP_008225560.1|  PREDICTED: cation-chloride cotransporter 1         177   6e-49   
ref|XP_007138528.1|  hypothetical protein PHAVU_009G216800g             177   6e-49   
ref|XP_003565703.1|  PREDICTED: cation-chloride cotransporter 1-like    176   9e-49   
ref|XP_008799639.1|  PREDICTED: cation-chloride cotransporter 1-l...    176   1e-48   
ref|XP_008799625.1|  PREDICTED: cation-chloride cotransporter 1-l...    176   1e-48   
ref|XP_009344396.1|  PREDICTED: cation-chloride cotransporter 1-like    176   1e-48   
ref|XP_010921512.1|  PREDICTED: cation-chloride cotransporter 1-l...    176   1e-48   
ref|XP_010921511.1|  PREDICTED: cation-chloride cotransporter 1-l...    176   1e-48   
ref|XP_002450297.1|  hypothetical protein SORBIDRAFT_05g003370          175   2e-48   Sorghum bicolor [broomcorn]
ref|XP_008656210.1|  PREDICTED: LOW QUALITY PROTEIN: cation-chlor...    176   2e-48   
dbj|BAD44902.1|  putative potassium-chloride cotransporter isoform 4    175   2e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EEC70491.1|  hypothetical protein OsI_01563                          175   2e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_004967551.1|  PREDICTED: cation-chloride cotransporter 2-like    175   3e-48   
ref|XP_006369978.1|  hypothetical protein POPTR_0001s36780g             173   3e-48   
sp|Q657W3.2|CCC2_ORYSJ  RecName: Full=Cation-chloride cotransport...    175   3e-48   Oryza sativa Japonica Group [Japonica rice]
gb|ACE78321.1|  cation-chloride cotransporter-like protein              175   3e-48   Lotus tenuis [slender trefoil]
ref|XP_010480752.1|  PREDICTED: cation-chloride cotransporter 1-like    173   5e-48   
ref|XP_009410340.1|  PREDICTED: cation-chloride cotransporter 1-like    174   5e-48   
ref|XP_010478432.1|  PREDICTED: cation-chloride cotransporter 1-like    174   6e-48   
ref|XP_006415472.1|  hypothetical protein EUTSA_v10006695mg             174   6e-48   
ref|XP_010460835.1|  PREDICTED: cation-chloride cotransporter 1         174   8e-48   
emb|CDX77592.1|  BnaA07g07300D                                          174   9e-48   
ref|XP_003568633.1|  PREDICTED: cation-chloride cotransporter 1         173   1e-47   
gb|EMS63243.1|  Solute carrier family 12 member 6                       173   1e-47   
ref|XP_010519078.1|  PREDICTED: LOW QUALITY PROTEIN: cation-chlor...    173   1e-47   
ref|NP_174333.2|  cation-chloride co-transporter 1                      173   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAF19744.1|AC009917_3  Strong similarity to gb|AF021220 Nicoti...    173   2e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890871.1|  hypothetical protein ARALYDRAFT_473269             173   2e-47   
ref|XP_004169776.1|  PREDICTED: LOW QUALITY PROTEIN: cation-chlor...    170   2e-47   
emb|CDX98204.1|  BnaC07g08940D                                          172   3e-47   
gb|KEH37821.1|  cation-chloride cotransporter                           172   3e-47   
ref|XP_011046736.1|  PREDICTED: cation-chloride cotransporter 1-like    172   3e-47   
ref|XP_006352987.1|  PREDICTED: cation-chloride cotransporter 1-l...    171   3e-47   
ref|XP_006645801.1|  PREDICTED: cation-chloride cotransporter 2-like    172   3e-47   
ref|XP_010316942.1|  PREDICTED: cation-chloride cotransporter 1 i...    171   4e-47   
ref|XP_006352986.1|  PREDICTED: cation-chloride cotransporter 1-l...    171   4e-47   
ref|XP_003595505.1|  Solute carrier family 12 member                    172   5e-47   
ref|XP_008680718.1|  PREDICTED: cation-chloride cotransporter 2-like    170   5e-47   
ref|XP_010316941.1|  PREDICTED: cation-chloride cotransporter 1 i...    171   5e-47   
ref|XP_009102698.1|  PREDICTED: cation-chloride cotransporter 1-like    171   5e-47   
gb|AFW64849.1|  hypothetical protein ZEAMMB73_634073                    170   5e-47   
ref|XP_004233139.1|  PREDICTED: cation-chloride cotransporter 1 i...    171   7e-47   
ref|XP_006352985.1|  PREDICTED: cation-chloride cotransporter 1-l...    171   8e-47   
gb|KDO75321.1|  hypothetical protein CISIN_1g002018mg                   168   1e-46   
ref|XP_002526613.1|  cation:chloride symporter, putative                171   1e-46   Ricinus communis
gb|KGN65931.1|  hypothetical protein Csa_1G538780                       170   1e-46   
ref|XP_008445142.1|  PREDICTED: cation-chloride cotransporter 1 i...    169   2e-46   
ref|XP_006306671.1|  hypothetical protein CARUB_v10008188mg             170   3e-46   
ref|XP_008445134.1|  PREDICTED: cation-chloride cotransporter 1 i...    169   3e-46   
ref|XP_007041133.1|  Cation-chloride co-transporter 1                   168   8e-46   
ref|XP_002975190.1|  hypothetical protein SELMODRAFT_150343             167   9e-46   
ref|XP_002977594.1|  hypothetical protein SELMODRAFT_151983             167   1e-45   
gb|KDO75319.1|  hypothetical protein CISIN_1g002018mg                   167   1e-45   
ref|XP_006448939.1|  hypothetical protein CICLE_v10014154mg             167   1e-45   
ref|XP_006468281.1|  PREDICTED: cation-chloride cotransporter 1-like    167   2e-45   
gb|KDO75320.1|  hypothetical protein CISIN_1g002018mg                   167   2e-45   
gb|AFW77716.1|  hypothetical protein ZEAMMB73_362284                    166   4e-45   
gb|ADF30875.1|  cation-chloride cotransporter                           166   4e-45   
ref|XP_008650609.1|  PREDICTED: cation-chloride cotransporter 1-like    165   5e-45   
gb|KHN06604.1|  Cation-chloride cotransporter 1                         164   5e-45   
ref|XP_004962386.1|  PREDICTED: cation-chloride cotransporter 1-l...    165   6e-45   
gb|EMT12359.1|  Solute carrier family 12 member 7                       166   8e-45   
ref|XP_001752655.1|  predicted protein                                  165   8e-45   
ref|XP_009362253.1|  PREDICTED: cation-chloride cotransporter 1-like    165   1e-44   
gb|EMT23953.1|  Solute carrier family 12 member 6                       163   1e-44   
ref|XP_008372221.1|  PREDICTED: cation-chloride cotransporter 1-like    165   1e-44   
gb|EEE54414.1|  hypothetical protein OsJ_01456                          164   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008383418.1|  PREDICTED: cation-chloride cotransporter 1-like    165   1e-44   
ref|XP_002440935.1|  hypothetical protein SORBIDRAFT_09g017170          165   1e-44   Sorghum bicolor [broomcorn]
ref|XP_001771559.1|  predicted protein                                  164   1e-44   
sp|Q6Z0E2.1|CCC1_ORYSJ  RecName: Full=Cation-chloride cotransport...    165   1e-44   Oryza sativa Japonica Group [Japonica rice]
gb|AAC49874.1|  cation-chloride co-transporter                          165   2e-44   Nicotiana tabacum [American tobacco]
gb|EAZ06533.1|  hypothetical protein OsI_28779                          165   2e-44   Oryza sativa Indica Group [Indian rice]
ref|XP_004962385.1|  PREDICTED: cation-chloride cotransporter 1-l...    164   2e-44   
gb|KHN41441.1|  Cation-chloride cotransporter 1                         164   2e-44   
ref|XP_001754624.1|  predicted protein                                  164   2e-44   
ref|XP_003533835.1|  PREDICTED: cation-chloride cotransporter 1-like    164   3e-44   
ref|XP_009766115.1|  PREDICTED: cation-chloride cotransporter 1-l...    163   3e-44   
gb|AFW81651.1|  hypothetical protein ZEAMMB73_928402                    153   3e-44   
ref|XP_003546564.1|  PREDICTED: cation-chloride cotransporter 1-like    164   3e-44   
ref|XP_009591378.1|  PREDICTED: cation-chloride cotransporter 1-l...    163   3e-44   
ref|XP_009591380.1|  PREDICTED: cation-chloride cotransporter 1-l...    163   3e-44   
ref|XP_009766112.1|  PREDICTED: cation-chloride cotransporter 1-l...    164   4e-44   
gb|KHG11109.1|  Cation-chloride cotransporter 1                         163   4e-44   
ref|XP_009766113.1|  PREDICTED: cation-chloride cotransporter 1-l...    163   4e-44   
ref|XP_009766111.1|  PREDICTED: cation-chloride cotransporter 1-l...    163   4e-44   
emb|CDP19733.1|  unnamed protein product                                163   5e-44   
ref|XP_003557250.1|  PREDICTED: cation-chloride cotransporter 1-like    163   5e-44   
ref|XP_011012482.1|  PREDICTED: cation-chloride cotransporter 1-like    163   7e-44   
ref|XP_010051971.1|  PREDICTED: cation-chloride cotransporter 1         162   8e-44   
gb|EMS47393.1|  Solute carrier family 12 member 6                       162   1e-43   
ref|XP_004293999.1|  PREDICTED: cation-chloride cotransporter 1-like    162   1e-43   
ref|XP_006661616.1|  PREDICTED: cation-chloride cotransporter 1-like    162   1e-43   
ref|XP_001756366.1|  predicted protein                                  162   1e-43   
ref|XP_006836309.1|  hypothetical protein AMTR_s00092p00043650          159   9e-43   
ref|XP_006377639.1|  hypothetical protein POPTR_0011s09300g             140   9e-37   
ref|XP_009037856.1|  hypothetical protein AURANDRAFT_53926              122   7e-30   
ref|XP_004135733.1|  PREDICTED: cation-chloride cotransporter 1-like    121   3e-29   
ref|XP_007610095.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...    121   4e-29   
ref|XP_003147811.1|  hypothetical protein LOAG_12249                    118   6e-29   
ref|XP_006818288.1|  PREDICTED: solute carrier family 12 member 7...    120   7e-29   
gb|ENN76824.1|  hypothetical protein YQE_06665                          119   1e-28   
gb|EJD73621.1|  K /cl-cotransporter protein 2                           118   2e-28   
ref|XP_001987039.1|  GH20188                                            119   2e-28   Drosophila grimshawi
gb|ETN62998.1|  potassium/chloride symporter                            118   3e-28   
ref|XP_002015636.1|  GL11178                                            119   3e-28   Drosophila persimilis
ref|XP_002049970.1|  GJ21885                                            119   3e-28   Drosophila virilis
ref|XP_002063789.1|  GK15715                                            118   3e-28   Drosophila willistoni
ref|XP_002942716.1|  PREDICTED: solute carrier family 12 member 4...    118   4e-28   
gb|KFB47485.1|  AGAP011498-PA-like protein                              118   4e-28   
ref|NP_001286794.1|  kazachoc, isoform F                                118   4e-28   
ref|XP_001976496.1|  GG22903                                            118   5e-28   Drosophila erecta
ref|NP_571976.2|  kazachoc, isoform C                                   118   5e-28   Drosophila melanogaster
ref|XP_002092713.1|  GE14341                                            118   5e-28   Drosophila yakuba
ref|NP_726377.1|  kazachoc, isoform D                                   118   5e-28   Drosophila melanogaster
ref|NP_001286795.1|  kazachoc, isoform G                                118   5e-28   
ref|NP_726378.1|  kazachoc, isoform A                                   118   5e-28   Drosophila melanogaster
ref|XP_008316487.1|  PREDICTED: solute carrier family 12 member 6...    118   5e-28   
ref|XP_001959437.1|  GF12875                                            118   5e-28   Drosophila ananassae
ref|XP_008316494.1|  PREDICTED: solute carrier family 12 member 6...    118   5e-28   
ref|XP_002040175.1|  GM16063                                            118   5e-28   Drosophila sechellia
ref|XP_007887682.1|  PREDICTED: solute carrier family 12 member 4...    118   6e-28   
ref|NP_726379.1|  kazachoc, isoform B                                   118   6e-28   Drosophila melanogaster
ref|XP_005025758.1|  PREDICTED: solute carrier family 12 member 4...    118   6e-28   
ref|XP_008316459.1|  PREDICTED: solute carrier family 12 member 6...    118   6e-28   
ref|XP_005025761.1|  PREDICTED: solute carrier family 12 member 4...    117   7e-28   
ref|XP_008499512.1|  PREDICTED: solute carrier family 12 member 4...    117   7e-28   
ref|XP_007910505.1|  PREDICTED: solute carrier family 12 member 5...    117   7e-28   
ref|XP_007910496.1|  PREDICTED: solute carrier family 12 member 5...    117   7e-28   
ref|XP_004175039.1|  PREDICTED: solute carrier family 12 member 4...    117   7e-28   
ref|XP_005052628.1|  PREDICTED: solute carrier family 12 member 4...    117   7e-28   
ref|XP_005912997.1|  PREDICTED: solute carrier family 12 member 4...    117   7e-28   
ref|XP_005912998.1|  PREDICTED: solute carrier family 12 member 4...    117   8e-28   
ref|XP_317803.3|  AGAP011498-PA                                         117   8e-28   Anopheles gambiae str. PEST
ref|XP_006779859.1|  PREDICTED: solute carrier family 12 member 4...    117   8e-28   
ref|XP_004539718.1|  PREDICTED: solute carrier family 12 member 4...    117   8e-28   
ref|XP_003437579.1|  PREDICTED: solute carrier family 12 member 4...    117   8e-28   
ref|XP_003437580.1|  PREDICTED: solute carrier family 12 member 4...    117   8e-28   
ref|XP_010131533.1|  PREDICTED: solute carrier family 12 member 4       117   8e-28   
ref|XP_009075074.1|  PREDICTED: solute carrier family 12 member 4       117   8e-28   
ref|XP_004534770.1|  PREDICTED: solute carrier family 12 member 6...    117   8e-28   
ref|XP_002189635.2|  PREDICTED: solute carrier family 12 member 4...    117   8e-28   Taeniopygia guttata
gb|KFU94747.1|  Solute carrier family 12 member 4                       117   8e-28   
ref|XP_008499511.1|  PREDICTED: solute carrier family 12 member 4...    117   8e-28   
ref|XP_010002720.1|  PREDICTED: solute carrier family 12 member 4       117   8e-28   
ref|XP_005052624.1|  PREDICTED: solute carrier family 12 member 4...    117   8e-28   
ref|XP_010175642.1|  PREDICTED: solute carrier family 12 member 4       117   8e-28   
gb|KFP82213.1|  Solute carrier family 12 member 4                       117   8e-28   
emb|CDQ06781.1|  Protein Bm8657, isoform c                              115   9e-28   
ref|XP_005488931.1|  PREDICTED: solute carrier family 12 member 4...    117   9e-28   
ref|XP_008931652.1|  PREDICTED: solute carrier family 12 member 4       117   9e-28   
ref|XP_007887681.1|  PREDICTED: solute carrier family 12 member 4...    117   9e-28   
ref|XP_006002448.1|  PREDICTED: solute carrier family 12 member 5       117   9e-28   
gb|EYC42509.1|  hypothetical protein Y032_0529g2998                     117   9e-28   
ref|XP_010180265.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...    117   9e-28   
ref|XP_008208471.1|  PREDICTED: solute carrier family 12 member 4...    117   9e-28   
ref|XP_005526407.1|  PREDICTED: solute carrier family 12 member 4...    117   9e-28   
ref|XP_005025760.1|  PREDICTED: solute carrier family 12 member 4...    117   9e-28   
ref|XP_010216245.1|  PREDICTED: solute carrier family 12 member 4       117   9e-28   
ref|XP_010583072.1|  PREDICTED: solute carrier family 12 member 4       117   9e-28   
ref|XP_009866725.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_008208470.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
gb|KFO87945.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|EJW80315.1|  hypothetical protein WUBG_08776                         114   1e-27   
emb|CAF91145.1|  unnamed protein product                                117   1e-27   Tetraodon nigroviridis
gb|KFW75874.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|EOA96920.1|  Solute carrier family 12 member 4                       117   1e-27   
ref|XP_007910482.1|  PREDICTED: solute carrier family 12 member 5...    117   1e-27   
ref|XP_009951782.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_004944227.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_009884678.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
emb|CDJ86943.1|  Amino acid permease-associated region domain con...    117   1e-27   
ref|XP_009937817.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_005526404.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_010394904.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_009319071.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...    117   1e-27   
ref|XP_010716115.1|  PREDICTED: solute carrier family 12 member 4       116   1e-27   
ref|XP_010287711.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
gb|KGL79527.1|  Solute carrier family 12 member 4                       117   1e-27   
ref|XP_010394905.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_009973834.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_009704882.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_008277924.1|  PREDICTED: solute carrier family 12 member 6...    117   1e-27   
ref|XP_006121169.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_005488929.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_005488927.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_005488930.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_006121168.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_009088881.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_005422781.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_005488928.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_007910490.1|  PREDICTED: solute carrier family 12 member 5...    117   1e-27   
ref|XP_010118797.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_009897438.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_009467494.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_005233553.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_009982158.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
gb|KFP06625.1|  Solute carrier family 12 member 4                       117   1e-27   
ref|XP_001505237.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_005152287.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
gb|KFP58700.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFZ51766.1|  Solute carrier family 12 member 4                       117   1e-27   
ref|XP_008165136.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_010747336.1|  PREDICTED: solute carrier family 12 member 6...    117   1e-27   
ref|XP_008277925.1|  PREDICTED: solute carrier family 12 member 6...    117   1e-27   
gb|KGL86629.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFV01330.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFR14634.1|  Solute carrier family 12 member 4                       117   1e-27   
ref|XP_008277922.1|  PREDICTED: solute carrier family 12 member 6...    117   1e-27   
ref|XP_005912999.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_008637128.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_010298582.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
gb|KFV66351.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFQ85077.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFQ77265.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFQ33232.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFP60035.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFP41987.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFO74093.1|  Solute carrier family 12 member 4                       117   1e-27   
ref|XP_008277921.1|  PREDICTED: solute carrier family 12 member 6...    117   1e-27   
gb|KFV43767.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFR01619.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFO63126.1|  Solute carrier family 12 member 4                       117   1e-27   
gb|KFQ13029.1|  Solute carrier family 12 member 4                       117   1e-27   
ref|XP_003641964.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_010287710.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_003976414.1|  PREDICTED: solute carrier family 12 member 6...    117   1e-27   
emb|CDJ86038.1|  Amino acid permease-associated region domain con...    117   1e-27   
ref|XP_003641965.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
gb|KFQ37242.1|  Solute carrier family 12 member 4                       117   1e-27   
ref|XP_007054047.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_008946420.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_009556387.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_005526405.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_005526406.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_009635911.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...    117   1e-27   
ref|XP_004944226.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_008550268.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_005507183.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_005463978.1|  PREDICTED: solute carrier family 12 member 6...    116   1e-27   
gb|KFW64885.1|  Solute carrier family 12 member 4                       117   1e-27   
ref|XP_006121167.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_010747335.1|  PREDICTED: solute carrier family 12 member 6...    117   1e-27   
ref|XP_008308601.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
ref|XP_005152286.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
emb|CDQ06780.1|  Protein Bm8657, isoform a                              114   1e-27   
ref|XP_005152284.1|  PREDICTED: solute carrier family 12 member 4...    117   1e-27   
ref|XP_008550271.1|  PREDICTED: solute carrier family 12 member 6...    117   1e-27   
ref|XP_003223001.1|  PREDICTED: solute carrier family 12 member 4       117   1e-27   
gb|AAF91094.1|AF191023_1  K-Cl cotransporter KCC1                       116   1e-27   
ref|XP_005152288.1|  PREDICTED: solute carrier family 12 member 4...    117   2e-27   
ref|XP_005152285.1|  PREDICTED: solute carrier family 12 member 4...    117   2e-27   
ref|XP_009506363.1|  PREDICTED: solute carrier family 12 member 4       117   2e-27   
ref|XP_009676587.1|  PREDICTED: solute carrier family 12 member 4...    117   2e-27   
ref|XP_009866724.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_008165135.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_005755347.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_004539719.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
emb|CBY21371.1|  unnamed protein product                                116   2e-27   
gb|ELT90881.1|  hypothetical protein CAPTEDRAFT_220110                  116   2e-27   
ref|XP_008165134.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_004563585.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_004534769.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
gb|KFP75782.1|  Solute carrier family 12 member 4                       116   2e-27   
gb|KFW92843.1|  Solute carrier family 12 member 4                       116   2e-27   
gb|KFW06682.1|  Solute carrier family 12 member 4                       116   2e-27   
gb|KFQ52039.1|  Solute carrier family 12 member 4                       116   2e-27   
ref|XP_005748867.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
gb|KFO04523.1|  Solute carrier family 12 member 4                       116   2e-27   
ref|XP_009578119.1|  PREDICTED: solute carrier family 12 member 4       116   2e-27   
ref|XP_010015475.1|  PREDICTED: solute carrier family 12 member 4       116   2e-27   
ref|XP_010774714.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...    116   2e-27   
ref|XP_010075503.1|  PREDICTED: solute carrier family 12 member 4       116   2e-27   
ref|XP_009676586.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
gb|KFV83064.1|  Solute carrier family 12 member 4                       116   2e-27   
ref|NP_062102.1|  solute carrier family 12 member 4                     116   2e-27   
ref|XP_004534765.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_005949366.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_008770714.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_006809523.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_006809525.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_009556692.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...    116   2e-27   
gb|AAH66872.1|  Solute carrier family 12, member 4                      116   2e-27   
ref|NP_033221.1|  solute carrier family 12 member 4 isoform 2           116   2e-27   
ref|XP_004563584.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_005748868.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_006809526.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
dbj|BAE39467.1|  unnamed protein product                                116   2e-27   
ref|XP_006878734.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_004534766.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_006878733.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_005949365.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
dbj|BAE30636.1|  unnamed protein product                                116   2e-27   
ref|XP_006809524.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_006878736.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_005748869.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
dbj|BAE34996.1|  unnamed protein product                                116   2e-27   
ref|NP_001240733.1|  solute carrier family 12 member 4 isoform 1        116   2e-27   
ref|XP_006986894.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
dbj|BAE31836.1|  unnamed protein product                                116   2e-27   
gb|EPS58080.1|  hypothetical protein M569_16736                         110   2e-27   
ref|XP_006255544.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_006986893.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
gb|KFV10095.1|  Solute carrier family 12 member 4                       116   2e-27   
ref|XP_006809522.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_005949363.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_010145816.1|  PREDICTED: solute carrier family 12 member 4       116   2e-27   
ref|XP_004079998.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_006878735.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_004563580.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_005813048.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_005813047.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_005813049.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_006019134.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
dbj|BAE29203.1|  unnamed protein product                                116   2e-27   
ref|XP_008403802.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
dbj|BAE37803.1|  unnamed protein product                                116   2e-27   
ref|XP_006530855.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_007643050.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_006641467.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_005748866.1|  PREDICTED: solute carrier family 12 member 6...    116   2e-27   
ref|XP_007477275.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_008565540.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
gb|EZA57194.1|  Solute carrier family 12 member                         116   2e-27   
ref|XP_006641468.1|  PREDICTED: solute carrier family 12 member 4...    116   2e-27   
ref|XP_008565551.1|  PREDICTED: solute carrier family 12 member 4...    116   3e-27   
ref|XP_005748862.1|  PREDICTED: solute carrier family 12 member 6...    116   3e-27   
ref|XP_008565533.1|  PREDICTED: solute carrier family 12 member 4...    116   3e-27   
ref|XP_008837272.1|  PREDICTED: solute carrier family 12 member 4...    116   3e-27   
ref|XP_008255641.1|  PREDICTED: solute carrier family 12 member 4...    116   3e-27   
gb|KFV91610.1|  Solute carrier family 12 member 4                       115   3e-27   
ref|XP_005318395.1|  PREDICTED: solute carrier family 12 member 4...    116   3e-27   
ref|XP_006019132.1|  PREDICTED: solute carrier family 12 member 4...    116   3e-27   
ref|XP_005318396.1|  PREDICTED: solute carrier family 12 member 4...    116   3e-27   
ref|XP_005345497.1|  PREDICTED: solute carrier family 12 member 4...    116   3e-27   
ref|XP_004661732.1|  PREDICTED: solute carrier family 12 member 4...    116   3e-27   
ref|XP_005345496.1|  PREDICTED: solute carrier family 12 member 4...    116   3e-27   
ref|XP_003758485.1|  PREDICTED: solute carrier family 12 member 4       115   3e-27   
ref|XP_006099516.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005076372.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_003744033.1|  PREDICTED: solute carrier family 12 member 6       115   3e-27   
dbj|BAE39530.1|  unnamed protein product                                115   3e-27   
ref|XP_004584024.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005345495.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005345494.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
gb|KFZ69203.1|  Solute carrier family 12 member 4                       115   3e-27   
ref|XP_004661729.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004584022.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_008837271.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006019133.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_002424915.1|  conserved hypothetical protein                     115   3e-27   
ref|XP_002918502.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005345493.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005809251.1|  PREDICTED: solute carrier family 12 member 6...    115   3e-27   
ref|XP_006269372.1|  PREDICTED: solute carrier family 12 member 4       115   3e-27   
ref|XP_006941700.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004584023.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005076368.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004997283.1|  solute carrier family 12 member 6                  115   3e-27   
gb|EAW83196.1|  solute carrier family 12 (potassium/chloride tran...    114   3e-27   
ref|XP_005076371.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005876486.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004273231.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005876487.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004584025.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006099514.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|NP_001076172.1|  solute carrier family 12 member 4                  115   3e-27   
ref|XP_005076369.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005931817.1|  PREDICTED: solute carrier family 12 member 5...    115   3e-27   
ref|XP_005692222.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_001868398.1|  potassium/chloride symporter                       115   3e-27   
ref|XP_004661731.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_007120849.1|  PREDICTED: solute carrier family 12 member 4       115   3e-27   
ref|XP_002005876.1|  GI20717                                            115   3e-27   
ref|XP_010812833.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004661728.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_007457317.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004690513.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_008138159.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006769896.1|  PREDICTED: solute carrier family 12 member 4       115   3e-27   
ref|XP_004843053.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006099512.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005076370.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004843050.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
emb|CDQ83590.1|  unnamed protein product                                115   3e-27   
ref|XP_007517776.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004393417.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_003364668.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_007561754.1|  PREDICTED: solute carrier family 12 member 6...    115   3e-27   
ref|XP_005876488.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004661730.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006099515.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_007517773.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006041065.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_007457314.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006099511.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004600639.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004843049.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005956896.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005896590.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
gb|ERE79787.1|  solute carrier family 12 member 4                       116   3e-27   
ref|XP_007457318.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_005620670.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006730159.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006180664.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_008138154.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006203778.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006180663.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006028252.1|  PREDICTED: solute carrier family 12 member 6...    115   3e-27   
ref|XP_003384645.1|  PREDICTED: solute carrier family 12 member 6...    115   3e-27   
ref|XP_003998192.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_002607403.1|  hypothetical protein BRAFLDRAFT_205085             115   3e-27   
ref|XP_008138155.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_004273229.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_007477276.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_008700663.1|  PREDICTED: solute carrier family 12 member 4       115   3e-27   
ref|XP_004843054.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_007517777.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_008433502.1|  PREDICTED: solute carrier family 12 member 6...    115   3e-27   
ref|XP_008433503.1|  PREDICTED: solute carrier family 12 member 6...    115   3e-27   
ref|XP_006099510.1|  PREDICTED: solute carrier family 12 member 4...    115   3e-27   
ref|XP_006796458.1|  PREDICTED: solute carrier family 12 member 5...    115   3e-27   
ref|XP_008138158.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_006203779.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_008138156.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_007517774.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_005692221.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_003472054.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_005608405.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_007457316.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_006193680.1|  PREDICTED: solute carrier family 12 member 7...    114   4e-27   
ref|XP_007561753.1|  PREDICTED: solute carrier family 12 member 6...    115   4e-27   
ref|NP_001167562.1|  solute carrier family 12 member 4                  115   4e-27   
ref|NP_001010952.1|  solute carrier family 12 member 4                  115   4e-27   
gb|ELR55801.1|  Solute carrier family 12 member 4                       115   4e-27   
ref|XP_004068989.1|  PREDICTED: solute carrier family 12 member 5...    115   4e-27   
ref|XP_005896589.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_010849308.1|  PREDICTED: solute carrier family 12 member 4       115   4e-27   
ref|XP_007457315.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_008433500.1|  PREDICTED: solute carrier family 12 member 6...    115   4e-27   
ref|XP_005620671.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_007517772.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_007477277.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_004600638.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_006099513.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_004744537.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_003364669.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_008516434.1|  PREDICTED: LOW QUALITY PROTEIN: solute carri...    115   4e-27   
ref|XP_004600637.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_005620665.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_004690511.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_008138157.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_005956895.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_004393415.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
gb|EFB15891.1|  hypothetical protein PANDA_006960                       115   4e-27   
ref|XP_004843052.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_008199568.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_005620666.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_004273230.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_008433501.1|  PREDICTED: solute carrier family 12 member 6...    115   4e-27   
ref|XP_008199563.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_010960802.1|  PREDICTED: solute carrier family 12 member 4       115   4e-27   
ref|XP_003472053.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_004744535.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_005620668.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   
ref|XP_007517775.1|  PREDICTED: solute carrier family 12 member 4...    115   4e-27   



>ref|XP_010315623.1| PREDICTED: cation-chloride cotransporter 1 isoform X4 [Solanum 
lycopersicum]
 ref|XP_010315624.1| PREDICTED: cation-chloride cotransporter 1 isoform X4 [Solanum 
lycopersicum]
Length=814

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TT+ LY+++V FFGSVATR KL
Sbjct  205  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTSALYLVSVLFFGSVATRDKL  264

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTAS+AWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  265  LTDRLLTASIAWPFPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  311



>ref|XP_010315621.1| PREDICTED: cation-chloride cotransporter 1 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010315622.1| PREDICTED: cation-chloride cotransporter 1 isoform X3 [Solanum 
lycopersicum]
Length=839

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TT+ LY+++V FFGSVATR KL
Sbjct  230  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTSALYLVSVLFFGSVATRDKL  289

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTAS+AWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  290  LTDRLLTASIAWPFPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  336



>ref|XP_010315620.1| PREDICTED: cation-chloride cotransporter 1 isoform X2 [Solanum 
lycopersicum]
Length=874

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TT+ LY+++V FFGSVATR KL
Sbjct  265  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTSALYLVSVLFFGSVATRDKL  324

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTAS+AWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  325  LTDRLLTASIAWPFPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  371



>ref|XP_006359094.1| PREDICTED: cation-chloride cotransporter 1-like [Solanum tuberosum]
Length=988

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TT+ LY+++V FFGSVATR KL
Sbjct  379  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTSALYLVSVLFFGSVATRDKL  438

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTAS+AWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  439  LTDRLLTASIAWPFPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  485



>ref|XP_004231552.1| PREDICTED: cation-chloride cotransporter 1 isoform X1 [Solanum 
lycopersicum]
Length=988

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TT+ LY+++V FFGSVATR KL
Sbjct  379  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTSALYLVSVLFFGSVATRDKL  438

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTAS+AWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  439  LTDRLLTASIAWPFPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  485



>ref|XP_009628380.1| PREDICTED: cation-chloride cotransporter 1 isoform X3 [Nicotiana 
tomentosiformis]
Length=840

 Score =   187 bits (474),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TT+ LY+++V FFGSVATR KL
Sbjct  231  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTSGLYLVSVLFFGSVATRDKL  290

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  291  LTDRLLTATIAWPFPAIVYIGIILSTLGAALQSLTGAPRLLAAIAND  337



>ref|XP_009804716.1| PREDICTED: cation-chloride cotransporter 1 isoform X3 [Nicotiana 
sylvestris]
Length=840

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TT+ LY+++V FFGSVATR KL
Sbjct  231  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTSGLYLVSVLFFGSVATRDKL  290

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  291  LTDRLLTATIAWPFPAIVYIGIILSTLGAALQSLTGAPRLLAAIAND  337



>ref|XP_009628379.1| PREDICTED: cation-chloride cotransporter 1 isoform X2 [Nicotiana 
tomentosiformis]
Length=875

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TT+ LY+++V FFGSVATR KL
Sbjct  266  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTSGLYLVSVLFFGSVATRDKL  325

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  326  LTDRLLTATIAWPFPAIVYIGIILSTLGAALQSLTGAPRLLAAIAND  372



>ref|XP_009804715.1| PREDICTED: cation-chloride cotransporter 1 isoform X2 [Nicotiana 
sylvestris]
Length=875

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TT+ LY+++V FFGSVATR KL
Sbjct  266  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTSGLYLVSVLFFGSVATRDKL  325

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  326  LTDRLLTATIAWPFPAIVYIGIILSTLGAALQSLTGAPRLLAAIAND  372



>ref|XP_009628378.1| PREDICTED: cation-chloride cotransporter 1 isoform X1 [Nicotiana 
tomentosiformis]
Length=987

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TT+ LY+++V FFGSVATR KL
Sbjct  378  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTSGLYLVSVLFFGSVATRDKL  437

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  438  LTDRLLTATIAWPFPAIVYIGIILSTLGAALQSLTGAPRLLAAIAND  484



>ref|XP_009804713.1| PREDICTED: cation-chloride cotransporter 1 isoform X1 [Nicotiana 
sylvestris]
Length=987

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TT+ LY+++V FFGSVATR KL
Sbjct  378  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTSGLYLVSVLFFGSVATRDKL  437

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  438  LTDRLLTATIAWPFPAIVYIGIILSTLGAALQSLTGAPRLLAAIAND  484



>emb|CDY12056.1| BnaC03g59720D [Brassica napus]
Length=1614

 Score =   186 bits (472),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2     LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
             LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA ++TT LYVI+V FFG+VATR KL
Sbjct  1005  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLSTTLLYVISVLFFGAVATRDKL  1064

Query  182   LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
             LTDRLLTA+VAWP P +V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  1065  LTDRLLTATVAWPLPLIVHVGIILSTLGAALQSLTGAPRLLAAIAND  1111



>ref|XP_010275770.1| PREDICTED: cation-chloride cotransporter 1-like isoform X2 [Nelumbo 
nucifera]
Length=922

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TT+ LY+I+V  FG++ATR++L
Sbjct  309  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTSALYLISVLLFGAIATREEL  368

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWPFPA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  369  LTDRLLTATVAWPFPAIIYVGIILSTLGAALQSLTGAPRLLAAIAND  415



>ref|XP_010275768.1| PREDICTED: cation-chloride cotransporter 1-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010275769.1| PREDICTED: cation-chloride cotransporter 1-like isoform X1 [Nelumbo 
nucifera]
Length=932

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TT+ LY+I+V  FG++ATR++L
Sbjct  319  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTSALYLISVLLFGAIATREEL  378

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWPFPA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  379  LTDRLLTATVAWPFPAIIYVGIILSTLGAALQSLTGAPRLLAAIAND  425



>ref|XP_010265903.1| PREDICTED: cation-chloride cotransporter 1-like [Nelumbo nucifera]
Length=915

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA + T+TLYVI+VFFFGS+ATR++L
Sbjct  302  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLLTSTLYVISVFFFGSLATREEL  361

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA+VAWP  AV+YAGIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  362  LTNRLLTATVAWPSSAVIYAGIILSTLGAALQSLTGAPRLLAAIAND  408



>emb|CDX90250.1| BnaA08g17340D [Brassica napus]
Length=941

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA ++TT LYVI+V FFG+VATR KL
Sbjct  332  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLSTTLLYVISVLFFGAVATRDKL  391

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP P +V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  392  LTDRLLTATVAWPLPLIVHVGIILSTLGAALQSLTGAPRLLAAIAND  438



>ref|XP_009109586.1| PREDICTED: cation-chloride cotransporter 1 [Brassica rapa]
Length=974

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA ++TT LYVI+V FFG+VATR KL
Sbjct  365  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLSTTLLYVISVLFFGAVATRDKL  424

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP P +V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  425  LTDRLLTATVAWPLPLIVHVGIILSTLGAALQSLTGAPRLLAAIAND  471



>gb|KDP34959.1| hypothetical protein JCGZ_09247 [Jatropha curcas]
Length=983

 Score =   182 bits (462),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA ++TT LY+I+V FFG++ATR KL
Sbjct  370  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLSTTVLYLISVLFFGALATRDKL  429

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWP PA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  430  LTDRLLTATIAWPAPAIVYIGIILSTLGAALQSLTGAPRLLAAIAND  476



>ref|XP_010686647.1| PREDICTED: cation-chloride cotransporter 1 [Beta vulgaris subsp. 
vulgaris]
Length=927

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQ SIPVGTLA+ +TTT LY+I+V  FG+ ATR+KL
Sbjct  314  LVGLFFPAVTGIMAGSNRSASLKDTQHSIPVGTLASQLTTTGLYLISVLLFGAFATREKL  373

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWPFP ++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  374  LTDRLLTATVAWPFPVIIYVGIILSTLGAALQSLTGAPRLLAAIAND  420



>gb|EYU43239.1| hypothetical protein MIMGU_mgv1a000978mg [Erythranthe guttata]
Length=924

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA + TT LY++TV FFG++ATR KL
Sbjct  313  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLATTILYLVTVLFFGALATRDKL  372

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PA+ Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  373  LTDRLLTATVAWPVPAITYIGIILSTLGAALQSLTGAPRLLAAIAND  419



>ref|XP_007213604.1| hypothetical protein PRUPE_ppa002325mg [Prunus persica]
 gb|EMJ14803.1| hypothetical protein PRUPE_ppa002325mg [Prunus persica]
Length=687

 Score =   177 bits (450),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            +VGLFFPAVTGIMAGSNRS+SL+DTQRSIP+GTLAA ++TT +Y+++V  FG++A+RQKL
Sbjct  74   MVGLFFPAVTGIMAGSNRSASLRDTQRSIPIGTLAATLSTTAMYLVSVLLFGALASRQKL  133

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFP  +Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  134  LTDRLLTATIAWPFPVFIYIGIILSTLGAALQSLTGAPRLLAAIAND  180



>ref|XP_010928376.1| PREDICTED: cation-chloride cotransporter 1-like [Elaeis guineensis]
Length=983

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TT++LY+I+V  FG++ATR++L
Sbjct  370  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTSSLYLISVLLFGALATREEL  429

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA VAWPFP ++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  430  LTNRLLTAEVAWPFPLIIYVGIILSTLGAALQSLTGAPRLLAAIAND  476



>ref|XP_007138527.1| hypothetical protein PHAVU_009G216800g [Phaseolus vulgaris]
 gb|ESW10521.1| hypothetical protein PHAVU_009G216800g [Phaseolus vulgaris]
Length=688

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSL+DTQRSIPVGTLAA +TT+ LY++++  FGSVA+R+KL
Sbjct  74   LVGLFFPAVTGIMAGSNRSSSLRDTQRSIPVGTLAATLTTSCLYLVSLVLFGSVASREKL  133

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFP+++  GIILST+GAALQSLTGAPRLLAAIAND
Sbjct  134  LTDRLLTATIAWPFPSLIKIGIILSTMGAALQSLTGAPRLLAAIAND  180



>ref|XP_009386802.1| PREDICTED: cation-chloride cotransporter 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=901

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TT+ LY+I+V  FGS+ATR++L
Sbjct  288  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTSFLYLISVLLFGSLATREEL  347

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA +AWP PA++Y GI+LSTLGAALQSLTGAPRLLAAIAND
Sbjct  348  LTNRLLTAEIAWPLPAIIYVGIVLSTLGAALQSLTGAPRLLAAIAND  394



>ref|XP_010655723.1| PREDICTED: cation-chloride cotransporter 1 isoform X2 [Vitis 
vinifera]
Length=931

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SL+DTQRSIPVGTLAA ++T+ +Y+ +V  FGS+ATR+KL
Sbjct  318  LVGLFFPAVTGIMAGSNRSASLRDTQRSIPVGTLAATLSTSAMYLFSVLLFGSLATREKL  377

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWP PA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  378  LTDRLLTATIAWPLPAIIYIGIILSTLGAALQSLTGAPRLLAAIAND  424



>ref|XP_011085219.1| PREDICTED: cation-chloride cotransporter 1 [Sesamum indicum]
Length=990

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A + T+ LY++TV FFG++ATR+KL
Sbjct  380  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLATSGLYLVTVLFFGALATREKL  439

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PA+ Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  440  LTDRLLTATVAWPAPAITYVGIILSTLGAALQSLTGAPRLLAAIAND  486



>ref|XP_010463000.1| PREDICTED: cation-chloride cotransporter 1-like [Camelina sativa]
Length=534

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT+LY+I+V FFG+VATR KL
Sbjct  21   LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTSLYLISVLFFGAVATRNKL  80

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  81   LTDRLLTATIAWPFPAIVHVGIILSTLGAALQSLTGAPRLLAAIAND  127



>ref|XP_009386801.1| PREDICTED: cation-chloride cotransporter 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=985

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TT+ LY+I+V  FGS+ATR++L
Sbjct  372  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTSFLYLISVLLFGSLATREEL  431

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA +AWP PA++Y GI+LSTLGAALQSLTGAPRLLAAIAND
Sbjct  432  LTNRLLTAEIAWPLPAIIYVGIVLSTLGAALQSLTGAPRLLAAIAND  478



>ref|XP_010655720.1| PREDICTED: cation-chloride cotransporter 1 isoform X1 [Vitis 
vinifera]
 ref|XP_010655721.1| PREDICTED: cation-chloride cotransporter 1 isoform X1 [Vitis 
vinifera]
 ref|XP_010655722.1| PREDICTED: cation-chloride cotransporter 1 isoform X1 [Vitis 
vinifera]
Length=982

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SL+DTQRSIPVGTLAA ++T+ +Y+ +V  FGS+ATR+KL
Sbjct  369  LVGLFFPAVTGIMAGSNRSASLRDTQRSIPVGTLAATLSTSAMYLFSVLLFGSLATREKL  428

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWP PA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  429  LTDRLLTATIAWPLPAIIYIGIILSTLGAALQSLTGAPRLLAAIAND  475



>emb|CBI30989.3| unnamed protein product [Vitis vinifera]
Length=1072

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SL+DTQRSIPVGTLAA ++T+ +Y+ +V  FGS+ATR+KL
Sbjct  459  LVGLFFPAVTGIMAGSNRSASLRDTQRSIPVGTLAATLSTSAMYLFSVLLFGSLATREKL  518

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWP PA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  519  LTDRLLTATIAWPLPAIIYIGIILSTLGAALQSLTGAPRLLAAIAND  565



>ref|XP_004488270.1| PREDICTED: cation-chloride cotransporter 1-like [Cicer arietinum]
Length=991

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAA + T+++Y+I+V  FG++ATR+KL
Sbjct  379  LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAATLVTSSMYLISVILFGALATREKL  438

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWPFP+++  GIILST+GAALQSLTGAPRLLAAIAND
Sbjct  439  LTDRLLTATVAWPFPSLIKIGIILSTMGAALQSLTGAPRLLAAIAND  485



>ref|XP_008781081.1| PREDICTED: cation-chloride cotransporter 1-like isoform X1 [Phoenix 
dactylifera]
Length=998

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TT+ LY+I+V  FG++ATR++L
Sbjct  385  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTSFLYLISVLLFGALATREEL  444

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA VAWP PA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  445  LTNRLLTAEVAWPVPAIIYVGIILSTLGAALQSLTGAPRLLAAIAND  491



>ref|XP_008781082.1| PREDICTED: cation-chloride cotransporter 1-like isoform X2 [Phoenix 
dactylifera]
Length=986

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TT+ LY+I+V  FG++ATR++L
Sbjct  373  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTSFLYLISVLLFGALATREEL  432

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA VAWP PA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  433  LTNRLLTAEVAWPVPAIIYVGIILSTLGAALQSLTGAPRLLAAIAND  479



>gb|KHF99564.1| Cation-chloride cotransporter 1 [Gossypium arboreum]
Length=1037

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A + TT LY+++VF FG+VA R+KL
Sbjct  426  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLVTTLLYLVSVFLFGAVANREKL  485

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFP ++  GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  486  LTDRLLTATIAWPFPVLIRVGIILSTLGAALQSLTGAPRLLAAIAND  532



>ref|XP_008225560.1| PREDICTED: cation-chloride cotransporter 1 [Prunus mume]
Length=984

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            +VGLFFPAVTGIMAGSNRS+SL+DTQRSIP+GTLAA ++TT +Y+++V  FG++A+RQKL
Sbjct  371  MVGLFFPAVTGIMAGSNRSASLRDTQRSIPIGTLAATLSTTAMYLVSVLLFGALASRQKL  430

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFP  +Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  431  LTDRLLTATIAWPFPVFIYIGIILSTLGAALQSLTGAPRLLAAIAND  477



>ref|XP_007138528.1| hypothetical protein PHAVU_009G216800g [Phaseolus vulgaris]
 gb|ESW10522.1| hypothetical protein PHAVU_009G216800g [Phaseolus vulgaris]
Length=973

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSL+DTQRSIPVGTLAA +TT+ LY++++  FGSVA+R+KL
Sbjct  359  LVGLFFPAVTGIMAGSNRSSSLRDTQRSIPVGTLAATLTTSCLYLVSLVLFGSVASREKL  418

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFP+++  GIILST+GAALQSLTGAPRLLAAIAND
Sbjct  419  LTDRLLTATIAWPFPSLIKIGIILSTMGAALQSLTGAPRLLAAIAND  465



>ref|XP_003565703.1| PREDICTED: cation-chloride cotransporter 1-like [Brachypodium 
distachyon]
Length=923

 Score =   176 bits (447),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL A + TT +Y+++VF FG++ATR++L
Sbjct  308  LLGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLNATLLTTVMYILSVFLFGALATREEL  367

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  368  LTDRLLTATVAWPAPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  414



>ref|XP_008799639.1| PREDICTED: cation-chloride cotransporter 1-like isoform X2 [Phoenix 
dactylifera]
Length=919

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TT++LY+I+V  FG++A R++L
Sbjct  306  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTSSLYLISVLLFGALAAREEL  365

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA VAWPFP ++Y GIILSTLGAALQSLTGAPRLL+AIAND
Sbjct  366  LTNRLLTAEVAWPFPIIIYVGIILSTLGAALQSLTGAPRLLSAIAND  412



>ref|XP_008799625.1| PREDICTED: cation-chloride cotransporter 1-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008799631.1| PREDICTED: cation-chloride cotransporter 1-like isoform X1 [Phoenix 
dactylifera]
Length=985

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TT++LY+I+V  FG++A R++L
Sbjct  372  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTSSLYLISVLLFGALAAREEL  431

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA VAWPFP ++Y GIILSTLGAALQSLTGAPRLL+AIAND
Sbjct  432  LTNRLLTAEVAWPFPIIIYVGIILSTLGAALQSLTGAPRLLSAIAND  478



>ref|XP_009344396.1| PREDICTED: cation-chloride cotransporter 1-like [Pyrus x bretschneideri]
Length=983

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            +VGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA ++TT +Y+++V  FG++ATR+KL
Sbjct  370  MVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLSTTAMYLVSVLLFGALATREKL  429

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A +AWPFP  +Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  430  LTDRLLSARIAWPFPVFIYIGIILSTLGAALQSLTGAPRLLAAIAND  476



>ref|XP_010921512.1| PREDICTED: cation-chloride cotransporter 1-like isoform X2 [Elaeis 
guineensis]
Length=930

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A +TT+ LY+I+V  FG++ATR++L
Sbjct  371  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLTTSFLYLISVLLFGALATREEL  430

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA VAWP PA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  431  LTNRLLTAEVAWPVPAIIYVGIILSTLGAALQSLTGAPRLLAAIAND  477



>ref|XP_010921511.1| PREDICTED: cation-chloride cotransporter 1-like isoform X1 [Elaeis 
guineensis]
Length=984

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A +TT+ LY+I+V  FG++ATR++L
Sbjct  371  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLTTSFLYLISVLLFGALATREEL  430

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA VAWP PA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  431  LTNRLLTAEVAWPVPAIIYVGIILSTLGAALQSLTGAPRLLAAIAND  477



>ref|XP_002450297.1| hypothetical protein SORBIDRAFT_05g003370 [Sorghum bicolor]
 gb|EES09285.1| hypothetical protein SORBIDRAFT_05g003370 [Sorghum bicolor]
Length=901

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A ++TT +Y+++VF FG++ATR++L
Sbjct  320  LLGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLSTTLMYLLSVFLFGALATREEL  379

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL A++AWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  380  LTDRLLAATIAWPGPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  426



>ref|XP_008656210.1| PREDICTED: LOW QUALITY PROTEIN: cation-chloride cotransporter 
1 [Zea mays]
Length=985

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A ++TT +Y+ +V  FG++ATR++L
Sbjct  370  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLSTTAMYLFSVLLFGALATREEL  429

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  430  LTDRLLTATVAWPAPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  476



>dbj|BAD44902.1| putative potassium-chloride cotransporter isoform 4 [Oryza sativa 
Japonica Group]
Length=914

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GL+FPAVTGIMAGSNRS+SLKDTQRSIP+GTL A ++TT +Y+++VF FG+++TR+ L
Sbjct  300  LLGLYFPAVTGIMAGSNRSASLKDTQRSIPIGTLHATISTTMMYLLSVFLFGALSTREGL  359

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL A+VAWP PAVVYAGIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  360  LTDRLLCAAVAWPSPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  406



>gb|EEC70491.1| hypothetical protein OsI_01563 [Oryza sativa Indica Group]
Length=920

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GL+FPAVTGIMAGSNRS+SLKDTQRSIP+GTL A ++TT +Y+++VF FG+++TR+ L
Sbjct  306  LLGLYFPAVTGIMAGSNRSASLKDTQRSIPIGTLHATISTTMMYLLSVFLFGALSTREGL  365

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL A+VAWP PAVVYAGIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  366  LTDRLLCAAVAWPSPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  412



>ref|XP_004967551.1| PREDICTED: cation-chloride cotransporter 2-like [Setaria italica]
Length=984

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTL A ++TT +Y+I+VF FG++ATR++L
Sbjct  370  LLGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLNATLSTTVMYLISVFLFGALATREEL  429

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRL++A++AWP PAV+Y GIILSTLGAALQS+TGAPRLLAAIAND
Sbjct  430  LTDRLISATIAWPGPAVIYIGIILSTLGAALQSMTGAPRLLAAIAND  476



>ref|XP_006369978.1| hypothetical protein POPTR_0001s36780g [Populus trichocarpa]
 gb|ERP66547.1| hypothetical protein POPTR_0001s36780g [Populus trichocarpa]
Length=657

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT LY+++V FFG++ATR KL
Sbjct  45   LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTVLYLVSVLFFGALATRDKL  104

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  105  LTDRLLTATIAWPFPAIIYIGIILSTLGAALQSLTGAPRLLAAIAND  151



>sp|Q657W3.2|CCC2_ORYSJ RecName: Full=Cation-chloride cotransporter 2; Short=OsCCC2; 
AltName: Full=Potassium-chloride cotransporter 2 [Oryza sativa 
Japonica Group]
 tpe|CAJ40614.1| TPA: putative cation chloride cotransporter 2 [Oryza sativa Japonica 
Group]
Length=994

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GL+FPAVTGIMAGSNRS+SLKDTQRSIP+GTL A ++TT +Y+++VF FG+++TR+ L
Sbjct  380  LLGLYFPAVTGIMAGSNRSASLKDTQRSIPIGTLHATISTTMMYLLSVFLFGALSTREGL  439

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL A+VAWP PAVVYAGIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  440  LTDRLLCAAVAWPSPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  486



>gb|ACE78321.1| cation-chloride cotransporter-like protein [Lotus tenuis]
Length=988

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSLKDTQRSIP+GTLAA + TT +Y+++V  FG++ATR+KL
Sbjct  376  LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPLGTLAATLVTTFMYLVSVIMFGALATREKL  435

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWPFP+++  GIILST+GAALQSLTGAPRLLAAIAND
Sbjct  436  LTDRLLTATVAWPFPSLIKIGIILSTMGAALQSLTGAPRLLAAIAND  482



>ref|XP_010480752.1| PREDICTED: cation-chloride cotransporter 1-like [Camelina sativa]
Length=791

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT+LY+I+V FFG+VATR KL
Sbjct  539  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTSLYLISVLFFGAVATRNKL  598

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  599  LTDRLLTATIAWPFPAIVHVGIILSTLGAALQSLTGAPRLLAAIAND  645


 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 62/95 (65%), Gaps = 31/95 (33%)
 Frame = +2

Query  38   MAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKLLTDRLLTASVAW  217
            MAGSNRS+SLKDTQRSIP GTL                               LTA++AW
Sbjct  1    MAGSNRSASLKDTQRSIPAGTL-------------------------------LTATIAW  29

Query  218  PFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            PFPA+V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  30   PFPAIVHVGIILSTLGAALQSLTGAPRLLAAIAND  64



>ref|XP_009410340.1| PREDICTED: cation-chloride cotransporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TT+ LY+I+V  FG++ATR++L
Sbjct  372  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPLGTLAATLTTSFLYLISVLLFGALATREEL  431

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA VAWP PA++Y GI+LSTLGAALQ+LTGAPRLLAAIAND
Sbjct  432  LTNRLLTAEVAWPLPAIIYLGIVLSTLGAALQTLTGAPRLLAAIAND  478



>ref|XP_010478432.1| PREDICTED: cation-chloride cotransporter 1-like [Camelina sativa]
Length=976

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT+LY+I+V FFG+VATR KL
Sbjct  367  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTSLYLISVLFFGAVATRNKL  426

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  427  LTDRLLTATIAWPFPAIVHVGIILSTLGAALQSLTGAPRLLAAIAND  473



>ref|XP_006415472.1| hypothetical protein EUTSA_v10006695mg [Eutrema salsugineum]
 gb|ESQ33825.1| hypothetical protein EUTSA_v10006695mg [Eutrema salsugineum]
Length=976

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT+LY+I+V FFG+VATR KL
Sbjct  367  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTSLYLISVLFFGAVATRDKL  426

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  427  LTDRLLTATIAWPFPAIVHVGIILSTLGAALQSLTGAPRLLAAIAND  473



>ref|XP_010460835.1| PREDICTED: cation-chloride cotransporter 1 [Camelina sativa]
Length=976

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT+LY+I+V FFG+VATR KL
Sbjct  367  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTSLYLISVLFFGAVATRNKL  426

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  427  LTDRLLTATIAWPFPAIVHVGIILSTLGAALQSLTGAPRLLAAIAND  473



>emb|CDX77592.1| BnaA07g07300D [Brassica napus]
Length=972

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/107 (88%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAA +TTT+LYVI+V FFG+VATR KL
Sbjct  363  LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAATLTTTSLYVISVLFFGAVATRDKL  422

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP+P +V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  423  LTDRLLTATVAWPWPVIVHVGIILSTLGAALQSLTGAPRLLAAIAND  469



>ref|XP_003568633.1| PREDICTED: cation-chloride cotransporter 1 [Brachypodium distachyon]
Length=1001

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A + TT +Y+ +V  FG+++TR++L
Sbjct  385  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLATTAMYLFSVLLFGALSTREEL  444

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  445  LTDRLLTATVAWPSPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  491



>gb|EMS63243.1| Solute carrier family 12 member 6 [Triticum urartu]
Length=963

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A +TTT +Y+++V  FG+++TR++L
Sbjct  347  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLTTTVMYLLSVLLFGALSTREEL  406

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP P V+Y GIILSTLGAALQ LTGAPRLLAAIAND
Sbjct  407  LTDRLLTATVAWPAPVVIYIGIILSTLGAALQCLTGAPRLLAAIAND  453



>ref|XP_010519078.1| PREDICTED: LOW QUALITY PROTEIN: cation-chloride cotransporter 
1 [Tarenaya hassleriana]
Length=970

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT+LY+I+VFFFG+V TR KL
Sbjct  371  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTSLYLISVFFFGAVVTRDKL  430

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+V  GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  431  LTDRLLTATIAWPFPAIVQIGIILSTLGAALQSLTGAPRLLAAIAND  477



>ref|NP_174333.2| cation-chloride co-transporter 1 [Arabidopsis thaliana]
 ref|NP_849731.1| cation-chloride co-transporter 1 [Arabidopsis thaliana]
 ref|NP_849732.1| cation-chloride co-transporter 1 [Arabidopsis thaliana]
 sp|Q2UVJ5.1|CCC1_ARATH RecName: Full=Cation-chloride cotransporter 1; Short=AtCCC1; 
AltName: Full=Protein HAPLESS 5 [Arabidopsis thaliana]
 emb|CAJ34849.1| cation chloride cotransporter [Arabidopsis thaliana]
 dbj|BAE98715.1| putative cation-chloride co-transporter [Arabidopsis thaliana]
 gb|AEE31217.1| cation-chloride co-transporter 1 [Arabidopsis thaliana]
 gb|AEE31218.1| cation-chloride co-transporter 1 [Arabidopsis thaliana]
 gb|AEE31219.1| cation-chloride co-transporter 1 [Arabidopsis thaliana]
Length=975

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQ+SIPVGTLAA +TTT+LY+I+V FFG+VATR KL
Sbjct  366  LVGLFFPAVTGIMAGSNRSASLKDTQKSIPVGTLAATLTTTSLYLISVLFFGAVATRDKL  425

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  426  LTDRLLTATIAWPFPAIVHVGIILSTLGAALQSLTGAPRLLAAIAND  472



>gb|AAF19744.1|AC009917_3 Strong similarity to gb|AF021220 Nicotiana tabacum cation-chloride 
co-transporter and contains an amino acid permease PF|00324 
domain [Arabidopsis thaliana]
Length=973

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQ+SIPVGTLAA +TTT+LY+I+V FFG+VATR KL
Sbjct  364  LVGLFFPAVTGIMAGSNRSASLKDTQKSIPVGTLAATLTTTSLYLISVLFFGAVATRDKL  423

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  424  LTDRLLTATIAWPFPAIVHVGIILSTLGAALQSLTGAPRLLAAIAND  470



>ref|XP_002890871.1| hypothetical protein ARALYDRAFT_473269 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67130.1| hypothetical protein ARALYDRAFT_473269 [Arabidopsis lyrata subsp. 
lyrata]
Length=976

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQ+SIPVGTLAA +TTT+LY+I+V FFG+VATR KL
Sbjct  367  LVGLFFPAVTGIMAGSNRSASLKDTQKSIPVGTLAATLTTTSLYLISVLFFGAVATRDKL  426

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  427  LTDRLLTATIAWPFPAIVHVGIILSTLGAALQSLTGAPRLLAAIAND  473



>ref|XP_004169776.1| PREDICTED: LOW QUALITY PROTEIN: cation-chloride cotransporter 
1-like, partial [Cucumis sativus]
Length=565

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT +Y+++V  FG++ATR+KL
Sbjct  369  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTVMYLVSVLLFGALATRKKL  428

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWPFPA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  429  LTDRLLTATVAWPFPAIIYVGIILSTLGAALQSLTGAPRLLAAIAND  475



>emb|CDX98204.1| BnaC07g08940D [Brassica napus]
Length=972

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT+LYVI+V FFG+VATR KL
Sbjct  363  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTSLYVISVLFFGAVATRDKL  422

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP+P +V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  423  LTDRLLTATVAWPWPVIVHVGIILSTLGAALQSLTGAPRLLAAIAND  469



>gb|KEH37821.1| cation-chloride cotransporter [Medicago truncatula]
Length=878

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSL+DTQRSIPVGTL+A ++T+ +Y+I+V  FG+VATR KL
Sbjct  266  LVGLFFPAVTGIMAGSNRSSSLRDTQRSIPVGTLSATLSTSFMYLISVILFGAVATRDKL  325

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWP P+++  GIILST+GAALQSLTGAPRLLAAIAND
Sbjct  326  LTDRLLTATIAWPLPSLIKIGIILSTMGAALQSLTGAPRLLAAIAND  372



>ref|XP_011046736.1| PREDICTED: cation-chloride cotransporter 1-like [Populus euphratica]
Length=985

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT LY+++V FFG++ATR+KL
Sbjct  372  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTVLYLVSVLFFGALATREKL  431

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA++Y GIILSTLGAALQS+TGAPRLLAAIAND
Sbjct  432  LTDRLLTATIAWPFPAIIYIGIILSTLGAALQSMTGAPRLLAAIAND  478



>ref|XP_006352987.1| PREDICTED: cation-chloride cotransporter 1-like isoform X3 [Solanum 
tuberosum]
Length=840

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQR+IPVGTLAA +TTT+LY+++V  FG+VATR KL
Sbjct  231  LVGLFFPAVTGIMAGSNRSASLKDTQRAIPVGTLAATLTTTSLYLVSVLLFGAVATRDKL  290

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  291  LTDRLLSATVAWPFPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  337



>ref|XP_006645801.1| PREDICTED: cation-chloride cotransporter 2-like [Oryza brachyantha]
Length=1059

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GL+FPAVTGIMAGSNRS+SLKDTQ SIPVGTL A ++TT +YV++VF FG+++TR+ L
Sbjct  445  LLGLYFPAVTGIMAGSNRSASLKDTQYSIPVGTLHATISTTVMYVLSVFLFGALSTREGL  504

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL A+VAWP P V+YAGIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  505  LTDRLLCATVAWPSPIVIYAGIILSTLGAALQSLTGAPRLLAAIAND  551



>ref|XP_010316942.1| PREDICTED: cation-chloride cotransporter 1 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010316943.1| PREDICTED: cation-chloride cotransporter 1 isoform X3 [Solanum 
lycopersicum]
Length=840

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQR+IPVGTLAA +TTT+LY+++V  FG+VATR KL
Sbjct  231  LVGLFFPAVTGIMAGSNRSASLKDTQRAIPVGTLAATLTTTSLYLVSVLLFGAVATRDKL  290

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  291  LTDRLLSATVAWPFPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  337



>ref|XP_006352986.1| PREDICTED: cation-chloride cotransporter 1-like isoform X2 [Solanum 
tuberosum]
Length=875

 Score =   171 bits (433),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQR+IPVGTLAA +TTT+LY+++V  FG+VATR KL
Sbjct  266  LVGLFFPAVTGIMAGSNRSASLKDTQRAIPVGTLAATLTTTSLYLVSVLLFGAVATRDKL  325

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  326  LTDRLLSATVAWPFPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  372



>ref|XP_003595505.1| Solute carrier family 12 member [Medicago truncatula]
 tpe|CAJ38499.1| TPA: cation chloride cotransporter [Medicago truncatula f. tricycla]
 gb|AES65756.1| cation-chloride cotransporter [Medicago truncatula]
Length=990

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSL+DTQRSIPVGTL+A ++T+ +Y+I+V  FG+VATR KL
Sbjct  378  LVGLFFPAVTGIMAGSNRSSSLRDTQRSIPVGTLSATLSTSFMYLISVILFGAVATRDKL  437

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWP P+++  GIILST+GAALQSLTGAPRLLAAIAND
Sbjct  438  LTDRLLTATIAWPLPSLIKIGIILSTMGAALQSLTGAPRLLAAIAND  484



>ref|XP_008680718.1| PREDICTED: cation-chloride cotransporter 2-like [Zea mays]
Length=763

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGSNRS+SL+DTQ SIPVGTL+A ++TT +Y+++VF FG++ATR++L
Sbjct  149  LLGLFFPAVTGIMAGSNRSASLRDTQSSIPVGTLSATLSTTVMYLLSVFIFGALATREEL  208

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL A++AWP PA++Y GIILSTLGAALQS+TGAPRLLAAIAND
Sbjct  209  LTDRLLAAAIAWPGPAMIYIGIILSTLGAALQSMTGAPRLLAAIAND  255



>ref|XP_010316941.1| PREDICTED: cation-chloride cotransporter 1 isoform X2 [Solanum 
lycopersicum]
Length=875

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQR+IPVGTLAA +TTT+LY+++V  FG+VATR KL
Sbjct  266  LVGLFFPAVTGIMAGSNRSASLKDTQRAIPVGTLAATLTTTSLYLVSVLLFGAVATRDKL  325

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  326  LTDRLLSATVAWPFPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  372



>ref|XP_009102698.1| PREDICTED: cation-chloride cotransporter 1-like [Brassica rapa]
Length=972

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAA +TTT+LYVI+V FFG+VATR KL
Sbjct  363  LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAATLTTTSLYVISVLFFGAVATRDKL  422

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL A+VAWP+P +V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  423  LTDRLLPATVAWPWPVIVHVGIILSTLGAALQSLTGAPRLLAAIAND  469



>gb|AFW64849.1| hypothetical protein ZEAMMB73_634073 [Zea mays]
Length=776

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGSNRS+SL+DTQ SIPVGTL+A ++TT +Y+++VF FG++ATR++L
Sbjct  162  LLGLFFPAVTGIMAGSNRSASLRDTQSSIPVGTLSATLSTTVMYLLSVFIFGALATREEL  221

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL A++AWP PA++Y GIILSTLGAALQS+TGAPRLLAAIAND
Sbjct  222  LTDRLLAAAIAWPGPAMIYIGIILSTLGAALQSMTGAPRLLAAIAND  268



>ref|XP_004233139.1| PREDICTED: cation-chloride cotransporter 1 isoform X1 [Solanum 
lycopersicum]
Length=979

 Score =   171 bits (434),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQR+IPVGTLAA +TTT+LY+++V  FG+VATR KL
Sbjct  370  LVGLFFPAVTGIMAGSNRSASLKDTQRAIPVGTLAATLTTTSLYLVSVLLFGAVATRDKL  429

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  430  LTDRLLSATVAWPFPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  476



>ref|XP_006352985.1| PREDICTED: cation-chloride cotransporter 1-like isoform X1 [Solanum 
tuberosum]
Length=979

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQR+IPVGTLAA +TTT+LY+++V  FG+VATR KL
Sbjct  370  LVGLFFPAVTGIMAGSNRSASLKDTQRAIPVGTLAATLTTTSLYLVSVLLFGAVATRDKL  429

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  430  LTDRLLSATVAWPFPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  476



>gb|KDO75321.1| hypothetical protein CISIN_1g002018mg [Citrus sinensis]
Length=680

 Score =   168 bits (426),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT LYVI+V  FG+ ATR++L
Sbjct  67   LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTALYVISVLLFGAAATREEL  126

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPAV++ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  127  LTDRLLTATIAWPFPAVIHIGIILSTLGAALQSLTGAPRLLAAIAND  173



>ref|XP_002526613.1| cation:chloride symporter, putative [Ricinus communis]
 gb|EEF35772.1| cation:chloride symporter, putative [Ricinus communis]
Length=976

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT +Y+++V  FG++ATR KL
Sbjct  364  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTAMYLVSVLLFGALATRNKL  423

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWPFPA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  424  LTDRLLTATVAWPFPAIVYIGIILSTLGAALQSLTGAPRLLAAIAND  470



>gb|KGN65931.1| hypothetical protein Csa_1G538780 [Cucumis sativus]
Length=981

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT +Y+++V  FG++ATR+KL
Sbjct  369  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTVMYLVSVLLFGALATRKKL  428

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWPFPA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  429  LTDRLLTATVAWPFPAIIYVGIILSTLGAALQSLTGAPRLLAAIAND  475



>ref|XP_008445142.1| PREDICTED: cation-chloride cotransporter 1 isoform X2 [Cucumis 
melo]
Length=842

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT LY+++V  FG++ATR+KL
Sbjct  230  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTALYLVSVLLFGALATREKL  289

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWPFPA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  290  LTDRLLTATVAWPFPAIIYVGIILSTLGAALQSLTGAPRLLAAIAND  336



>ref|XP_006306671.1| hypothetical protein CARUB_v10008188mg, partial [Capsella rubella]
 gb|EOA39569.1| hypothetical protein CARUB_v10008188mg, partial [Capsella rubella]
Length=1013

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 92/107 (86%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LY+I+V FFG+VATR KL
Sbjct  404  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTALYLISVLFFGAVATRNKL  463

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFP +V+ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  464  LTDRLLTATIAWPFPTIVHVGIILSTLGAALQSLTGAPRLLAAIAND  510



>ref|XP_008445134.1| PREDICTED: cation-chloride cotransporter 1 isoform X1 [Cucumis 
melo]
Length=981

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT LY+++V  FG++ATR+KL
Sbjct  369  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTALYLVSVLLFGALATREKL  428

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWPFPA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  429  LTDRLLTATVAWPFPAIIYVGIILSTLGAALQSLTGAPRLLAAIAND  475



>ref|XP_007041133.1| Cation-chloride co-transporter 1 [Theobroma cacao]
 gb|EOX96964.1| Cation-chloride co-transporter 1 [Theobroma cacao]
Length=979

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT LY+++V  FG+VATR KL
Sbjct  366  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTALYIVSVLLFGAVATRDKL  425

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+++ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  426  LTDRLLTATIAWPFPAIIHIGIILSTLGAALQSLTGAPRLLAAIAND  472



>ref|XP_002975190.1| hypothetical protein SELMODRAFT_150343 [Selaginella moellendorffii]
 gb|EFJ23975.1| hypothetical protein SELMODRAFT_150343 [Selaginella moellendorffii]
Length=880

 Score =   167 bits (424),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGSNRS+SL+DTQRSIPVGTL A  +TT LY+I+   FGSVA R++L
Sbjct  269  LLGLFFPAVTGIMAGSNRSASLRDTQRSIPVGTLLAIASTTCLYLISAIMFGSVANREEL  328

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA++AWP PAVV  GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  329  LTNRLLTATLAWPVPAVVQVGIILSTLGAALQSLTGAPRLLAAIAND  375



>ref|XP_002977594.1| hypothetical protein SELMODRAFT_151983 [Selaginella moellendorffii]
 gb|EFJ21598.1| hypothetical protein SELMODRAFT_151983 [Selaginella moellendorffii]
Length=880

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGSNRS+SL+DTQRSIPVGTL A  +TT LY+I+   FGSVA R++L
Sbjct  269  LLGLFFPAVTGIMAGSNRSASLRDTQRSIPVGTLLAIASTTCLYLISAIMFGSVANREEL  328

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA++AWP PAVV  GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  329  LTNRLLTATLAWPVPAVVQVGIILSTLGAALQSLTGAPRLLAAIAND  375



>gb|KDO75319.1| hypothetical protein CISIN_1g002018mg [Citrus sinensis]
Length=926

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT LYVI+V  FG+ ATR++L
Sbjct  367  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTALYVISVLLFGAAATREEL  426

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPAV++ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  427  LTDRLLTATIAWPFPAVIHIGIILSTLGAALQSLTGAPRLLAAIAND  473



>ref|XP_006448939.1| hypothetical protein CICLE_v10014154mg [Citrus clementina]
 gb|ESR62179.1| hypothetical protein CICLE_v10014154mg [Citrus clementina]
Length=980

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT LYVI+V  FG+ ATR++L
Sbjct  367  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTALYVISVLLFGAAATREEL  426

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPAV++ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  427  LTDRLLTATIAWPFPAVIHIGIILSTLGAALQSLTGAPRLLAAIAND  473



>ref|XP_006468281.1| PREDICTED: cation-chloride cotransporter 1-like [Citrus sinensis]
 emb|CBJ19439.1| cation chloride cotransporter [Citrus clementina]
Length=980

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT LYVI+V  FG+ ATR++L
Sbjct  367  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTALYVISVLLFGAAATREEL  426

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPAV++ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  427  LTDRLLTATIAWPFPAVIHIGIILSTLGAALQSLTGAPRLLAAIAND  473



>gb|KDO75320.1| hypothetical protein CISIN_1g002018mg [Citrus sinensis]
Length=980

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT LYVI+V  FG+ ATR++L
Sbjct  367  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTALYVISVLLFGAAATREEL  426

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPAV++ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  427  LTDRLLTATIAWPFPAVIHIGIILSTLGAALQSLTGAPRLLAAIAND  473



>gb|AFW77716.1| hypothetical protein ZEAMMB73_362284 [Zea mays]
Length=822

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL A +TTT +Y+ +V  FG++ATR++L
Sbjct  206  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLYATLTTTAMYLFSVLLFGALATREEL  265

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  266  LTDRLLTATVAWPAPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  312



>gb|ADF30875.1| cation-chloride cotransporter [Citrus trifoliata]
Length=980

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LYVI+   FG+ ATR++L
Sbjct  367  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTALYVISALLFGAAATREEL  426

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPAV++ GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  427  LTDRLLTATIAWPFPAVIHIGIILSTLGAALQSLTGAPRLLAAIAND  473



>ref|XP_008650609.1| PREDICTED: cation-chloride cotransporter 1-like [Zea mays]
Length=845

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL A +TTT +Y+ +V  FG++ATR++L
Sbjct  229  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLYATLTTTAMYLFSVLLFGALATREEL  288

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  289  LTDRLLTATVAWPAPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  335



>gb|KHN06604.1| Cation-chloride cotransporter 1, partial [Glycine soja]
Length=731

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSL+DTQ+SIPVGTLAA +TTT+LY++++  FG+VATR+KL
Sbjct  117  LVGLFFPAVTGIMAGSNRSSSLRDTQQSIPVGTLAATLTTTSLYLVSLMLFGAVATREKL  176

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFP+++  GIILST+GAALQSLTGAPRLLAAIAND
Sbjct  177  LTDRLLTATIAWPFPSLIKIGIILSTMGAALQSLTGAPRLLAAIAND  223



>ref|XP_004962386.1| PREDICTED: cation-chloride cotransporter 1-like isoform X2 [Setaria 
italica]
Length=850

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A +TTT +Y+ +V  FG++ATR++L
Sbjct  234  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLTTTAMYLFSVLLFGALATREEL  293

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  294  LTDRLLTATVAWPAPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  340



>gb|EMT12359.1| Solute carrier family 12 member 7 [Aegilops tauschii]
Length=1108

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGS R +SLKDTQ SIP+GTL A + TT +Y+++VF FG++ATRQ+L
Sbjct  495  LLGLFFPAVTGIMAGSKRPASLKDTQSSIPIGTLYATLLTTMMYLLSVFLFGALATRQEL  554

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV++ GIILSTLGAALQSLTGAPRLL AIAND
Sbjct  555  LTDRLLTATVAWPAPAVIHIGIILSTLGAALQSLTGAPRLLVAIAND  601



>ref|XP_001752655.1| predicted protein [Physcomitrella patens]
 gb|EDQ82526.1| predicted protein [Physcomitrella patens]
Length=936

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGSNRS+SLKDTQRSIP GTL+A   TT LY+I+V  FG+VATR  L
Sbjct  319  LLGLFFPAVTGIMAGSNRSASLKDTQRSIPKGTLSAIGVTTALYLISVLMFGAVATRDVL  378

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWP P +V  G+ILSTLGAALQSLTGAPRLLAAIAND
Sbjct  379  LTDRLLTATIAWPVPWIVQVGVILSTLGAALQSLTGAPRLLAAIAND  425



>ref|XP_009362253.1| PREDICTED: cation-chloride cotransporter 1-like [Pyrus x bretschneideri]
Length=983

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            +VGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT +Y+++V  FG++ATR+KL
Sbjct  370  MVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTAMYLVSVLLFGALATREKL  429

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A++AWPFP  +Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  430  LTDRLLSATIAWPFPVFIYIGIILSTLGAALQSLTGAPRLLAAIAND  476



>gb|EMT23953.1| Solute carrier family 12 member 6 [Aegilops tauschii]
Length=659

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL A +TTT +Y+ +V  FG+++TR++L
Sbjct  43   LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLCATLTTTAMYLFSVLLFGALSTREEL  102

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP P V+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  103  LTDRLLTATVAWPAPVVIYIGIILSTLGAALQSLTGAPRLLAAIAND  149



>ref|XP_008372221.1| PREDICTED: cation-chloride cotransporter 1-like [Malus domestica]
Length=986

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            +VGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT +Y+++V  FG++ATR+KL
Sbjct  373  MVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTAMYLVSVLLFGALATREKL  432

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A++AWPFP  +Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  433  LTDRLLSATIAWPFPVFIYIGIILSTLGAALQSLTGAPRLLAAIAND  479



>gb|EEE54414.1| hypothetical protein OsJ_01456 [Oryza sativa Japonica Group]
Length=885

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 97/111 (87%), Gaps = 7/111 (6%)
 Frame = +2

Query  11   LFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKLLTD  190
            L+FPAVTGIMAGSNRS+SLKDTQRSIP+GTL A ++TT +Y+++VF FG+++TR+ LLTD
Sbjct  267  LYFPAVTGIMAGSNRSASLKDTQRSIPIGTLHATISTTMMYLLSVFLFGALSTREGLLTD  326

Query  191  R-------LLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R       LL A+VAWP PAVVYAGIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  327  RTTFSCLQLLCAAVAWPSPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  377



>ref|XP_008383418.1| PREDICTED: cation-chloride cotransporter 1-like [Malus domestica]
 ref|XP_008383419.1| PREDICTED: cation-chloride cotransporter 1-like [Malus domestica]
Length=983

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            +VGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA + TT +Y+++V  FG++ATR+KL
Sbjct  370  MVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLXTTAMYLVSVLLFGALATREKL  429

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A +AWPFP  +Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  430  LTDRLLSARIAWPFPVFIYIGIILSTLGAALQSLTGAPRLLAAIAND  476



>ref|XP_002440935.1| hypothetical protein SORBIDRAFT_09g017170 [Sorghum bicolor]
 gb|EES19365.1| hypothetical protein SORBIDRAFT_09g017170 [Sorghum bicolor]
Length=998

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A +TTT +Y+ +V  FG++ATR++L
Sbjct  382  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLTTTAMYLFSVLLFGALATREEL  441

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  442  LTDRLLTATVAWPAPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  488



>ref|XP_001771559.1| predicted protein [Physcomitrella patens]
 gb|EDQ63589.1| predicted protein [Physcomitrella patens]
Length=886

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGSNRS SLKDTQRSIP GTL+A   TTTLY+++V  FG+VA+R +L
Sbjct  269  LLGLFFPAVTGIMAGSNRSGSLKDTQRSIPRGTLSAIAATTTLYLVSVVMFGAVASRNEL  328

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWP P VV   I+LSTLGAALQSLTGAPRLLAAIAND
Sbjct  329  LTDRLLTATIAWPVPWVVQVAIVLSTLGAALQSLTGAPRLLAAIAND  375



>sp|Q6Z0E2.1|CCC1_ORYSJ RecName: Full=Cation-chloride cotransporter 1; Short=OsCCC1; 
AltName: Full=Potassium-chloride cotransporter 1 [Oryza sativa 
Japonica Group]
 dbj|BAD03666.1| putative Na+/K+/Cl-cotransport protein [Oryza sativa Japonica 
Group]
 gb|EAZ42309.1| hypothetical protein OsJ_26882 [Oryza sativa Japonica Group]
 gb|ADB03187.1| potassium-chloride cotransporter [Oryza sativa Japonica Group]
Length=989

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A +TTT +Y+ +V  FG++ATR++L
Sbjct  373  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLTTTAMYLFSVLLFGALATREEL  432

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  433  LTDRLLTATVAWPAPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  479



>gb|AAC49874.1| cation-chloride co-transporter [Nicotiana tabacum]
Length=990

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/107 (85%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LYV++V  FG+V+TR KL
Sbjct  381  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTGLYVVSVLLFGAVSTRDKL  440

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWP PA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  441  LTDRLLSATVAWPLPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  487



>gb|EAZ06533.1| hypothetical protein OsI_28779 [Oryza sativa Indica Group]
Length=989

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A +TTT +Y+ +V  FG++ATR++L
Sbjct  373  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLTTTAMYLFSVLLFGALATREEL  432

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  433  LTDRLLTATVAWPAPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  479



>ref|XP_004962385.1| PREDICTED: cation-chloride cotransporter 1-like isoform X1 [Setaria 
italica]
Length=999

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A +TTT +Y+ +V  FG++ATR++L
Sbjct  383  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLTTTAMYLFSVLLFGALATREEL  442

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  443  LTDRLLTATVAWPAPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  489



>gb|KHN41441.1| Cation-chloride cotransporter 1 [Glycine soja]
Length=995

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSL+DTQRSIPVGTLAA +TTT LY++++  FG+VATR+KL
Sbjct  380  LVGLFFPAVTGIMAGSNRSSSLRDTQRSIPVGTLAATLTTTFLYLVSLMLFGAVATREKL  439

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFP+++  GIILST+GAALQSLTGAPRLLAAIAND
Sbjct  440  LTDRLLTATIAWPFPSLIKIGIILSTMGAALQSLTGAPRLLAAIAND  486



>ref|XP_001754624.1| predicted protein [Physcomitrella patens]
 gb|EDQ80594.1| predicted protein [Physcomitrella patens]
Length=963

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 1/108 (1%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGSNRS+SLKDTQ+SIPVGTL+A  TTT LY+++VF FG+VATR++L
Sbjct  352  LLGLFFPAVTGIMAGSNRSASLKDTQKSIPVGTLSAIGTTTALYLVSVFMFGAVATREQL  411

Query  182  LTD-RLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTD RLLTA+VAWP   VV  G+ILSTLGAALQSLTGAPRLLAAIAND
Sbjct  412  LTDSRLLTATVAWPVAWVVQVGVILSTLGAALQSLTGAPRLLAAIAND  459



>ref|XP_003533835.1| PREDICTED: cation-chloride cotransporter 1-like [Glycine max]
Length=994

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSL+DTQRSIPVGTLAA +TTT LY++++  FG+VATR+KL
Sbjct  379  LVGLFFPAVTGIMAGSNRSSSLRDTQRSIPVGTLAATLTTTFLYLVSLMLFGAVATREKL  438

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFP+++  GIILST+GAALQSLTGAPRLLAAIAND
Sbjct  439  LTDRLLTATIAWPFPSLIKIGIILSTMGAALQSLTGAPRLLAAIAND  485



>ref|XP_009766115.1| PREDICTED: cation-chloride cotransporter 1-like isoform X4 [Nicotiana 
sylvestris]
Length=860

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LY+++V  FG+V+TR KL
Sbjct  231  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTGLYLVSVLLFGAVSTRDKL  290

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWP PA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  291  LTDRLLSATVAWPLPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  337



>gb|AFW81651.1| hypothetical protein ZEAMMB73_928402 [Zea mays]
Length=199

 Score =   153 bits (387),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +2

Query  38   MAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKLLTDRLLTASVAW  217
            MAGSNRS+SLKDTQRSIP+GTL+A ++TT +Y+ +V  FG++ATR++LLTDRLLTA+VAW
Sbjct  1    MAGSNRSASLKDTQRSIPIGTLSATLSTTAMYLFSVLLFGALATREELLTDRLLTATVAW  60

Query  218  PFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            P PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  61   PAPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  95



>ref|XP_003546564.1| PREDICTED: cation-chloride cotransporter 1-like [Glycine max]
Length=992

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRSSSL+DTQ+SIPVGTLAA +TTT+LY++++  FG+VATR+KL
Sbjct  378  LVGLFFPAVTGIMAGSNRSSSLRDTQQSIPVGTLAATLTTTSLYLVSLMLFGAVATREKL  437

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFP+++  GIILST+GAALQSLTGAPRLLAAIAND
Sbjct  438  LTDRLLTATIAWPFPSLIKIGIILSTMGAALQSLTGAPRLLAAIAND  484



>ref|XP_009591378.1| PREDICTED: cation-chloride cotransporter 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=873

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LY+++V  FG+V+TR KL
Sbjct  244  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTGLYLVSVLLFGAVSTRDKL  303

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWP PA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  304  LTDRLLSATVAWPLPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  350



>ref|XP_009591380.1| PREDICTED: cation-chloride cotransporter 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=853

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LY+++V  FG+V+TR KL
Sbjct  244  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTGLYLVSVLLFGAVSTRDKL  303

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWP PA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  304  LTDRLLSATVAWPLPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  350



>ref|XP_009766112.1| PREDICTED: cation-chloride cotransporter 1-like isoform X2 [Nicotiana 
sylvestris]
Length=990

 Score =   164 bits (414),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LY+++V  FG+V+TR KL
Sbjct  381  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTGLYLVSVLLFGAVSTRDKL  440

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWP PA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  441  LTDRLLSATVAWPLPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  487



>gb|KHG11109.1| Cation-chloride cotransporter 1 [Gossypium arboreum]
Length=905

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT LY+++V  FG+VATR KL
Sbjct  292  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTGLYLVSVLLFGAVATRDKL  351

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWPFPA+++ GIILSTLGAALQSLTGAPRLLAAI+ND
Sbjct  352  LTDRLLTATIAWPFPAIIHIGIILSTLGAALQSLTGAPRLLAAISND  398



>ref|XP_009766113.1| PREDICTED: cation-chloride cotransporter 1-like isoform X3 [Nicotiana 
sylvestris]
Length=895

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LY+++V  FG+V+TR KL
Sbjct  266  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTGLYLVSVLLFGAVSTRDKL  325

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWP PA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  326  LTDRLLSATVAWPLPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  372



>ref|XP_009766111.1| PREDICTED: cation-chloride cotransporter 1-like isoform X1 [Nicotiana 
sylvestris]
Length=1010

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LY+++V  FG+V+TR KL
Sbjct  381  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTGLYLVSVLLFGAVSTRDKL  440

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+VAWP PA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  441  LTDRLLSATVAWPLPAIVYVGIILSTLGAALQSLTGAPRLLAAIAND  487



>emb|CDP19733.1| unnamed protein product [Coffea canephora]
Length=1004

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 103/112 (92%), Gaps = 5/112 (4%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LY+I+V FFG++ATR+KL
Sbjct  389  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTGLYLISVLFFGALATREKL  448

Query  182  LTDR-----LLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDR     LLTA++AWPFPA++Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  449  LTDRQVYVLLLTATIAWPFPAIIYIGIILSTLGAALQSLTGAPRLLAAIAND  500



>ref|XP_003557250.1| PREDICTED: cation-chloride cotransporter 1-like [Brachypodium 
distachyon]
 ref|XP_010228116.1| PREDICTED: cation-chloride cotransporter 1-like [Brachypodium 
distachyon]
 ref|XP_010228117.1| PREDICTED: cation-chloride cotransporter 1-like [Brachypodium 
distachyon]
Length=993

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A +TTT +Y+ +V  FG+++TR++L
Sbjct  377  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLTTTAMYLFSVLLFGALSTREEL  436

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  437  LTDRLLTATVAWPSPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  483



>ref|XP_011012482.1| PREDICTED: cation-chloride cotransporter 1-like [Populus euphratica]
 ref|XP_011012483.1| PREDICTED: cation-chloride cotransporter 1-like [Populus euphratica]
Length=968

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA + TT LY+++V FFG++A+R  L
Sbjct  355  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLATTALYLVSVLFFGALASRDTL  414

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWPFPA++Y GIILSTLGAALQS+TGAPRLLAAIAND
Sbjct  415  LTDRLLTATVAWPFPAIIYVGIILSTLGAALQSMTGAPRLLAAIAND  461



>ref|XP_010051971.1| PREDICTED: cation-chloride cotransporter 1 [Eucalyptus grandis]
 ref|XP_010051972.1| PREDICTED: cation-chloride cotransporter 1 [Eucalyptus grandis]
 gb|KCW75808.1| hypothetical protein EUGRSUZ_D00196 [Eucalyptus grandis]
Length=992

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LY+I+V  FG++ATR  L
Sbjct  379  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTALYLISVLTFGALATRDTL  438

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWP PA+VY GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  439  LTDRLLTATIAWPLPAIVYIGIILSTLGAALQSLTGAPRLLAAIAND  485



>gb|EMS47393.1| Solute carrier family 12 member 6 [Triticum urartu]
Length=943

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTL+A +TTT +Y+ +V  FG+++TR++L
Sbjct  327  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLSATLTTTAMYLFSVLLFGALSTREEL  386

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP P V+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  387  LTDRLLTATVAWPAPVVIYIGIILSTLGAALQSLTGAPRLLAAIAND  433



>ref|XP_004293999.1| PREDICTED: cation-chloride cotransporter 1-like [Fragaria vesca 
subsp. vesca]
Length=981

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            +VGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT +Y+I+V  FG++ATR  L
Sbjct  368  MVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTFMYLISVLLFGAIATRHLL  427

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLL+A+++WP+PA +Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  428  LTDRLLSATISWPYPAFIYVGIILSTLGAALQSLTGAPRLLAAIAND  474



>ref|XP_006661616.1| PREDICTED: cation-chloride cotransporter 1-like [Oryza brachyantha]
Length=991

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIP+GTLAA +TTT +Y+ +V  F ++ATR++L
Sbjct  375  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTAMYLFSVLLFAALATREEL  434

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA+VAWP PAV+Y GIILSTLGAALQSLTGAPRLLAAIAND
Sbjct  435  LTDRLLTATVAWPAPAVIYIGIILSTLGAALQSLTGAPRLLAAIAND  481



>ref|XP_001756366.1| predicted protein [Physcomitrella patens]
 gb|EDQ78762.1| predicted protein [Physcomitrella patens]
Length=895

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+GLFFPAVTGIMAGSNRS SLKDTQRSIP GTL+A   T T+Y++++  FG+VATR +L
Sbjct  278  LLGLFFPAVTGIMAGSNRSGSLKDTQRSIPRGTLSAIAATATIYLVSIIMFGAVATRNEL  337

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LTDRLLTA++AWP P VV   I+LSTLGAALQSLTGAPRLLAAIAND
Sbjct  338  LTDRLLTATIAWPVPWVVQIAIVLSTLGAALQSLTGAPRLLAAIAND  384



>ref|XP_006836309.1| hypothetical protein AMTR_s00092p00043650 [Amborella trichopoda]
 gb|ERM99162.1| hypothetical protein AMTR_s00092p00043650 [Amborella trichopoda]
Length=977

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            LVGLFFPAVTGIMAGSNRS+SLKDTQRSIPVGTLAA +TTT LY+++V  FG++A R +L
Sbjct  373  LVGLFFPAVTGIMAGSNRSASLKDTQRSIPVGTLAATLTTTALYLVSVLLFGALAKRTEL  432

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            LT+RLLTA+VAWP PA++Y GIILSTLGAALQS+TGAPRLLAAIAND
Sbjct  433  LTNRLLTATVAWPVPAIIYVGIILSTLGAALQSMTGAPRLLAAIAND  479



>ref|XP_006377639.1| hypothetical protein POPTR_0011s09300g [Populus trichocarpa]
 gb|ERP55436.1| hypothetical protein POPTR_0011s09300g [Populus trichocarpa]
Length=602

 Score =   140 bits (353),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 75/95 (79%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  38   MAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKLLTDRLLTASVAW  217
            MAGSNRS+SLKDTQRSIP+GTLAA + TT LY+++V  FG++ATR  LLTDRLLTA+VAW
Sbjct  1    MAGSNRSASLKDTQRSIPIGTLAATLATTALYLVSVLLFGALATRDALLTDRLLTATVAW  60

Query  218  PFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            PFPA++Y GIILSTLGAALQS+TGAPRLLAAIAND
Sbjct  61   PFPAIIYVGIILSTLGAALQSMTGAPRLLAAIAND  95



>ref|XP_009037856.1| hypothetical protein AURANDRAFT_53926, partial [Aureococcus anophagefferens]
 gb|EGB07220.1| hypothetical protein AURANDRAFT_53926 [Aureococcus anophagefferens]
Length=616

 Score =   122 bits (305),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+ +F+P+VTGIMAGSNRS  L    +SIP+GTLAA   TT LYV+ V+ +G V     L
Sbjct  364  LLAIFYPSVTGIMAGSNRSGVLATPSKSIPLGTLAAIALTTFLYVVVVWLYGLVVAHDVL  423

Query  182  LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            + ++L+ A VAWP P +V  GII+S +GAALQSLTGAPRLLAAIA+D
Sbjct  424  IEEKLVVALVAWPSPIIVKLGIIMSCVGAALQSLTGAPRLLAAIASD  470



>ref|XP_004135733.1| PREDICTED: cation-chloride cotransporter 1-like [Cucumis sativus]
Length=836

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  101  LAANVTTTTLYVITVFFFGSVATRQKLLTDRLLTASVAWPFPAVVYAGIILSTLGAALQS  280
            LAA +TTT +Y+++V  FG++ATR+KLLTDRLLTA+VAWPFPA++Y GIILSTLGAALQS
Sbjct  257  LAATLTTTVMYLVSVLLFGALATRKKLLTDRLLTATVAWPFPAIIYVGIILSTLGAALQS  316

Query  281  LTGAPRLLAAIAND  322
            LTGAPRLLAAIAND
Sbjct  317  LTGAPRLLAAIAND  330



>ref|XP_007610095.1| PREDICTED: LOW QUALITY PROTEIN: solute carrier family 12 member 
4 isoform X2 [Cricetulus griseus]
Length=1163

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  L+D Q+SIPVGT+ A VTT+ +Y  +V  FG+    V  
Sbjct  504  LVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIVTTSLVYFSSVILFGACIDGVVL  563

Query  170  RQKLLTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K ++  L+  ++AWP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  564  RDKXVSRNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKD  614



>ref|XP_003147811.1| hypothetical protein LOAG_12249 [Loa loa]
Length=489

 Score =   118 bits (295),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            L+G+FFP+ TGIMAGSNRS +LKD  RSIP+GTL A VTTT +Y+  V  FGS    +  
Sbjct  262  LIGVFFPSATGIMAGSNRSGNLKDASRSIPLGTLGAQVTTTVVYLSGVILFGSSVSEIFI  321

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K       +L+ A +A P+P V+  G  LST+GA +QSLTGAPRLL AIA+D
Sbjct  322  RDKFGQSAMSKLVIAEIAVPYPTVILIGCFLSTVGAGMQSLTGAPRLLQAIASD  375



>ref|XP_006818288.1| PREDICTED: solute carrier family 12 member 7-like [Saccoglossus 
kowalevskii]
Length=1089

 Score =   120 bits (302),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 64/114 (56%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            L+ +FFP+VTGIMAGSNRS  LKD Q+SIP GT+AA +TTT +Y+ TV FFG+    V  
Sbjct  346  LLAIFFPSVTGIMAGSNRSGDLKDAQQSIPRGTIAAILTTTFIYLTTVLFFGATGKGVVL  405

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+ A +AWP   V+  G  +ST+GA LQSLTGAPRLL AIA D
Sbjct  406  RDKFGESIGGSLVVAQLAWPNEWVILIGSFMSTVGAGLQSLTGAPRLLQAIAKD  459



>gb|ENN76824.1| hypothetical protein YQE_06665, partial [Dendroctonus ponderosae]
 gb|ERL94686.1| hypothetical protein D910_11961 [Dendroctonus ponderosae]
Length=834

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVAT----  169
            L+G+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A +TT+T+Y+  V  F S       
Sbjct  309  LIGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTICAILTTSTVYLSAVILFASTVDNLLL  368

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  RL+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  369  RDKFGSSIGGRLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIAKD  422



>gb|EJD73621.1| K /cl-cotransporter protein 2, partial [Loa loa]
Length=715

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            L+G+FFP+ TGIMAGSNRS +LKD  RSIP+GTL A VTTT +Y+  V  FGS    +  
Sbjct  383  LIGVFFPSATGIMAGSNRSGNLKDASRSIPLGTLGAQVTTTVVYLSGVILFGSSVSEIFI  442

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K       +L+ A +A P+P V+  G  LST+GA +QSLTGAPRLL AIA+D
Sbjct  443  RDKFGQSAMSKLVIAEIAVPYPTVILIGCFLSTVGAGMQSLTGAPRLLQAIASD  496



>ref|XP_001987039.1| GH20188 [Drosophila grimshawi]
 gb|EDW01906.1| GH20188 [Drosophila grimshawi]
Length=1066

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF     ++  
Sbjct  390  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLTSVLFFAGTVDNLLL  449

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  450  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIAKD  503



>gb|ETN62998.1| potassium/chloride symporter [Anopheles darlingi]
Length=826

 Score =   118 bits (296),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 61/114 (54%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+  V  F     ++  
Sbjct  104  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTIGAILTTSTVYLSCVLLFAGTVDNLLL  163

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  164  RDKFGQSIGGKLVVANMAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIAKD  217



>ref|XP_002015636.1| GL11178 [Drosophila persimilis]
 ref|XP_001360235.2| GA18994 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW31526.1| GL11178 [Drosophila persimilis]
 gb|EAL24809.2| GA18994 [Drosophila pseudoobscura pseudoobscura]
Length=1059

 Score =   119 bits (297),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF     ++  
Sbjct  383  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVLFFAGTVDNLLL  442

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  443  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  496



>ref|XP_002049970.1| GJ21885 [Drosophila virilis]
 gb|EDW61163.1| GJ21885 [Drosophila virilis]
Length=1067

 Score =   119 bits (297),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 63/115 (55%), Positives = 79/115 (69%), Gaps = 9/115 (8%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF        L
Sbjct  391  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLTSVLFFAGTVD-NLL  449

Query  182  LTD--------RLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            L D        +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  450  LRDKYGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIAKD  504



>ref|XP_002063789.1| GK15715 [Drosophila willistoni]
 gb|EDW74775.1| GK15715 [Drosophila willistoni]
Length=1067

 Score =   118 bits (296),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF     ++  
Sbjct  391  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLL  450

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  451  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  504



>ref|XP_002942716.1| PREDICTED: solute carrier family 12 member 4-like [Xenopus (Silurana) 
tropicalis]
Length=1090

 Score =   118 bits (296),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  L+D Q+SIPVGT+ A +TT+ +Y  TV  FG+    V  
Sbjct  427  LVGIFFPSVTGIMAGSNRSGDLRDAQKSIPVGTILAIITTSFIYFSTVVLFGACIEGVVL  486

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIAND
Sbjct  487  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAND  540



>gb|KFB47485.1| AGAP011498-PA-like protein [Anopheles sinensis]
Length=882

 Score =   118 bits (295),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 61/114 (54%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+  V  F     ++  
Sbjct  181  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTIGAILTTSTVYLSCVLLFAGTVDNLLL  240

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  241  RDKFGQSIGGKLVVANMAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIAKD  294



>ref|NP_001286794.1| kazachoc, isoform F [Drosophila melanogaster]
 gb|AHN56589.1| kazachoc, isoform F [Drosophila melanogaster]
Length=1066

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFF-GSVAT---  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF G+V     
Sbjct  390  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLL  449

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  450  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  503



>ref|XP_001976496.1| GG22903 [Drosophila erecta]
 gb|EDV56896.1| GG22903 [Drosophila erecta]
Length=1074

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFF-GSVAT---  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF G+V     
Sbjct  398  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLL  457

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  458  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  511



>ref|NP_571976.2| kazachoc, isoform C [Drosophila melanogaster]
 gb|AAF47099.2| kazachoc, isoform C [Drosophila melanogaster]
Length=1059

 Score =   118 bits (295),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF     ++  
Sbjct  383  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLL  442

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  443  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  496



>ref|XP_002092713.1| GE14341 [Drosophila yakuba]
 gb|EDW92425.1| GE14341 [Drosophila yakuba]
Length=1074

 Score =   118 bits (295),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF     ++  
Sbjct  398  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLL  457

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  458  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  511



>ref|NP_726377.1| kazachoc, isoform D [Drosophila melanogaster]
 ref|NP_001286793.1| kazachoc, isoform E [Drosophila melanogaster]
 gb|AAM68276.1| kazachoc, isoform D [Drosophila melanogaster]
 gb|AAS93762.1| LD02554p [Drosophila melanogaster]
 gb|AHN56588.1| kazachoc, isoform E [Drosophila melanogaster]
Length=1074

 Score =   118 bits (295),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF     ++  
Sbjct  398  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLL  457

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  458  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  511



>ref|NP_001286795.1| kazachoc, isoform G [Drosophila melanogaster]
 gb|AHN56590.1| kazachoc, isoform G [Drosophila melanogaster]
Length=1077

 Score =   118 bits (295),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF     ++  
Sbjct  383  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLL  442

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  443  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  496



>ref|NP_726378.1| kazachoc, isoform A [Drosophila melanogaster]
 gb|AAF47098.2| kazachoc, isoform A [Drosophila melanogaster]
Length=1043

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFF-GSVAT---  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF G+V     
Sbjct  398  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLL  457

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  458  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  511



>ref|XP_008316487.1| PREDICTED: solute carrier family 12 member 6 isoform X2 [Cynoglossus 
semilaevis]
 ref|XP_008316503.1| PREDICTED: solute carrier family 12 member 6 isoform X2 [Cynoglossus 
semilaevis]
 ref|XP_008316511.1| PREDICTED: solute carrier family 12 member 6 isoform X2 [Cynoglossus 
semilaevis]
Length=1062

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD QRSIP+GT+ A +TT+ +Y+ +V  FG+    V  
Sbjct  383  LVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTILAILTTSVVYLSSVILFGACIDGVVL  442

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  443  RDKFGDSVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  496



>ref|XP_001959437.1| GF12875 [Drosophila ananassae]
 gb|EDV36259.1| GF12875 [Drosophila ananassae]
Length=1058

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFF-GSVAT---  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF G+V     
Sbjct  383  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLL  442

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  443  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  496



>ref|XP_008316494.1| PREDICTED: solute carrier family 12 member 6 isoform X3 [Cynoglossus 
semilaevis]
Length=1035

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD QRSIP+GT+ A +TT+ +Y+ +V  FG+    V  
Sbjct  496  LVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTILAILTTSVVYLSSVILFGACIDGVVL  555

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  556  RDKFGDSVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  609



>ref|XP_002040175.1| GM16063 [Drosophila sechellia]
 gb|EDW57040.1| GM16063 [Drosophila sechellia]
Length=1074

 Score =   118 bits (295),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF     ++  
Sbjct  398  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLL  457

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  458  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  511



>ref|XP_007887682.1| PREDICTED: solute carrier family 12 member 4 isoform X2 [Callorhinchus 
milii]
Length=1089

 Score =   118 bits (295),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A  TT+ +Y+ +V  FG+    V  
Sbjct  426  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIATTSLVYLSSVVLFGACVEGVVL  485

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  486  RDKYGDAVNKNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKD  539



>ref|NP_726379.1| kazachoc, isoform B [Drosophila melanogaster]
 gb|AAM50621.1| GH09271p [Drosophila melanogaster]
 gb|AAM68277.1| kazachoc, isoform B [Drosophila melanogaster]
 gb|ACL86084.1| CG5594-PB, partial [synthetic construct]
 gb|ACL90873.1| CG5594-PB [synthetic construct]
Length=1028

 Score =   118 bits (295),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 81/114 (71%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V FF     ++  
Sbjct  383  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVMFFAGTVDNLLL  442

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  443  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIARD  496



>ref|XP_005025758.1| PREDICTED: solute carrier family 12 member 4 isoform X1 [Anas 
platyrhynchos]
 ref|XP_005025759.1| PREDICTED: solute carrier family 12 member 4 isoform X2 [Anas 
platyrhynchos]
Length=1112

 Score =   118 bits (295),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_008316459.1| PREDICTED: solute carrier family 12 member 6 isoform X1 [Cynoglossus 
semilaevis]
 ref|XP_008316464.1| PREDICTED: solute carrier family 12 member 6 isoform X1 [Cynoglossus 
semilaevis]
 ref|XP_008316474.1| PREDICTED: solute carrier family 12 member 6 isoform X1 [Cynoglossus 
semilaevis]
Length=1175

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD QRSIP+GT+ A +TT+ +Y+ +V  FG+    V  
Sbjct  496  LVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTILAILTTSVVYLSSVILFGACIDGVVL  555

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  556  RDKFGDSVNGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  609



>ref|XP_005025761.1| PREDICTED: solute carrier family 12 member 4 isoform X4 [Anas 
platyrhynchos]
Length=1070

 Score =   117 bits (294),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  400  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  459

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  460  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  513



>ref|XP_008499512.1| PREDICTED: solute carrier family 12 member 4 isoform X2 [Calypte 
anna]
Length=1084

 Score =   117 bits (294),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  400  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  459

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  460  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  513



>ref|XP_007910505.1| PREDICTED: solute carrier family 12 member 5 isoform X4 [Callorhinchus 
milii]
Length=1110

 Score =   117 bits (294),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 60/114 (53%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG++FP+VTGIMAGSNRS  L+D Q+SIP+GT+ A  TT+ +YV T+  FG+    V  
Sbjct  401  LVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTIMAITTTSAVYVSTIILFGACIEGVVL  460

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G + ST GA LQSLTGAPRLL AIA D
Sbjct  461  RDKFGEAVNGNLVIGTLSWPSPWVIVFGSLFSTCGAGLQSLTGAPRLLQAIARD  514



>ref|XP_007910496.1| PREDICTED: solute carrier family 12 member 5 isoform X3 [Callorhinchus 
milii]
Length=1111

 Score =   117 bits (294),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 60/114 (53%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG++FP+VTGIMAGSNRS  L+D Q+SIP+GT+ A  TT+ +YV T+  FG+    V  
Sbjct  402  LVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTIMAITTTSAVYVSTIILFGACIEGVVL  461

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G + ST GA LQSLTGAPRLL AIA D
Sbjct  462  RDKFGEAVNGNLVIGTLSWPSPWVIVFGSLFSTCGAGLQSLTGAPRLLQAIARD  515



>ref|XP_004175039.1| PREDICTED: solute carrier family 12 member 4 isoform 2 [Taeniopygia 
guttata]
Length=1104

 Score =   117 bits (294),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKFGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_005052628.1| PREDICTED: solute carrier family 12 member 4 isoform X5 [Ficedula 
albicollis]
Length=1109

 Score =   117 bits (294),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKFGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_005912997.1| PREDICTED: solute carrier family 12 member 4-like isoform X1 
[Haplochromis burtoni]
Length=1094

 Score =   117 bits (294),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+ TGIMAGSNRS  LKD Q+SIPVGT+ A  TT+ +Y  +V  FGS    V  
Sbjct  431  LVGIFFPSATGIMAGSNRSGDLKDAQKSIPVGTILAITTTSLVYFSSVVLFGSCIEGVVL  490

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST+GA LQSLTGAPRLL AIA D
Sbjct  491  RDKFGDAVKKNLVVGTLAWPSPWVIVIGSFFSTVGAGLQSLTGAPRLLQAIAKD  544



>ref|XP_005912998.1| PREDICTED: solute carrier family 12 member 4-like isoform X2 
[Haplochromis burtoni]
Length=1088

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+ TGIMAGSNRS  LKD Q+SIPVGT+ A  TT+ +Y  +V  FGS    V  
Sbjct  431  LVGIFFPSATGIMAGSNRSGDLKDAQKSIPVGTILAITTTSLVYFSSVVLFGSCIEGVVL  490

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST+GA LQSLTGAPRLL AIA D
Sbjct  491  RDKFGDAVKKNLVVGTLAWPSPWVIVIGSFFSTVGAGLQSLTGAPRLLQAIAKD  544



>ref|XP_317803.3| AGAP011498-PA [Anopheles gambiae str. PEST]
 gb|EAA13082.4| AGAP011498-PA [Anopheles gambiae str. PEST]
Length=898

 Score =   117 bits (293),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A VTT+T+Y+  V  F     ++  
Sbjct  217  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTIGAIVTTSTVYLSCVLLFAGTVDNLLL  276

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  277  RDKFGQSIGGKLVVANMAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIAKD  330



>ref|XP_006779859.1| PREDICTED: solute carrier family 12 member 4-like [Neolamprologus 
brichardi]
Length=1093

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+ TGIMAGSNRS  LKD Q+SIPVGT+ A  TT+ +Y  +V  FGS    V  
Sbjct  430  LVGIFFPSATGIMAGSNRSGDLKDAQKSIPVGTILAITTTSLVYFSSVVLFGSCIEGVVL  489

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST+GA LQSLTGAPRLL AIA D
Sbjct  490  RDKFGDAVKKNLVVGTLAWPSPWVIVIGSFFSTVGAGLQSLTGAPRLLQAIAKD  543



>ref|XP_004539718.1| PREDICTED: solute carrier family 12 member 4-like isoform X1 
[Maylandia zebra]
Length=1094

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+ TGIMAGSNRS  LKD Q+SIPVGT+ A  TT+ +Y  +V  FGS    V  
Sbjct  431  LVGIFFPSATGIMAGSNRSGDLKDAQKSIPVGTILAITTTSLVYFSSVVLFGSCIEGVVL  490

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST+GA LQSLTGAPRLL AIA D
Sbjct  491  RDKFGDAVKKNLVVGTLAWPSPWVIVIGSFFSTVGAGLQSLTGAPRLLQAIAKD  544



>ref|XP_003437579.1| PREDICTED: solute carrier family 12 member 4-like isoformX1 [Oreochromis 
niloticus]
Length=1094

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+ TGIMAGSNRS  LKD Q+SIPVGT+ A  TT+ +Y  +V  FGS    V  
Sbjct  431  LVGIFFPSATGIMAGSNRSGDLKDAQKSIPVGTILAITTTSLVYFSSVVLFGSCIEGVVL  490

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST+GA LQSLTGAPRLL AIA D
Sbjct  491  RDKFGDAVKKNLVVGTLAWPSPWVIVIGSFFSTVGAGLQSLTGAPRLLQAIAKD  544



>ref|XP_003437580.1| PREDICTED: solute carrier family 12 member 4-like isoformX2 [Oreochromis 
niloticus]
Length=1088

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+ TGIMAGSNRS  LKD Q+SIPVGT+ A  TT+ +Y  +V  FGS    V  
Sbjct  431  LVGIFFPSATGIMAGSNRSGDLKDAQKSIPVGTILAITTTSLVYFSSVVLFGSCIEGVVL  490

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST+GA LQSLTGAPRLL AIA D
Sbjct  491  RDKFGDAVKKNLVVGTLAWPSPWVIVIGSFFSTVGAGLQSLTGAPRLLQAIAKD  544



>ref|XP_010131533.1| PREDICTED: solute carrier family 12 member 4 [Buceros rhinoceros 
silvestris]
Length=1104

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y+  V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYLSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_009075074.1| PREDICTED: solute carrier family 12 member 4 [Acanthisitta chloris]
Length=1105

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  443  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSVVYFSCVLLFGACIEGVVL  502

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  503  RDKYGDAVKKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  556



>ref|XP_004534770.1| PREDICTED: solute carrier family 12 member 6-like isoform X6 
[Ceratitis capitata]
Length=908

 Score =   117 bits (293),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 61/114 (54%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFG----SVAT  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+ +V  F     ++  
Sbjct  205  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSSVILFAGTVDNLLL  264

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  +L+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  265  RDKFGQSIGGKLVVANIAWPNQWVILIGSFLSTLGAGLQSLTGAPRLLQAIAKD  318



>ref|XP_002189635.2| PREDICTED: solute carrier family 12 member 4 isoform 1 [Taeniopygia 
guttata]
Length=1085

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  423  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  482

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  483  RDKFGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  536



>gb|KFU94747.1| Solute carrier family 12 member 4, partial [Chaetura pelagica]
Length=1046

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKFGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>ref|XP_008499511.1| PREDICTED: solute carrier family 12 member 4 isoform X1 [Calypte 
anna]
Length=1104

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_010002720.1| PREDICTED: solute carrier family 12 member 4 [Chaetura pelagica]
Length=1104

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKFGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_005052624.1| PREDICTED: solute carrier family 12 member 4 isoform X1 [Ficedula 
albicollis]
 ref|XP_005052625.1| PREDICTED: solute carrier family 12 member 4 isoform X2 [Ficedula 
albicollis]
 ref|XP_005052626.1| PREDICTED: solute carrier family 12 member 4 isoform X3 [Ficedula 
albicollis]
 ref|XP_005052627.1| PREDICTED: solute carrier family 12 member 4 isoform X4 [Ficedula 
albicollis]
Length=1104

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKFGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_010175642.1| PREDICTED: solute carrier family 12 member 4 [Caprimulgus carolinensis]
Length=1104

 Score =   117 bits (294),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>gb|KFP82213.1| Solute carrier family 12 member 4, partial [Acanthisitta chloris]
Length=1047

 Score =   117 bits (293),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  385  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSVVYFSCVLLFGACIEGVVL  444

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  445  RDKYGDAVKKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  498



>emb|CDQ06781.1| Protein Bm8657, isoform c [Brugia malayi]
Length=543

 Score =   115 bits (288),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVAT----  169
            L+G+FFP+ TGIMAGSNRS +LKD  RSIP+GTL A VTTT +Y+  V  FG+  +    
Sbjct  122  LIGVFFPSATGIMAGSNRSGNLKDASRSIPLGTLGAQVTTTIVYLSGVILFGASVSEMFI  181

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K       +L+ A +A P P V+  G  LST+GA +QSLTGAPRLL AIA+D
Sbjct  182  RDKFGQSAMSKLVIAELAIPHPTVILIGCFLSTVGAGMQSLTGAPRLLQAIASD  235



>ref|XP_005488931.1| PREDICTED: solute carrier family 12 member 4 isoform X5 [Zonotrichia 
albicollis]
Length=1087

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  425  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  484

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  485  RDKFGDAVNRNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  538



>ref|XP_008931652.1| PREDICTED: solute carrier family 12 member 4 [Manacus vitellinus]
Length=1104

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_007887681.1| PREDICTED: solute carrier family 12 member 4 isoform X1 [Callorhinchus 
milii]
Length=1103

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A  TT+ +Y+ +V  FG+    V  
Sbjct  440  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIATTSLVYLSSVVLFGACVEGVVL  499

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  500  RDKYGDAVNKNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKD  553



>ref|XP_006002448.1| PREDICTED: solute carrier family 12 member 5 [Latimeria chalumnae]
Length=1105

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 61/114 (54%), Positives = 79/114 (69%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG++FP+VTGIMAGSNRS  L+D Q+SIP+GT+ A  TTT +Y+ +V  FG+    V  
Sbjct  396  LVGIYFPSVTGIMAGSNRSGDLRDAQKSIPLGTIMAIATTTFVYISSVILFGACIEGVVL  455

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    ++  L+  ++AWP P V+  G + ST GA LQSLTGAPRLL AIA D
Sbjct  456  RDKFGEAVSGNLVVGTLAWPSPWVIVFGSLFSTCGAGLQSLTGAPRLLQAIARD  509



>gb|EYC42509.1| hypothetical protein Y032_0529g2998 [Ancylostoma ceylanicum]
Length=908

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 83/115 (72%), Gaps = 9/115 (8%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+G+FFP+ TGIMAGSNRS +L+D  +SIP+GTLAA ++T+T+Y++ V  FG+ +  +  
Sbjct  408  LIGVFFPSATGIMAGSNRSGNLRDASKSIPLGTLAAQISTSTVYLLGVLLFGA-SVSEMF  466

Query  182  LTD--------RLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            + D        +L  + +AWPFP V+  G + +T+GA +QSLTGAPRLL AIA+D
Sbjct  467  IRDKYGQSAMGKLTISEIAWPFPIVILWGCLGATIGAGMQSLTGAPRLLQAIASD  521



>ref|XP_010180265.1| PREDICTED: LOW QUALITY PROTEIN: solute carrier family 12 member 
4-like [Mesitornis unicolor]
Length=1084

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  400  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  459

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  460  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  513



>ref|XP_008208471.1| PREDICTED: solute carrier family 12 member 4 isoform X2 [Nasonia 
vitripennis]
Length=1171

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFF-GSVAT---  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+  V  F G+V     
Sbjct  454  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSCVLLFAGTVDNLLL  513

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  RL+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  514  RDKFGQSIGGRLVVANIAWPNEWVILVGSFLSTLGAGLQSLTGAPRLLQAIAKD  567



>ref|XP_005526407.1| PREDICTED: solute carrier family 12 member 4 isoform X4 [Pseudopodoces 
humilis]
Length=1087

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  425  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  484

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  485  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  538



>ref|XP_005025760.1| PREDICTED: solute carrier family 12 member 4 isoform X3 [Anas 
platyrhynchos]
Length=1104

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_010216245.1| PREDICTED: solute carrier family 12 member 4, partial [Tinamus 
guttatus]
Length=1051

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>ref|XP_010583072.1| PREDICTED: solute carrier family 12 member 4 [Haliaeetus leucocephalus]
Length=1109

 Score =   117 bits (293),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_009866725.1| PREDICTED: solute carrier family 12 member 4 isoform X2 [Apaloderma 
vittatum]
Length=1055

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  401  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  460

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  461  RDKYGDAVKKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  514



>ref|XP_008208470.1| PREDICTED: solute carrier family 12 member 4 isoform X1 [Nasonia 
vitripennis]
Length=1177

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFF-GSVAT---  169
            L+G+FFP+VTGIMAGSNRS  L D Q+SIP+GT+ A +TT+T+Y+  V  F G+V     
Sbjct  454  LIGIFFPSVTGIMAGSNRSGDLADAQKSIPIGTICAILTTSTVYLSCVLLFAGTVDNLLL  513

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +  RL+ A++AWP   V+  G  LSTLGA LQSLTGAPRLL AIA D
Sbjct  514  RDKFGQSIGGRLVVANIAWPNEWVILVGSFLSTLGAGLQSLTGAPRLLQAIAKD  567



>gb|KFO87945.1| Solute carrier family 12 member 4, partial [Buceros rhinoceros 
silvestris]
Length=1049

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y+  V  FG+    V  
Sbjct  387  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYLSCVLLFGACIEGVVL  446

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  447  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  500



>gb|EJW80315.1| hypothetical protein WUBG_08776 [Wuchereria bancrofti]
Length=443

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVAT----  169
            L+G+FFP+ TGIMAGSNRS +LKD  RSIP+GTL A VTTT +Y+  V  FG+  +    
Sbjct  89   LIGVFFPSATGIMAGSNRSGNLKDASRSIPLGTLGAQVTTTIVYLSGVILFGASVSEMFI  148

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K       +L+ A +A P P V+  G  LST+GA +QSLTGAPRLL AIA+D
Sbjct  149  RDKFGQSAMSKLVIAELAVPHPTVILIGCFLSTVGAGMQSLTGAPRLLQAIASD  202



>emb|CAF91145.1| unnamed protein product [Tetraodon nigroviridis]
Length=1211

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD QRSIP+GT+ A +TT+ +Y+ +V  FG+    V  
Sbjct  505  LVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTILAILTTSIVYLSSVVLFGACIDGVVL  564

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  565  RDKFGDSVKGNLVVGTLAWPSPWVIVVGSFFSTCGAGLQSLTGAPRLLQAIAKD  618



>gb|KFW75874.1| Solute carrier family 12 member 4, partial [Manacus vitellinus]
Length=1046

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>gb|EOA96920.1| Solute carrier family 12 member 4, partial [Anas platyrhynchos]
Length=1047

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  385  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  444

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  445  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  498



>ref|XP_007910482.1| PREDICTED: solute carrier family 12 member 5 isoform X1 [Callorhinchus 
milii]
Length=1152

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 60/114 (53%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG++FP+VTGIMAGSNRS  L+D Q+SIP+GT+ A  TT+ +YV T+  FG+    V  
Sbjct  443  LVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTIMAITTTSAVYVSTIILFGACIEGVVL  502

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G + ST GA LQSLTGAPRLL AIA D
Sbjct  503  RDKFGEAVNGNLVIGTLSWPSPWVIVFGSLFSTCGAGLQSLTGAPRLLQAIARD  556



>ref|XP_009951782.1| PREDICTED: solute carrier family 12 member 4, partial [Leptosomus 
discolor]
Length=1051

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>ref|XP_004944227.1| PREDICTED: solute carrier family 12 member 4 isoform X5 [Gallus 
gallus]
Length=1099

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  432  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  491

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  492  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  545



>ref|XP_009884678.1| PREDICTED: solute carrier family 12 member 4 [Charadrius vociferus]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>emb|CDJ86943.1| Amino acid permease-associated region domain containing protein 
[Haemonchus contortus]
Length=951

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 82/115 (71%), Gaps = 9/115 (8%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGSVATRQKL  181
            L+G+FFP+ TGIMAGSNRS +L+D  RSIP+GTLAA ++T+T+Y++ V  FG+ +  +  
Sbjct  276  LIGVFFPSATGIMAGSNRSGNLRDASRSIPLGTLAAQISTSTVYLVGVMVFGA-SVSEMF  334

Query  182  LTD--------RLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            + D        +L  + +AWPFP V+  G + +T+GA +QSLTGAPRLL AIA D
Sbjct  335  IRDKYGQSAMSKLTISEIAWPFPIVILFGCLGATIGAGMQSLTGAPRLLQAIAFD  389



>ref|XP_009937817.1| PREDICTED: solute carrier family 12 member 4 [Opisthocomus hoazin]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_005526404.1| PREDICTED: solute carrier family 12 member 4 isoform X1 [Pseudopodoces 
humilis]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_010394904.1| PREDICTED: solute carrier family 12 member 4 isoform X1 [Corvus 
cornix cornix]
Length=1109

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_009319071.1| PREDICTED: LOW QUALITY PROTEIN: solute carrier family 12 member 
4 [Pygoscelis adeliae]
Length=1117

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGEAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_010716115.1| PREDICTED: solute carrier family 12 member 4 [Meleagris gallopavo]
Length=651

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  259  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  318

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  319  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  372



>ref|XP_010287711.1| PREDICTED: solute carrier family 12 member 4 isoform X2 [Phaethon 
lepturus]
Length=1035

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  400  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  459

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  460  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  513



>gb|KGL79527.1| Solute carrier family 12 member 4, partial [Tinamus guttatus]
Length=1046

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>ref|XP_010394905.1| PREDICTED: solute carrier family 12 member 4 isoform X2 [Corvus 
cornix cornix]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_009973834.1| PREDICTED: solute carrier family 12 member 4 [Tyto alba]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_009704882.1| PREDICTED: solute carrier family 12 member 4 [Cariama cristata]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_008277924.1| PREDICTED: solute carrier family 12 member 6 isoform X3 [Stegastes 
partitus]
Length=1042

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD QRSIP+GT+ A +TT+ +Y+ +V  FG+    V  
Sbjct  344  LVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTILAILTTSIVYLSSVVLFGACIDGVVL  403

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  404  RDKFGDSVKGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  457



>ref|XP_006121169.1| PREDICTED: solute carrier family 12 member 4 isoform X3 [Pelodiscus 
sinensis]
Length=1109

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y  +V  FG+    V  
Sbjct  447  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSSVLLFGACIEGVVL  506

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  507  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  560



>ref|XP_005488929.1| PREDICTED: solute carrier family 12 member 4 isoform X3 [Zonotrichia 
albicollis]
Length=1094

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  432  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  491

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  492  RDKFGDAVNRNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  545



>ref|XP_005488927.1| PREDICTED: solute carrier family 12 member 4 isoform X1 [Zonotrichia 
albicollis]
Length=1099

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  432  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  491

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  492  RDKFGDAVNRNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  545



>ref|XP_005488930.1| PREDICTED: solute carrier family 12 member 4 isoform X4 [Zonotrichia 
albicollis]
Length=1088

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  432  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  491

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  492  RDKFGDAVNRNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  545



>ref|XP_006121168.1| PREDICTED: solute carrier family 12 member 4 isoform X2 [Pelodiscus 
sinensis]
Length=1123

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y  +V  FG+    V  
Sbjct  456  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSSVLLFGACIEGVVL  515

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  516  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  569



>ref|XP_009088881.1| PREDICTED: solute carrier family 12 member 4 [Serinus canaria]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKFGDAVNRNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_005422781.1| PREDICTED: solute carrier family 12 member 4 [Geospiza fortis]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKFGDAVNRNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_005488928.1| PREDICTED: solute carrier family 12 member 4 isoform X2 [Zonotrichia 
albicollis]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKFGDAVNRNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_007910490.1| PREDICTED: solute carrier family 12 member 5 isoform X2 [Callorhinchus 
milii]
Length=1147

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 60/114 (53%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG++FP+VTGIMAGSNRS  L+D Q+SIP+GT+ A  TT+ +YV T+  FG+    V  
Sbjct  443  LVGIYFPSVTGIMAGSNRSGDLRDAQKSIPIGTIMAITTTSAVYVSTIILFGACIEGVVL  502

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G + ST GA LQSLTGAPRLL AIA D
Sbjct  503  RDKFGEAVNGNLVIGTLSWPSPWVIVFGSLFSTCGAGLQSLTGAPRLLQAIARD  556



>ref|XP_010118797.1| PREDICTED: solute carrier family 12 member 4 [Chlamydotis macqueenii]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_009897438.1| PREDICTED: solute carrier family 12 member 4 [Picoides pubescens]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_009467494.1| PREDICTED: solute carrier family 12 member 4 [Nipponia nippon]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_005233553.1| PREDICTED: solute carrier family 12 member 4 [Falco peregrinus]
 ref|XP_005444648.1| PREDICTED: solute carrier family 12 member 4 [Falco cherrug]
Length=1104

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>ref|XP_009982158.1| PREDICTED: solute carrier family 12 member 4 [Tauraco erythrolophus]
Length=1108

 Score =   117 bits (293),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  446  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  505

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  506  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  559



>gb|KFP06625.1| Solute carrier family 12 member 4, partial [Calypte anna]
Length=1046

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>ref|XP_001505237.1| PREDICTED: solute carrier family 12 member 4 [Ornithorhynchus 
anatinus]
Length=1093

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y  +V  FG+    V  
Sbjct  431  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSSVVLFGACIEGVVL  490

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    ++  L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  491  RDKYGDGVSKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  544



>ref|XP_005152287.1| PREDICTED: solute carrier family 12 member 4 isoform X4 [Melopsittacus 
undulatus]
Length=1087

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  425  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  484

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  485  RDKYGDAVNRNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  538



>gb|KFP58700.1| Solute carrier family 12 member 4, partial [Cathartes aura]
Length=1046

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>gb|KFZ51766.1| Solute carrier family 12 member 4, partial [Caprimulgus carolinensis]
Length=1046

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>ref|XP_008165136.1| PREDICTED: solute carrier family 12 member 4 isoform X3 [Chrysemys 
picta bellii]
Length=1061

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 77/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y  +V  FG+    V  
Sbjct  399  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSSVLLFGACIEGVVL  458

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  459  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  512



>ref|XP_010747336.1| PREDICTED: solute carrier family 12 member 6 isoform X2 [Larimichthys 
crocea]
Length=1168

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD QRSIP+GT+ A +TT+ +Y+ +V  FG+    V  
Sbjct  487  LVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTILAILTTSIVYLSSVVLFGACIDGVVL  546

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  547  RDKFGDSVKGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  600



>ref|XP_008277925.1| PREDICTED: solute carrier family 12 member 6 isoform X4 [Stegastes 
partitus]
Length=1200

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD QRSIP+GT+ A +TT+ +Y+ +V  FG+    V  
Sbjct  488  LVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTILAILTTSIVYLSSVVLFGACIDGVVL  547

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  548  RDKFGDSVKGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  601



>gb|KGL86629.1| Solute carrier family 12 member 4, partial [Charadrius vociferus]
Length=1046

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>gb|KFV01330.1| Solute carrier family 12 member 4, partial [Tauraco erythrolophus]
Length=1046

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>gb|KFR14634.1| Solute carrier family 12 member 4, partial [Opisthocomus hoazin]
Length=1046

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>ref|XP_008277922.1| PREDICTED: solute carrier family 12 member 6 isoform X2 [Stegastes 
partitus]
Length=1167

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 78/114 (68%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD QRSIP+GT+ A +TT+ +Y+ +V  FG+    V  
Sbjct  488  LVGIFFPSVTGIMAGSNRSGDLKDAQRSIPIGTILAILTTSIVYLSSVVLFGACIDGVVL  547

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  548  RDKFGDSVKGNLVVGTLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  601



>ref|XP_005912999.1| PREDICTED: solute carrier family 12 member 4-like isoform X3 
[Haplochromis burtoni]
Length=1064

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+ TGIMAGSNRS  LKD Q+SIPVGT+ A  TT+ +Y  +V  FGS    V  
Sbjct  401  LVGIFFPSATGIMAGSNRSGDLKDAQKSIPVGTILAITTTSLVYFSSVVLFGSCIEGVVL  460

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  ++AWP P V+  G   ST+GA LQSLTGAPRLL AIA D
Sbjct  461  RDKFGDAVKKNLVVGTLAWPSPWVIVIGSFFSTVGAGLQSLTGAPRLLQAIAKD  514



>ref|XP_008637128.1| PREDICTED: solute carrier family 12 member 4 [Corvus brachyrhynchos]
Length=1124

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  462  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  521

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  522  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  575



>ref|XP_010298582.1| PREDICTED: solute carrier family 12 member 4 [Balearica regulorum 
gibbericeps]
Length=1030

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  442  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  501

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  502  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  555



>gb|KFV66351.1| Solute carrier family 12 member 4, partial [Picoides pubescens]
Length=1046

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>gb|KFQ85077.1| Solute carrier family 12 member 4, partial [Phoenicopterus ruber 
ruber]
Length=1046

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>gb|KFQ77265.1| Solute carrier family 12 member 4, partial [Phaethon lepturus]
Length=1046

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



>gb|KFQ33232.1| Solute carrier family 12 member 4, partial [Mesitornis unicolor]
Length=1046

 Score =   117 bits (292),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 63/114 (55%), Positives = 76/114 (67%), Gaps = 7/114 (6%)
 Frame = +2

Query  2    LVGLFFPAVTGIMAGSNRSSSLKDTQRSIPVGTLAANVTTTTLYVITVFFFGS----VAT  169
            LVG+FFP+VTGIMAGSNRS  LKD Q+SIPVGT+ A VTT+ +Y   V  FG+    V  
Sbjct  384  LVGIFFPSVTGIMAGSNRSGDLKDAQKSIPVGTILAIVTTSLVYFSCVLLFGACIEGVVL  443

Query  170  RQKL---LTDRLLTASVAWPFPAVVYAGIILSTLGAALQSLTGAPRLLAAIAND  322
            R K    +   L+  +++WP P V+  G   ST GA LQSLTGAPRLL AIA D
Sbjct  444  RDKYGDAVNKNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKD  497



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506643158204