BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c10006_g1_i1 len=1150 path=[39:0-595 38:596-1149]

Length=1150
                                                                      Score     E

gb|AAK27151.1|  MADS box transcription factor                           372   6e-125   Ipomoea batatas [batate]
gb|ADU56833.1|  MADS-box protein STMADS11 subfamily                     315   8e-103   
ref|XP_011016930.1|  PREDICTED: MADS-box protein JOINTLESS              298   2e-96    
gb|AAR92206.1|  MADS box transcription factor                           298   2e-96    Populus tomentosa [Chinese white poplar]
emb|CAX11663.1|  MADS domain MPF2-like transcription factor             296   6e-95    Withania somnifera [ashwagandha]
emb|CAX84150.1|  MPF2-like                                              293   7e-94    
ref|XP_007018219.1|  K-box region and MADS-box transcription fact...    289   1e-92    
dbj|BAN89455.1|  short vegetative phase                                 287   8e-92    
emb|CAX11664.1|  MADS domain MPF2-like transcription factor             288   1e-91    Tubocapsicum anomalum
emb|CAX51260.1|  MPF2-like-B                                            284   1e-90    Tubocapsicum anomalum
gb|ADX96027.1|  MPF2-like transcription factor                          284   2e-90    
gb|AIK35208.1|  SVP1 protein                                            283   4e-90    
emb|CAX51259.1|  MPF2-like-B                                            282   7e-90    Tubocapsicum anomalum
emb|CAX51305.1|  MPF2-like-B                                            281   3e-89    Withania somnifera [ashwagandha]
gb|AAV65505.1|  MPF2                                                    280   1e-88    Physalis pubescens [capuli]
emb|CAX51261.1|  MPF2-like-B                                            279   1e-88    Withania aristata
emb|CAX51268.1|  MPF2-like-B                                            279   2e-88    Withania frutescens
ref|XP_006472470.1|  PREDICTED: MADS-box protein SVP-like isoform X1    278   2e-88    
gb|ABQ51097.1|  MPF2-like                                               280   3e-88    Witheringia coccoloboides
emb|CAX51300.1|  MPF2-like-B                                            278   4e-88    Withania frutescens
emb|CAX51278.1|  MPF2-like-B                                            278   4e-88    Withania riebeckii
emb|CAX51279.1|  MPF2-like-B                                            278   5e-88    Withania somnifera [ashwagandha]
emb|CAX84147.1|  MPF2-like                                              278   7e-88    
emb|CAX51295.1|  MPF2-like-A                                            277   8e-88    Withania somnifera [ashwagandha]
gb|ABQ51131.1|  MPF2-like                                               278   8e-88    Physalis pubescens [capuli]
gb|AIA58526.1|  SVP-like MADS-box protein                               277   8e-88    
gb|AFA37965.1|  SVP3                                                    277   9e-88    
emb|CAX51297.1|  MPF2-like-A                                            276   1e-87    Withania frutescens
gb|ABQ51132.1|  MPF2-like                                               277   2e-87    Physalis pruinosa
emb|CAX51296.1|  MPF2-like-B                                            276   2e-87    Withania somnifera [ashwagandha]
emb|CAX51287.1|  MPF2-like-B                                            276   2e-87    Withania sp. W010
ref|XP_009627164.1|  PREDICTED: MADS-box protein SVP-like isoform X3    276   2e-87    
emb|CAX84149.1|  MPF2-like                                              276   2e-87    
ref|XP_002285687.1|  PREDICTED: MADS-box protein SVP                    276   2e-87    Vitis vinifera
emb|CAX84161.1|  MPF2-like                                              276   4e-87    
gb|ABQ51096.1|  MPF2-like                                               276   4e-87    Witheringia solanacea
emb|CAX84157.1|  MPF2-like                                              275   7e-87    
emb|CAX51262.1|  MPF2-like-B                                            275   7e-87    Withania aristata
gb|AHI85951.1|  AGL24                                                   274   1e-86    
emb|CAX51263.1|  MPF2-like-A                                            274   1e-86    Withania aristata
gb|ABQ51099.1|  MPF2-like                                               275   1e-86    Vassobia breviflora
emb|CAX11666.1|  MADS domain MPF2-like transcription factor             274   2e-86    Withania somnifera [ashwagandha]
emb|CAX51299.1|  MPF2-like-A                                            273   2e-86    Withania frutescens
gb|AAV65502.1|  MPP3                                                    273   5e-86    Physalis peruviana [Cape-gooseberry]
gb|AAK21250.1|AF335237_1  MADS-box transcription factor FBP13           273   6e-86    Petunia x hybrida [garden petunia]
emb|CAX51283.1|  MPF2-like-B                                            272   6e-86    Withania somnifera [ashwagandha]
gb|AAV65501.1|  MSM2                                                    272   9e-86    Solanum macrocarpon
gb|AFA37969.1|  SVP3                                                    271   1e-85    
gb|ABQ51120.1|  MPF2-like                                               272   1e-85    Physalis alkekengi [Chinese-lantern]
emb|CAX51276.1|  MPF2-like-A                                            271   1e-85    Withania riebeckii
ref|XP_009627161.1|  PREDICTED: MADS-box protein AGL24-like isofo...    271   2e-85    
emb|CAX51281.1|  MPF2-like-A                                            271   2e-85    Withania somnifera [ashwagandha]
emb|CAX51270.1|  MPF2-like-A                                            271   2e-85    Withania frutescens
emb|CAX51267.1|  MPF2-like-A                                            271   2e-85    Withania aristata
gb|AAV65503.1|  MPP4                                                    271   3e-85    Physalis peruviana [Cape-gooseberry]
emb|CAX51285.1|  MPF2-like-A                                            270   5e-85    Withania somnifera [ashwagandha]
emb|CAX51292.1|  MPF2-like-A                                            270   6e-85    Withania sp. W011
emb|CAX51275.1|  MPF2-like-A                                            269   8e-85    Withania riebeckii
emb|CAX51308.1|  MPF2-like-B                                            269   1e-84    Withania sp. W009
emb|CAX51307.1|  MPF2-like-B                                            268   4e-84    Withania sp. W009
ref|XP_009627163.1|  PREDICTED: MADS-box protein SVP-like isoform X2    268   4e-84    
emb|CAX51272.1|  MPF2-like-B                                            267   5e-84    Withania riebeckii
emb|CAX51303.1|  MPF2-like-A                                            266   9e-84    Withania somnifera [ashwagandha]
ref|XP_009785678.1|  PREDICTED: MADS-box protein AGL24-like isofo...    267   1e-83    
ref|XP_010060099.1|  PREDICTED: MADS-box protein SVP-like isoform X2    266   1e-83    
emb|CAX51264.1|  MPF2-like-A                                            266   1e-83    Withania aristata
emb|CAX51282.1|  MPF2-like-A                                            266   2e-83    Withania somnifera [ashwagandha]
gb|AGW23339.1|  MADS box protein MADS37                                 264   6e-83    
emb|CAX51302.1|  MPF2-like-A                                            264   9e-83    Withania somnifera [ashwagandha]
ref|XP_010254525.1|  PREDICTED: MADS-box protein SVP isoform X2         262   3e-82    
ref|XP_010277489.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    262   4e-82    
ref|XP_004237993.1|  PREDICTED: MADS-box protein SVP isoform X1         261   2e-81    
ref|XP_010277487.1|  PREDICTED: MADS-box protein SVP-like isoform X1    259   4e-81    
ref|XP_006338063.1|  PREDICTED: MADS-box protein SVP isoform X1         259   6e-81    
ref|XP_010060098.1|  PREDICTED: MADS-box protein SVP-like isoform X1    259   6e-81    
gb|AGW23356.1|  MADS box protein MADS54                                 258   9e-81    
ref|NP_001275284.1|  MADS16 protein                                     259   1e-80    
emb|CAX51306.1|  MPF2-like-A                                            258   1e-80    Withania sp. W009
ref|XP_010254524.1|  PREDICTED: MADS-box protein SVP isoform X1         258   1e-80    
gb|AAB94005.1|  MADS transcriptional factor                             256   7e-80    Solanum tuberosum [potatoes]
ref|XP_010320206.1|  PREDICTED: MADS-box protein SVP isoform X2         256   7e-80    
gb|AFA37968.1|  SVP2                                                    256   1e-79    
ref|XP_009785671.1|  PREDICTED: MADS-box protein AGL24-like isofo...    257   2e-79    
ref|XP_010027953.1|  PREDICTED: MADS-box protein JOINTLESS              255   2e-79    
ref|XP_006338064.1|  PREDICTED: MADS-box protein SVP isoform X2         254   3e-79    
gb|AAP40641.1|  SVP-like floral repressor                               253   1e-78    Eucalyptus occidentalis
gb|AFA37964.1|  SVP2                                                    253   2e-78    
gb|KDP41475.1|  hypothetical protein JCGZ_15882                         251   7e-78    
ref|NP_001289637.1|  MADS-box protein JOINTLESS                         251   1e-77    
emb|CBI38273.3|  unnamed protein product                                250   1e-77    
ref|XP_009783886.1|  PREDICTED: MADS-box protein JOINTLESS-like         250   2e-77    
gb|AHW58026.1|  SVP-1                                                   249   4e-77    
emb|CDP01559.1|  unnamed protein product                                249   4e-77    
ref|XP_011021843.1|  PREDICTED: MADS-box protein SVP                    248   1e-76    
ref|XP_002310310.1|  SHORT VEGETATIVE PHASE family protein              248   1e-76    Populus trichocarpa [western balsam poplar]
ref|XP_009623750.1|  PREDICTED: MADS-box protein JOINTLESS              248   2e-76    
emb|CAN68106.1|  hypothetical protein VITISV_009637                     246   4e-76    Vitis vinifera
ref|XP_002878622.1|  short vegetative phase protein                     247   5e-76    
ref|XP_008440538.1|  PREDICTED: MADS-box protein SVP-like isoform X1    246   5e-76    
ref|XP_004143442.1|  PREDICTED: MADS-box protein SVP-like               246   6e-76    
gb|ACV74250.1|  EXTRAPETALS                                             246   9e-76    
ref|XP_011099987.1|  PREDICTED: MADS-box protein SVP-like               244   3e-75    
gb|AFI49342.1|  jointless                                               244   5e-75    
ref|XP_010417014.1|  PREDICTED: MADS-box protein SVP isoform X2         244   6e-75    
emb|CAG27846.1|  incomposita protein                                    243   7e-75    Antirrhinum majus [garden snapdragon]
emb|CAL36572.1|  incomposita homologue                                  243   1e-74    Misopates orontium
ref|XP_010429177.1|  PREDICTED: MADS-box protein SVP-like isoform X2    243   1e-74    
ref|XP_010417013.1|  PREDICTED: MADS-box protein SVP isoform X1         243   2e-74    
gb|AFC96914.1|  SVP-like MADS-box protein                               242   3e-74    
gb|AIY25020.1|  short vegetative phase 1                                242   3e-74    
ref|XP_010526675.1|  PREDICTED: MADS-box protein SVP-like               242   4e-74    
ref|XP_006294892.1|  hypothetical protein CARUB_v10023941mg             242   4e-74    
ref|XP_010429176.1|  PREDICTED: MADS-box protein SVP-like isoform X1    242   5e-74    
ref|XP_009364259.1|  PREDICTED: MADS-box protein JOINTLESS-like         241   6e-74    
ref|XP_010646795.1|  PREDICTED: LOW QUALITY PROTEIN: MADS-box pro...    242   7e-74    
gb|KDP29759.1|  hypothetical protein JCGZ_18694                         240   1e-73    
ref|XP_003517407.1|  PREDICTED: MADS-box protein SVP-like isoform X1    239   3e-73    
ref|XP_006294891.1|  hypothetical protein CARUB_v10023941mg             239   4e-73    
ref|XP_004152597.1|  PREDICTED: MADS-box protein SVP-like               239   6e-73    
ref|XP_008444930.1|  PREDICTED: MADS-box protein SVP isoform X1         238   1e-72    
gb|AAF22455.1|  MADS box protein                                        238   1e-72    Paulownia kawakamii
ref|XP_010472243.1|  PREDICTED: MADS-box protein SVP-like               238   2e-72    
ref|XP_008363740.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    237   2e-72    
gb|AAK27150.1|  MADS box transcription factor                           237   3e-72    Ipomoea batatas [batate]
ref|XP_006353175.1|  PREDICTED: MADS-box protein JOINTLESS-like         237   3e-72    
ref|XP_006404717.1|  hypothetical protein EUTSA_v10000308mg             237   3e-72    
ref|NP_001280915.1|  MADS-box protein JOINTLESS                         236   3e-72    
ref|XP_009345716.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    236   4e-72    
ref|XP_011097479.1|  PREDICTED: MADS-box protein JOINTLESS              236   5e-72    
ref|XP_007047796.1|  K-box region and MADS-box transcription fact...    236   8e-72    
ref|NP_179840.2|  MADS-box protein SVP                                  236   8e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520750.1|  PREDICTED: MADS-box protein AGL24-like isofo...    235   1e-71    
gb|AFM77908.1|  MADS-box protein SVP                                    236   1e-71    
gb|KFK32803.1|  mads-box protein svp                                    234   3e-71    
gb|AFM77909.1|  MADS-box protein SVP                                    234   4e-71    
gb|AFU85632.1|  short vegetative phase                                  234   4e-71    
ref|XP_004288518.1|  PREDICTED: MADS-box protein JOINTLESS-like         233   6e-71    
ref|XP_008235579.1|  PREDICTED: MADS-box protein SVP                    233   8e-71    
dbj|BAE98676.1|  short vegegative phase protein                         233   1e-70    Arabidopsis thaliana [mouse-ear cress]
gb|AGR42634.1|  MADS1                                                   233   1e-70    
dbj|BAD43004.1|  short vegegative phase protein (SVP)                   233   1e-70    Arabidopsis thaliana [mouse-ear cress]
gb|AFM77910.1|  MADS-box protein SVP                                    233   1e-70    
gb|AFA37963.1|  SVP1                                                    232   2e-70    
ref|XP_007158373.1|  hypothetical protein PHAVU_002G147600g             232   2e-70    
ref|XP_009140365.1|  PREDICTED: MADS-box protein SVP-like               232   2e-70    
ref|XP_009112514.1|  PREDICTED: MADS-box protein SVP                    232   3e-70    
ref|XP_008363737.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    231   3e-70    
ref|NP_001240951.1|  MADS-box protein SVP-like                          231   3e-70    
emb|CDX89487.1|  BnaC04g35060D                                          232   3e-70    
gb|AHY82603.1|  short vegetative phase protein                          232   4e-70    
ref|XP_006574407.1|  PREDICTED: MADS-box protein SVP-like isoform X1    231   4e-70    
ref|XP_009345714.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    231   4e-70    
gb|AFM77907.1|  MADS-box protein SVP                                    231   4e-70    
ref|XP_004250145.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    231   5e-70    
gb|AFK36521.1|  unknown                                                 231   6e-70    
gb|AAQ55452.1|  short vegetative phase protein                          231   8e-70    Brassica rapa
gb|AFM77906.1|  MADS-box protein SVP                                    231   8e-70    
ref|XP_010520749.1|  PREDICTED: MADS-box protein AGL24-like isofo...    231   8e-70    
ref|XP_007205845.1|  hypothetical protein PRUPE_ppa011063mg             230   9e-70    
ref|XP_002867660.1|  hypothetical protein ARALYDRAFT_492389             230   1e-69    
gb|EYU30938.1|  hypothetical protein MIMGU_mgv1a021820mg                230   1e-69    
gb|AFA37967.1|  SVP1                                                    229   2e-69    
ref|XP_009631749.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    229   2e-69    
gb|AFG73587.1|  short vegetative phase protein                          230   2e-69    
gb|AAQ55451.1|  short vegetative phase protein                          229   6e-69    Brassica rapa
ref|NP_194185.1|  MADS-box protein AGL24                                228   9e-69    Arabidopsis thaliana [mouse-ear cress]
gb|AFM77897.1|  MADS-box protein AGL24                                  228   9e-69    
gb|AFM77905.1|  MADS-box protein SVP                                    228   9e-69    
ref|XP_006573007.1|  PREDICTED: MADS-box protein SVP-like isoform X3    227   1e-68    
emb|CDY13746.1|  BnaA09g42480D                                          228   1e-68    
ref|XP_006282462.1|  hypothetical protein CARUB_v10005653mg             227   2e-68    
emb|CDX76906.1|  BnaC08g34920D                                          227   2e-68    
ref|XP_006413417.1|  hypothetical protein EUTSA_v10026757mg             226   2e-68    
ref|XP_010448551.1|  PREDICTED: MADS-box protein AGL24-like isofo...    226   2e-68    
dbj|BAB70736.1|  putative MADS-domain transcription factor MpMADS1      227   2e-68    Magnolia praecocissima
sp|Q9FUY6.1|JOIN_SOLLC  RecName: Full=MADS-box protein JOINTLESS;...    228   3e-68    Solanum lycopersicum
ref|XP_010523348.1|  PREDICTED: MADS-box protein AGL24 isoform X2       226   4e-68    
ref|XP_010439015.1|  PREDICTED: MADS-box protein AGL24 isoform X2       225   6e-68    
ref|XP_009137455.1|  PREDICTED: MADS-box protein AGL24-like isofo...    225   6e-68    
emb|CDY03445.1|  BnaC01g16370D                                          224   1e-67    
gb|EPS73619.1|  hypothetical protein M569_01137                         224   1e-67    
gb|AAF66690.1|AF144623_1  MADS-box transcription factor                 224   2e-67    Canavalia lineata
gb|AFM77900.1|  MADS-box protein AGL24                                  224   2e-67    
gb|AGW23342.1|  MADS box protein MADS40                                 224   2e-67    
gb|AFM77902.1|  MADS-box protein AGL24                                  224   3e-67    
ref|XP_010523346.1|  PREDICTED: MADS-box protein AGL24 isoform X1       224   4e-67    
ref|XP_009137453.1|  PREDICTED: MADS-box protein AGL24-like isofo...    223   5e-67    
gb|AFM77901.1|  MADS-box protein AGL24                                  223   6e-67    
ref|NP_001154528.1|  MADS-box protein SVP                               223   7e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010926365.1|  PREDICTED: MADS-box protein JOINTLESS-like         223   8e-67    
ref|XP_003613086.1|  MADS-box transcription factor                      223   8e-67    
gb|AFM77899.1|  MADS-box protein AGL24                                  222   1e-66    
ref|XP_010448550.1|  PREDICTED: MADS-box protein AGL24-like isofo...    222   1e-66    
ref|XP_010675143.1|  PREDICTED: MADS-box protein JOINTLESS              222   2e-66    
gb|AGW23370.1|  MADS box protein MADS68                                 221   2e-66    
gb|ABQ51117.1|  MPF2-like copy 1                                        220   4e-66    Nolana humifusa
ref|XP_010439014.1|  PREDICTED: MADS-box protein AGL24 isoform X1       221   4e-66    
emb|CDY11019.1|  BnaA03g46780D                                          220   4e-66    
ref|XP_009138200.1|  PREDICTED: MADS-box protein AGL24 isoform X4       221   5e-66    
ref|XP_009138187.1|  PREDICTED: MADS-box protein AGL24 isoform X2       220   6e-66    
gb|ACJ61500.1|  MADS-box short vegitative phase                         219   8e-66    
ref|XP_008440541.1|  PREDICTED: MADS-box protein SVP-like isoform X2    219   1e-65    
ref|XP_006574410.1|  PREDICTED: MADS-box protein SVP-like isoform X4    219   1e-65    
ref|XP_009138194.1|  PREDICTED: MADS-box protein AGL24 isoform X3       219   1e-65    
ref|XP_004515126.1|  PREDICTED: MADS-box protein SVP-like isoform X1    219   2e-65    
ref|XP_009138166.1|  PREDICTED: MADS-box protein AGL24 isoform X1       219   2e-65    
gb|AES98247.2|  MADS-box transcription factor                           219   2e-65    
gb|ABQ51124.1|  MPF2-like                                               217   2e-65    Schizanthus grahamii
gb|ACJ84016.1|  unknown                                                 218   5e-65    Medicago truncatula
ref|XP_006282463.1|  hypothetical protein CARUB_v10005653mg             218   6e-65    
ref|XP_010680338.1|  PREDICTED: MADS-box protein JOINTLESS              218   6e-65    
gb|ABQ51150.1|  MPF2-like copy 1                                        216   9e-65    Tubocapsicum anomalum
gb|AAW66885.1|  MADS box transcription factor                           217   1e-64    Elaeis guineensis
gb|ABQ51118.1|  MPF2-like copy 2                                        215   2e-64    Nolana humifusa
ref|XP_006466301.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    216   3e-64    
ref|XP_006426275.1|  hypothetical protein CICLE_v10026457mg             216   4e-64    
emb|CDX92641.1|  BnaC07g38990D                                          216   5e-64    
gb|ADZ72841.1|  AGAMOUS-like 24-like protein 2                          215   5e-64    
ref|XP_003613054.1|  MADS-box protein SVP                               215   6e-64    
ref|XP_004490446.1|  PREDICTED: MADS-box protein SVP-like isoform X1    214   2e-63    
gb|ABQ51151.1|  MPF2-like copy 1                                        213   2e-63    Withania coagulans [Indian rennet]
gb|AHH28263.1|  MADS-box transcription factor                           214   2e-63    
ref|NP_001239872.1|  uncharacterized protein LOC100776749               214   2e-63    
ref|XP_010942683.1|  PREDICTED: MADS-box protein SVP-like               213   4e-63    
pir||H84613  probable MADS-box protein [imported] - Arabidopsis t...    212   5e-63 
dbj|BAF46766.1|  DNA-binding protein                                    213   5e-63    Ipomoea nil [qian niu]
ref|XP_004509780.1|  PREDICTED: MADS-box protein SVP-like               213   6e-63    
ref|XP_010530248.1|  PREDICTED: MADS-box protein AGL24-like             212   7e-63    
gb|ABQ51110.1|  MPF2-like                                               211   9e-63    Lycium barbarum [goji berry]
ref|XP_010555411.1|  PREDICTED: MADS-box protein SVP-like               212   2e-62    
gb|AHH28298.1|  MADS-box transcription factor                           211   2e-62    
gb|ABQ51101.1|  MPF2-like copy 1                                        210   2e-62    Atropa belladonna [deadly nightshade]
gb|ABQ51147.1|  MPF2-like copy 1                                        210   3e-62    Withania somnifera [ashwagandha]
gb|ABQ51104.1|  MPF2-like copy 4                                        209   3e-62    Atropa belladonna [deadly nightshade]
gb|ABQ51102.1|  MPF2-like copy 2                                        209   3e-62    Atropa belladonna [deadly nightshade]
gb|AIK35209.1|  MADS-box transcription factor protein 1                 210   5e-62    
ref|XP_008444932.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    210   6e-62    
ref|XP_010107287.1|  MADS-box protein JOINTLESS                         209   6e-62    
gb|ABQ51103.1|  MPF2-like copy 3                                        209   6e-62    Atropa belladonna [deadly nightshade]
gb|KCW66637.1|  hypothetical protein EUGRSUZ_F00420                     209   7e-62    
ref|XP_010520751.1|  PREDICTED: MADS-box protein AGL24-like isofo...    209   1e-61    
gb|ACJ09169.1|  SVP-like protein                                        209   1e-61    Citrus trifoliata [hardy orange]
gb|ABQ51140.1|  MPF2-like copy 1                                        207   2e-61    Physalis curassavica
gb|ABQ51145.1|  MPF2-like                                               207   2e-61    Physalis nicandroides
gb|ABQ51130.1|  MPF2-like                                               207   2e-61    Physalis fuscomaculata
gb|ABQ51128.1|  MPF2-like copy 1                                        207   3e-61    Physalis viscosa
ref|XP_009631750.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    208   3e-61    
gb|ABZ89560.1|  MPF2-like protein                                       207   4e-61    Physalis acutifolia
gb|ABZ89558.1|  MPF2-like protein                                       206   6e-61    Physalis longifolia var. subglabrata
gb|ABQ51144.1|  MPF2-like                                               206   7e-61    Physalis alkekengi [Chinese-lantern]
gb|ABZ89559.1|  MPF2-like protein                                       206   1e-60    Physalis longifolia var. subglabrata
gb|AAX47170.1|  SHORT VEGETATIVE PHASE                                  206   1e-60    Pisum sativum [garden pea]
ref|XP_006487503.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    206   2e-60    
gb|ABQ51135.1|  MPF2-like                                               205   2e-60    Physalis lanceifolia
gb|ABQ51123.1|  MPF2-like                                               205   2e-60    Salpiglossis sinuata
gb|ABQ51134.1|  MPF2-like copy 2                                        205   2e-60    Physalis minima [pygmy groundcherry]
gb|ABQ51108.1|  MPF2-like                                               205   2e-60    Iochroma australe
gb|ABQ51127.1|  MPF2-like copy 2                                        205   2e-60    Physalis viscosa
ref|XP_006580977.1|  PREDICTED: uncharacterized protein LOC100776...    206   2e-60    
gb|ABQ51100.1|  MPF2-like                                               204   3e-60    Calibrachoa parviflora [seaside petunia]
gb|ABQ51107.1|  MPF2-like                                               204   4e-60    Dunalia fasciculata
gb|ABQ51143.1|  MPF2-like                                               204   4e-60    Physalis crassifolia
gb|ABQ51138.1|  MPF2-like                                               204   6e-60    Physalis ixocarpa [tomatillo]
gb|AFA37970.1|  SVP4                                                    204   6e-60    
gb|AFA37966.1|  SVP4                                                    204   7e-60    
gb|ABQ51142.1|  MPF2-like                                               204   7e-60    Physalis mexicana
gb|ABQ51109.1|  MPF2-like                                               204   7e-60    Lycianthes biflora [hong si xian]
gb|ABQ51111.1|  MPF2-like                                               203   7e-60    Margaranthus solanaceus
gb|ABQ51137.1|  MPF2-like                                               203   7e-60    Physalis philadelphica [Mexican groundcherry]
gb|ABQ51148.1|  MPF2-like                                               203   7e-60    Physalis aequata
gb|ABJ96360.1|  dam6                                                    205   9e-60    Prunus persica
gb|AAZ17549.1|  MADS10                                                  204   1e-59    Lolium perenne [perennial ryegrass]
gb|AIU94278.1|  DAM6 for dormancy associated MADS-box transcripti...    204   1e-59    
ref|XP_007227562.1|  hypothetical protein PRUPE_ppa010714mg             204   2e-59    
gb|ABQ51098.1|  MPF2-like copy 2                                        202   3e-59    Withania coagulans [Indian rennet]
gb|ABQ51106.1|  MPF2-like                                               201   4e-59    Datura inoxia [downy thornapple]
gb|ABQ51149.1|  MPF2-like copy 2                                        201   5e-59    Tubocapsicum anomalum
gb|ABQ51105.1|  MPF2-like                                               201   7e-59    Capsicum baccatum
gb|AEX92969.1|  MADS box protein 5                                      202   8e-59    
gb|ABQ51141.1|  MPF2-like copy 2                                        201   9e-59    
ref|XP_007136341.1|  hypothetical protein PHAVU_009G037300g             202   9e-59    
ref|XP_010312646.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    201   1e-58    
gb|ABQ51146.1|  MPF2-like copy 2                                        201   1e-58    
ref|XP_006487501.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    201   1e-58    
gb|ABQ51133.1|  MPF2-like copy 1                                        200   1e-58    
emb|CDY34289.1|  BnaA01g13920D                                          214   1e-58    
gb|AIK35210.1|  MADS-box transcription factor protein 2                 201   1e-58    
ref|XP_003631742.2|  PREDICTED: MADS-box protein JOINTLESS-like i...    200   3e-58    
ref|XP_009380237.1|  PREDICTED: MADS-box transcription factor 22-...    200   5e-58    
gb|AHM92094.1|  MADS-box protein 18                                     200   5e-58    
ref|XP_009417612.1|  PREDICTED: MADS-box protein SVP-like               199   6e-58    
ref|XP_009391344.1|  PREDICTED: MADS-box transcription factor 22-...    199   7e-58    
gb|EAY87613.1|  hypothetical protein OsI_09024                          199   8e-58    
gb|AGB05618.1|  DAM3                                                    198   2e-57    
gb|ABQ51114.1|  MPF2-like                                               197   2e-57    
gb|AHC92622.1|  NSVP2                                                   197   2e-57    
gb|ABQ51136.1|  MPF2-like                                               197   3e-57    
gb|ABY60423.1|  dormancy associated MADS-box 2                          197   3e-57    
ref|XP_008237143.1|  PREDICTED: MADS-box protein SVP-like isoform X3    197   3e-57    
gb|ACF80425.1|  unknown                                                 197   3e-57    
ref|XP_006829974.1|  hypothetical protein AMTR_s00127p00060060          197   5e-57    
gb|ABZ89557.1|  MPF2-like protein                                       196   5e-57    
ref|XP_010661294.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    196   7e-57    
ref|XP_004953998.1|  PREDICTED: MADS-box transcription factor 22-...    197   9e-57    
gb|ABQ51121.1|  MPF2-like                                               194   1e-56    
gb|ABQ51119.1|  MPF2-like                                               195   1e-56    
ref|NP_001288317.1|  MADS-box transcription factor 22-like              196   2e-56    
ref|NP_001105148.1|  MADS19                                             196   3e-56    
gb|ACN26076.1|  unknown                                                 195   3e-56    
emb|CAD23409.1|  putative MADS-domain transcription factor              195   3e-56    
emb|CAM59068.1|  MIKC-type MADS-box transcription factor WM22B          195   4e-56    
gb|ABM21529.1|  MADS-box protein 10                                     194   6e-56    
ref|NP_001048193.1|  Os02g0761000                                       194   8e-56    
dbj|BAK00304.1|  predicted protein                                      194   1e-55    
ref|NP_001105154.1|  m26 protein                                        194   1e-55    
ref|XP_010648095.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    193   1e-55    
gb|ABF57916.1|  MADS-box transcription factor TaAGL11                   192   3e-55    
gb|KCW66638.1|  hypothetical protein EUGRSUZ_F00420                     190   3e-55    
ref|XP_010648099.1|  PREDICTED: MADS-box protein AGL24-like isofo...    193   3e-55    
gb|ADL36743.1|  MADS domain class transcription factor                  192   8e-55    
gb|AAV65500.1|  MPP2                                                    191   9e-55    
ref|XP_008353306.1|  PREDICTED: MADS-box protein SVP-like               191   9e-55    
gb|ABQ51112.1|  MPF2-like                                               190   1e-54    
gb|AHC92621.1|  NSVP1                                                   191   1e-54    
emb|CAM59067.1|  MIKC-type MADS-box transcription factor WM22A          191   1e-54    
ref|XP_008237141.1|  PREDICTED: MADS-box protein SVP-like isoform X1    191   1e-54    
ref|XP_006649065.1|  PREDICTED: MADS-box transcription factor 22-...    191   2e-54    
ref|XP_008237142.1|  PREDICTED: MADS-box protein SVP-like isoform X2    190   2e-54    
gb|ACH53559.1|  MADS-box transcription factor MPP2                      190   2e-54    
gb|ABQ51115.1|  MPF2-like                                               190   3e-54    
ref|XP_007042844.1|  MIKC mads-box transcription factor, putative...    189   4e-54    
ref|XP_008651770.1|  PREDICTED: MADS-box transcription factor 47 ...    190   4e-54    
gb|AAV65498.1|  MPF1                                                    189   4e-54    
ref|NP_001280191.1|  MADS-box protein AGL24-like                        190   5e-54    
gb|AAV65499.1|  MPP1                                                    189   6e-54    
gb|ADZ72840.1|  AGAMOUS-like E 24-like protein 1                        188   7e-54    
ref|XP_009802201.1|  PREDICTED: MADS-box protein SVP-like isoform X2    189   1e-53    
gb|ACH53558.1|  MADS-box transcription factor MPF1                      188   1e-53    
ref|XP_008219269.1|  PREDICTED: MADS-box protein AGL24-like             188   2e-53    
ref|XP_009802200.1|  PREDICTED: MADS-box protein SVP-like isoform X1    188   2e-53    
ref|XP_009802202.1|  PREDICTED: MADS-box protein SVP-like isoform X3    187   2e-53    
gb|AHH28332.1|  MADS-box transcription factor                           187   4e-53    
ref|XP_004964865.1|  PREDICTED: MADS-box transcription factor 55-...    187   4e-53    
ref|XP_003523783.1|  PREDICTED: MADS-box protein JOINTLESS-like         187   7e-53    
gb|AHH28264.1|  MADS-box transcription factor                           186   8e-53    
gb|ABQ51122.1|  MPF2-like                                               185   8e-53    
ref|XP_009376231.1|  PREDICTED: MADS-box protein AGL24-like             186   1e-52    
gb|ABK92958.1|  unknown                                                 185   1e-52    
ref|XP_006487504.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    185   1e-52    
ref|XP_008651762.1|  PREDICTED: MADS-box transcription factor 47 ...    186   2e-52    
ref|NP_001280193.1|  MADS-box protein AGL24-like                        186   2e-52    
ref|XP_002301093.2|  hypothetical protein POPTR_0002s10580g             182   3e-52    
gb|AIU94277.1|  DAM5 for dormancy associated MADS-box transcripti...    185   3e-52    
gb|ACG34827.1|  MADS-box transcription factor 47                        184   4e-52    
ref|XP_008782197.1|  PREDICTED: LOW QUALITY PROTEIN: MADS-box pro...    182   6e-52    
ref|XP_002310488.1|  MADS-box transcription factor family protein       184   7e-52    
gb|AGW23640.1|  dormancy-associated MADS-box transcription factor       184   7e-52    
ref|NP_001288323.1|  MADS-box transcription factor 47-like              184   7e-52    
ref|XP_006380343.1|  hypothetical protein POPTR_0007s03260g             184   9e-52    
ref|XP_010229795.1|  PREDICTED: MADS-box transcription factor 47-...    183   1e-51    
gb|KHN08262.1|  MADS-box protein JOINTLESS                              183   1e-51    
gb|ACH86229.1|  MADS box protein                                        183   1e-51    
ref|XP_011043063.1|  PREDICTED: MADS-box protein JOINTLESS-like         183   1e-51    
gb|ABQ51116.1|  MPF2-like                                               182   1e-51    
gb|AHH28268.1|  MADS-box transcription factor                           182   2e-51    
gb|ABJ96361.2|  dam1                                                    183   2e-51    
gb|AHM92095.1|  MADS-box protein 19                                     182   3e-51    
gb|AGW23639.1|  dormancy-associated MADS-box transcription factor       182   3e-51    
ref|XP_009376229.1|  PREDICTED: MADS-box protein AGL24-like             182   3e-51    
gb|KDP40987.1|  hypothetical protein JCGZ_24986                         182   3e-51    
gb|ABQ51113.1|  MPF2-like                                               181   4e-51    
dbj|BAM74183.1|  dormancy-associated MADS-box transcription factor      182   4e-51    
ref|XP_011043061.1|  PREDICTED: MADS-box protein JOINTLESS-like         181   5e-51    
gb|AIY25021.1|  short vegetative phase 2                                181   5e-51    
ref|XP_011023053.1|  PREDICTED: MADS-box protein JOINTLESS-like         181   9e-51    
dbj|BAM74166.1|  dormancy-associated MADS-box transcription factor      181   1e-50    
gb|AGW23365.1|  MADS box protein MADS63                                 180   1e-50    
ref|XP_004501636.1|  PREDICTED: MADS-box protein SVP-like isoform X1    181   2e-50    
ref|XP_004501637.1|  PREDICTED: MADS-box protein SVP-like isoform X2    180   2e-50    
ref|XP_008651772.1|  PREDICTED: MADS-box transcription factor 47 ...    180   2e-50    
gb|ABJ96358.1|  dam4                                                    180   3e-50    
ref|XP_006584957.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    179   3e-50    
ref|XP_006351733.1|  PREDICTED: MADS-box protein SVP                    179   3e-50    
gb|KDP29972.1|  hypothetical protein JCGZ_18739                         179   3e-50    
ref|XP_009376226.1|  PREDICTED: MADS-box protein AGL24-like isofo...    179   4e-50    
ref|XP_010061536.1|  PREDICTED: MADS-box protein SVP-like isoform X2    179   4e-50    
gb|ABQ51126.1|  MPF2-like                                               178   4e-50    
ref|XP_006584956.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    178   5e-50    
gb|AIE58043.1|  MADS10                                                  179   5e-50    
gb|ACH53556.1|  MADS-box transcription factor MADS11                    179   5e-50    
ref|NP_001274754.1|  MADS transcriptional factor                        179   5e-50    
gb|KHN46260.1|  MADS-box protein SVP                                    180   6e-50    
ref|XP_006584958.1|  PREDICTED: MADS-box protein JOINTLESS isofor...    178   7e-50    
emb|CAM59075.1|  MIKC-type MADS-box transcription factor WM28B          178   7e-50    
gb|AAZ17550.1|  MADS14                                                  178   8e-50    
ref|XP_009380238.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    177   8e-50    
ref|XP_007223944.1|  hypothetical protein PRUPE_ppa011123mg             177   1e-49    
ref|XP_004985440.1|  PREDICTED: MADS-box transcription factor 47-...    178   1e-49    
emb|CAM59074.1|  MIKC-type MADS-box transcription factor WM28A          177   2e-49    
gb|AAV65497.1|  MSM1                                                    177   3e-49    
dbj|BAM74184.1|  dormancy-associated MADS-box transcription factor      177   3e-49    
ref|NP_001057149.1|  Os06g0217300                                       176   4e-49    
gb|AFW64371.1|  putative MADS-box transcription factor family pro...    178   5e-49    
ref|NP_001280194.1|  MADS-box protein JOINTLESS-like                    177   6e-49    
ref|XP_008219270.1|  PREDICTED: MADS-box protein JOINTLESS-like         176   6e-49    
dbj|BAI48074.1|  dormancy-associated MADS-box transcription factor      176   7e-49    
ref|XP_007223866.1|  hypothetical protein PRUPE_ppa010822mg             176   8e-49    
gb|ABJ96359.1|  dam5                                                    176   1e-48    
ref|XP_002436710.1|  hypothetical protein SORBIDRAFT_10g007380          175   2e-48    
gb|EEC74650.1|  hypothetical protein OsI_10300                          175   2e-48    
gb|ABF57917.1|  MADS-box transcription factor TaAGL13                   174   2e-48    
ref|XP_004501639.1|  PREDICTED: MADS-box protein SVP-like isoform X4    174   3e-48    
emb|CAD23411.1|  m21                                                    174   3e-48    
emb|CAC29335.1|  MADS box transcription factor                          174   3e-48    
ref|XP_002262889.1|  PREDICTED: MADS-box protein SVP isoform X2         172   5e-48    
ref|XP_008219275.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    174   5e-48    
gb|AAQ23142.1|  transcription factor MADS47                             174   5e-48    
gb|ACG36350.1|  MADS-box transcription factor 22                        174   5e-48    
ref|XP_008237144.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    173   6e-48    
ref|XP_010661297.1|  PREDICTED: MADS-box protein SVP isoform X3         171   7e-48    
ref|XP_006655913.1|  PREDICTED: MADS-box transcription factor 55-...    173   8e-48    
ref|XP_004985436.1|  PREDICTED: MADS-box transcription factor 47-...    173   9e-48    
ref|XP_002514037.1|  mads box protein, putative                         171   9e-48    
ref|XP_010061535.1|  PREDICTED: MADS-box protein SVP-like isoform X1    173   9e-48    
gb|ABJ96366.1|  dam5                                                    173   9e-48    
ref|NP_001049203.2|  Os03g0186600                                       174   9e-48    
emb|CAB97350.1|  MADS-box protein 1-2                                   173   1e-47    
gb|ABB13345.1|  MADS box protein VRT-2                                  172   1e-47    
ref|XP_010061538.1|  PREDICTED: MADS-box protein SVP-like isoform X4    172   1e-47    
ref|XP_008237145.1|  PREDICTED: MADS-box protein SVP-like isoform X5    172   1e-47    
gb|ABF57936.1|  MADS-box transcription factor TaAGL36                   172   2e-47    
gb|EEC80232.1|  hypothetical protein OsI_22169                          172   2e-47    
emb|CAM59070.1|  MIKC-type MADS-box transcription factor WM24B          172   3e-47    
ref|XP_004230624.1|  PREDICTED: MADS-box protein SVP                    171   3e-47    
emb|CAB97349.1|  MADS box protein 1                                     172   3e-47    
emb|CAM59069.1|  MIKC-type MADS-box transcription factor WM24A          171   4e-47    
ref|XP_003528394.2|  PREDICTED: MADS-box protein SVP-like isoform X1    171   4e-47    
gb|ABQ51125.1|  MPF2-like                                               169   5e-47    
ref|XP_010648133.1|  PREDICTED: MADS-box protein SVP-like isoform X2    169   6e-47    
ref|NP_001280197.1|  MADS-box protein JOINTLESS-like                    171   9e-47    
gb|AAK21256.1|AF335243_1  MADS-box transcription factor FBP25           170   9e-47    
sp|Q5K4R0.2|MAD47_ORYSJ  RecName: Full=MADS-box transcription fac...    171   1e-46    
gb|AAC84133.1|  MADS box protein                                        167   1e-46    
ref|XP_004299728.1|  PREDICTED: MADS-box protein SVP-like               170   1e-46    
gb|ABF94360.1|  SHORT VEGETATIVE PHASE protein, putative, expressed     171   2e-46    
ref|XP_008455140.1|  PREDICTED: MADS-box protein SVP-like isoform X1    169   2e-46    
gb|AAY43789.1|  MADS box protein VRT-2                                  169   2e-46    
ref|XP_006433830.1|  hypothetical protein CICLE_v10002707mg             167   2e-46    
ref|XP_008365219.1|  PREDICTED: MADS-box protein JOINTLESS-like         169   2e-46    
ref|XP_011087945.1|  PREDICTED: MADS-box protein SVP-like isoform X1    169   2e-46    
ref|XP_004136891.1|  PREDICTED: MADS-box protein SVP-like               169   2e-46    
gb|AGA01527.1|  SVP-like protein                                        169   3e-46    
gb|ADR51708.1|  MADS box protein VRT-2                                  168   4e-46    
ref|XP_008219274.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    169   5e-46    
gb|ABW82562.1|  MADS1                                                   168   6e-46    
gb|AGW23341.1|  MADS box protein MADS39                                 167   9e-46    
ref|XP_008219271.1|  PREDICTED: MADS-box protein JOINTLESS-like         168   1e-45    
emb|CDO97392.1|  unnamed protein product                                169   1e-45    
gb|AHW58043.1|  SVP-3                                                   168   1e-45    
ref|XP_008219272.1|  PREDICTED: MADS-box protein AGL24-like             167   2e-45    
gb|AEJ76850.1|  MADS29                                                  167   2e-45    
ref|XP_009624656.1|  PREDICTED: MADS-box protein SVP-like               166   2e-45    
ref|XP_011023057.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    166   2e-45    
ref|XP_010061537.1|  PREDICTED: MADS-box protein SVP-like isoform X3    166   3e-45    
gb|EYU18428.1|  hypothetical protein MIMGU_mgv1a013294mg                166   3e-45    
gb|ABL11476.1|  MADS10 protein                                          166   4e-45    
ref|XP_010107679.1|  MADS-box protein SVP                               167   5e-45    
ref|XP_008341077.1|  PREDICTED: MADS-box protein AGL24-like isofo...    166   5e-45    
ref|XP_008659116.1|  PREDICTED: LOW QUALITY PROTEIN: MADS-box tra...    165   7e-45    
ref|XP_002306534.2|  hypothetical protein POPTR_0005s17950g             164   9e-45    
gb|KCW68497.1|  hypothetical protein EUGRSUZ_F02145                     165   9e-45    
sp|Q69TG5.2|MAD55_ORYSJ  RecName: Full=MADS-box transcription fac...    165   1e-44    
gb|ABJ96364.1|  dam3                                                    165   1e-44    
gb|KCW68496.1|  hypothetical protein EUGRSUZ_F02145                     165   1e-44    
ref|XP_007042845.1|  MIKC mads-box transcription factor, putative...    164   3e-44    
ref|XP_010061534.1|  PREDICTED: MADS-box protein JOINTLESS-like         162   3e-44    
gb|ADK55060.1|  VRT2                                                    164   3e-44    
ref|XP_010690400.1|  PREDICTED: MADS-box protein AGL24-like             164   3e-44    
gb|ABR18588.1|  MPF1-like protein                                       162   3e-44    
ref|XP_007223848.1|  hypothetical protein PRUPE_ppa010758mg             164   4e-44    
emb|CAD48304.1|  MADS-box protein SVP-a                                 162   4e-44    
ref|XP_011087946.1|  PREDICTED: MADS-box protein SVP-like isoform X2    162   6e-44    
ref|NP_001280195.1|  MADS-box protein JOINTLESS-like                    163   7e-44    
ref|XP_008378580.1|  PREDICTED: MADS-box protein JOINTLESS-like         162   8e-44    
ref|XP_006583776.1|  PREDICTED: MADS-box protein SVP-like isoform X2    162   9e-44    
ref|XP_011023054.1|  PREDICTED: MADS-box protein JOINTLESS-like         163   9e-44    
gb|ACJ83294.1|  unknown                                                 159   1e-43    
gb|AIU94275.1|  DAM3 for dormancy associated MADS-box transcripti...    163   1e-43    
ref|XP_009376227.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    162   1e-43    
ref|XP_010227855.1|  PREDICTED: MADS-box transcription factor 55 ...    162   1e-43    
ref|XP_008341076.1|  PREDICTED: MADS-box protein AGL24-like isofo...    162   1e-43    
ref|XP_010229445.1|  PREDICTED: MADS-box transcription factor 47-...    163   1e-43    
ref|XP_010228829.1|  PREDICTED: MADS-box transcription factor 47-...    163   2e-43    
gb|ABJ96370.1|  dam2                                                    162   2e-43    
ref|XP_011023055.1|  PREDICTED: MADS-box protein SVP-like isoform X1    163   2e-43    
ref|XP_008455141.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    161   2e-43    
gb|AFK42723.1|  unknown                                                 158   3e-43    
gb|AGW23358.1|  MADS box protein MADS56                                 160   4e-43    
gb|ABJ96363.1|  dam2                                                    160   6e-43    
ref|XP_006597363.1|  PREDICTED: MADS-box protein JOINTLESS-like i...    159   6e-43    



>gb|AAK27151.1| MADS box transcription factor [Ipomoea batatas]
 dbj|BAC15562.1| IbMADS4 [Ipomoea batatas]
Length=229

 Score =   372 bits (954),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 215/229 (94%), Positives = 221/229 (97%), Gaps = 1/229 (0%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALI+FSATGKLFEFASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIVFSATGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            NMKDILGKY+LHSSNLDQ  QPS ELQLENSLH+RLSKEVADKT ELRQMKGEELQGLSL
Sbjct  61   NMKDILGKYELHSSNLDQATQPSRELQLENSLHVRLSKEVADKTRELRQMKGEELQGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQKLEK+LENGLTRVLETKGERVVTEIATLQRKGAELM ENKQLK+KMAR+NGEKFPV
Sbjct  121  EELQKLEKRLENGLTRVLETKGERVVTEIATLQRKGAELMKENKQLKEKMARVNGEKFPV  180

Query  758  IADVE-AGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            IADVE AGLIPEEG SSESITTNVCSCNSGP PEDDCSDTSLKLGLPIN
Sbjct  181  IADVEAAGLIPEEGQSSESITTNVCSCNSGPPPEDDCSDTSLKLGLPIN  229



>gb|ADU56833.1| MADS-box protein STMADS11 subfamily [Coffea arabica]
 gb|AHW58042.1| SVP-2 [Coffea arabica]
 emb|CDP11501.1| unnamed protein product [Coffea canephora]
Length=227

 Score =   315 bits (807),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 185/228 (81%), Positives = 203/228 (89%), Gaps = 1/228 (0%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M DILGKYKLHSSNL++  QPSLELQLENS H+RLSKEVAD+TH+LRQMKGE+LQGL +
Sbjct  61   SMSDILGKYKLHSSNLEKTEQPSLELQLENSCHVRLSKEVADRTHQLRQMKGEDLQGLKI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ+LEK LE GLTRVL+TKGER++ EI  LQ+KGAEL  ENKQLKQKMA +   K PV
Sbjct  121  EELQQLEKVLEAGLTRVLQTKGERIMNEINALQKKGAELFEENKQLKQKMAMLYEGKRPV  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            I D++  ++ EEG SSESI TNVCSCNSGP PEDDCSDTSLKLGLP N
Sbjct  181  IPDLDKDMLIEEGQSSESI-TNVCSCNSGPPPEDDCSDTSLKLGLPFN  227



>ref|XP_011016930.1| PREDICTED: MADS-box protein JOINTLESS [Populus euphratica]
Length=225

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 201/227 (89%), Gaps = 2/227 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGLFKKAEEL+VLCDA+VA+IIFSATGKLFE++SS
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVAVIIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKD+L +Y LHS+NLD++NQPSLELQLENS HMRLSKE+++K+H+LR+M+GE+LQGL++
Sbjct  61   SMKDVLARYNLHSNNLDKINQPSLELQLENSNHMRLSKEISEKSHQLRRMRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ+LEK LE GL+RVLETKGER++ EI TL+RKG +L+ ENKQLKQK+A I   K P 
Sbjct  121  EELQQLEKALEVGLSRVLETKGERIMNEITTLERKGVQLLEENKQLKQKIATICKGKRPA  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
            + D++   + EEG SSES TTNVCSC+SGP  EDD SDTSLKLGL I
Sbjct  181  LVDLDTA-VQEEGMSSES-TTNVCSCSSGPPVEDDSSDTSLKLGLAI  225



>gb|AAR92206.1| MADS box transcription factor [Populus tomentosa]
Length=225

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 201/227 (89%), Gaps = 2/227 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGLFKKAEEL+VLCDA+VA+IIFSATGKLFE++SS
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVAVIIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MK +L +Y LHS+NLD++NQPSLELQLENS HMRLSKEV++K+H+LR+M+GE+LQGL++
Sbjct  61   SMKGVLARYNLHSNNLDKINQPSLELQLENSNHMRLSKEVSEKSHQLRRMRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ+LEK LE GL+RVLETKGER++ EI+TL+RKG +L+ ENKQLKQK+A I   K P 
Sbjct  121  EELQQLEKALEVGLSRVLETKGERIMNEISTLERKGVQLLEENKQLKQKIATITRGKRPA  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
            + D++   + EEG SSES TTNVCSC+SGP  EDD SDTSLKLGL I
Sbjct  181  LVDLDTA-VQEEGMSSES-TTNVCSCSSGPPVEDDSSDTSLKLGLAI  225



>emb|CAX11663.1| MADS domain MPF2-like transcription factor [Withania somnifera]
 emb|CAX11667.1| MADS domain MPF2-like transcription factor [Withania somnifera]
Length=249

 Score =   296 bits (757),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 196/226 (87%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKI+KIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVA+IIFSATGKLFE+ASS
Sbjct  1    MAREKIKIQKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVAIIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M+DILGKYKL S+NL++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSL
Sbjct  61   SMRDILGKYKLQSANLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EI  LQRKGAELM E KQL QKM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGARIMDEITKLQRKGAELMEEKKQLNQKMEMLKEGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  ++ EEG SSESI  T NVCS NSGP PEDDCS+ SLKLG
Sbjct  181  VIDMDC-MVMEEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKLG  225



>emb|CAX84150.1| MPF2-like [Physalis alkekengi]
Length=249

 Score =   293 bits (750),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 197/226 (87%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKI+KIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGK+F+FASS
Sbjct  1    MAREKIKIRKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKVFDFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M DILGKYKL S+NL++V+QPSL+LQLENSL++RLSK+VADKT ELRQMKGEEL+GLSL
Sbjct  61   SMMDILGKYKLQSANLEKVDQPSLDLQLENSLNVRLSKQVADKTRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVL+ KG R++ EIA LQRKGAELM ENKQLKQKM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLDIKGTRIMDEIAKLQRKGAELMEENKQLKQKMEMMKAGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  ++ EEG SS+SI  T NVCS NSGP PEDDCS+  LKLG
Sbjct  181  LIDMDC-MVMEEGQSSDSIITTNNVCSSNSGPPPEDDCSNAYLKLG  225



>ref|XP_007018219.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOY15444.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=227

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/228 (71%), Positives = 201/228 (88%), Gaps = 2/228 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKI+KIDN+TARQVTFSKRRRGLFKKAEEL+VLCDA+VALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIRKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M+DILG+Y +HS+NL++++QPSLELQLENS H+RLSKE + K+H+LRQM+GE+LQGL++
Sbjct  61   SMRDILGRYNVHSNNLNKLDQPSLELQLENSNHIRLSKEFSVKSHQLRQMRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            +ELQ+LEK LE GLTRVLETKGER+ +EI+ L+RKG +L+ ENKQLKQKM  +   K P+
Sbjct  121  DELQQLEKMLEAGLTRVLETKGERISSEISALERKGVQLLEENKQLKQKMVTLCKGKRPI  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            +A+ +A  + EEG SSES+ TNV SC+SGP  EDD SDTSLKLGLP +
Sbjct  181  LAESDAA-VQEEGMSSESV-TNVYSCSSGPPLEDDSSDTSLKLGLPFS  226



>dbj|BAN89455.1| short vegetative phase [Shorea beccariana]
Length=225

 Score =   287 bits (734),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 201/228 (88%), Gaps = 3/228 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKI+KIDN+TARQVTFSKRRRGLFKKAEEL+VLCDA+VALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIRKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            NMKDIL +Y LHSSN+++++QPSLELQLENS  M LSKEVADK+H+L+QM+GE+LQGLS+
Sbjct  61   NMKDILSRYNLHSSNINKLDQPSLELQLENSNQM-LSKEVADKSHQLKQMRGEDLQGLSI  119

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ+LEK LE+GLTRVLETKGER++ EI+ L++KGAEL+ ENK+LK KM  ++  K P+
Sbjct  120  EELQQLEKMLESGLTRVLETKGERILNEISALEQKGAELLEENKRLKDKMVALSKGKRPL  179

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
             A+ +   + EEG SSES+ TNVCSCNSGP  +DD SDTSLKLGL ++
Sbjct  180  PAESDIA-VQEEGMSSESV-TNVCSCNSGPPVDDDSSDTSLKLGLSLH  225



>emb|CAX11664.1| MADS domain MPF2-like transcription factor [Tubocapsicum anomalum]
 emb|CAX11665.1| MADS domain MPF2-like transcription factor [Tubocapsicum anomalum]
Length=249

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 199/226 (88%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M+DILGKYKL S+NL++V+QPSL+LQLENSL++RLSK+VADKT ELRQM+GEEL+GLSL
Sbjct  61   SMRDILGKYKLQSANLEKVDQPSLDLQLENSLNVRLSKQVADKTRELRQMRGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EI  LQRKGAEL+ ENKQLKQKM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGARIMDEITKLQRKGAELIEENKQLKQKMEMLKEGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  ++ EEG SSESI  T NVCS NSGPLPEDDCS+ SLKLG
Sbjct  181  VTDMDC-MVMEEGQSSESIITTNNVCSNNSGPLPEDDCSNASLKLG  225



>emb|CAX51260.1| MPF2-like-B [Tubocapsicum anomalum]
 emb|CAX51266.1| MPF2-like-B [Withania coagulans]
Length=235

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 189/216 (88%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL++RLSK+VADKT ELRQM+GEEL+GLSLEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNVRLSKQVADKTRELRQMRGEELEGLSLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RVLE KG R++ EI  LQRKGAEL+ ENKQLKQKM  +   K P++ D++  ++ 
Sbjct  121  EAGFNRVLEIKGARIMDEITKLQRKGAELIEENKQLKQKMEMLKEGKLPLVTDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGPLPEDDCS+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSNNSGPLPEDDCSNASLKLG  215



>gb|ADX96027.1| MPF2-like transcription factor [Lycium chinense]
Length=248

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 198/226 (88%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M DILGKYKLHS+ L++V QPSL+LQLENS + RLSKEVADKT E+RQ++GEEL+GLS 
Sbjct  61   SMNDILGKYKLHSAGLEKVEQPSLDLQLENSFNTRLSKEVADKTREMRQIRGEELEGLSF  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE+GL RVLE KG R++ EI+ LQRKGAELM ENKQLK+KMA +N  K P+
Sbjct  121  EELQQIEKRLESGLNRVLEIKGTRIMDEISNLQRKGAELMEENKQLKEKMAIMNEGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + +++  L+ EEG SSESI  T NVCS NSGP PEDDCS+ SLKLG
Sbjct  181  LTEMDC-LVMEEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKLG  225



>gb|AIK35208.1| SVP1 protein [Camellia sinensis]
Length=232

 Score =   283 bits (724),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 172/233 (74%), Positives = 206/233 (88%), Gaps = 6/233 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLF++ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFDYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENS-LHMRLSKEVADKTHELRQMkgeelqgls  574
            +MKDIL KY +H++N ++V+QPSLELQLEN+  H RLSKEV++KT++LRQM+G++LQGL+
Sbjct  61   SMKDILRKYNVHANNSEKVDQPSLELQLENTNNHARLSKEVSEKTNQLRQMRGDDLQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LE+ LE+GL+RVL+TKGER++ EIATLQ KGA+L+ ENKQLK+KM  I+  K+ 
Sbjct  121  IEELQQLERMLESGLSRVLKTKGERIMNEIATLQSKGAQLIEENKQLKRKMTMISKGKWG  180

Query  755  V-IADVEA---GLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            V +A+V A    L+PEEG S ESI TN CSCNS P PEDDCSDTSLKLGLPIN
Sbjct  181  VGVANVGAESDNLVPEEGQSPESI-TNGCSCNSAPPPEDDCSDTSLKLGLPIN  232



>emb|CAX51259.1| MPF2-like-B [Tubocapsicum anomalum]
 emb|CAX51290.1| MPF2-like-B [Withania sp. W011]
Length=235

 Score =   282 bits (722),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 188/216 (87%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++ +QPSL+LQLENSL++RLSK+VADKT ELRQM+GEEL+GLSLEELQ++EK+L
Sbjct  61   LQSANLEKADQPSLDLQLENSLNVRLSKQVADKTRELRQMRGEELEGLSLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RVLE KG R++ EI  LQRKGAEL+ ENKQLKQKM  +   K P++ D++  ++ 
Sbjct  121  EAGFNRVLEIKGARIMDEITKLQRKGAELIEENKQLKQKMEMLKEGKLPLVTDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGPLPEDDCS+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSNNSGPLPEDDCSNASLKLG  215



>emb|CAX51305.1| MPF2-like-B [Withania somnifera]
Length=235

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 188/219 (86%), Gaps = 3/219 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVA+IIFSATGKLFE+ASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVAIIIFSATGKLFEYASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSLEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E GL RVLE KG R++ EI  LQRKGAELM E KQL QKM  +   K P++ D++  ++ 
Sbjct  121  EAGLNRVLEIKGARIMDEITKLQRKGAELMEEKKQLNQKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
            EEG SSESI  T NVCS NSGP PEDDCS+ SLKLG  I
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKLGCNI  218



>gb|AAV65505.1| MPF2 [Physalis pubescens]
 gb|AAV65506.1| MPF2 [Physalis pubescens]
Length=249

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 198/226 (88%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF+F+SS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S+NLD+V+QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSL
Sbjct  61   SMKDILGKYKLQSANLDKVDQPSLDLQLENSLNVRLRKQVADKTRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EIA LQRKGAELM ENK+LKQKM  +   KFP+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGTRIMDEIANLQRKGAELMEENKKLKQKMEMMKLGKFPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  ++ EEG SS+SI  T NVCS NSGP PEDD S+ SLKLG
Sbjct  181  LTDMDC-MVIEEGQSSDSIITTNNVCSSNSGPPPEDDSSNASLKLG  225



>emb|CAX51261.1| MPF2-like-B [Withania aristata]
 emb|CAX51280.1| MPF2-like-B [Withania somnifera]
 emb|CAX51304.1| MPF2-like-B [Withania somnifera]
Length=235

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 187/219 (85%), Gaps = 3/219 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVA+IIFSATGKLFE+ASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVAIIIFSATGKLFEYASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSLEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RVLE KG R++ EI  LQRKGAELM E KQL QKM  +   K P++ D++  ++ 
Sbjct  121  EAGFNRVLEIKGARIMDEITKLQRKGAELMEEKKQLNQKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
            EEG SSESI  T NVCS NSGP PEDDCS+ SLKLG  I
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKLGCNI  218



>emb|CAX51268.1| MPF2-like-B [Withania frutescens]
 emb|CAX51271.1| MPF2-like-B [Withania riebeckii]
 emb|CAX51284.1| MPF2-like-B [Withania somnifera]
 emb|CAX51288.1| MPF2-like-B [Withania sp. W010]
 emb|CAX51291.1| MPF2-like-B [Withania sp. W011]
Length=235

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 186/216 (86%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVA+IIFSATGKLFE+ASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVAIIIFSATGKLFEYASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSLEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RVLE KG R++ EI  LQRKGAELM E KQL QKM  +   K P++ D++  ++ 
Sbjct  121  EAGFNRVLEIKGARIMDEITKLQRKGAELMEEKKQLNQKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGP PEDDCS+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKLG  215



>ref|XP_006472470.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Citrus sinensis]
 ref|XP_006472471.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Citrus sinensis]
Length=226

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 191/226 (85%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKI+KIDNITARQVTFSKRRRGLFKKAEEL+VLCDA+V +IIFSATGKLFE +SS
Sbjct  1    MAREKIKIRKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVGVIIFSATGKLFESSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDI+ +Y +HSSN+ ++N PSLELQLENS H+ LS+E+ADK+ +LRQM+GE+L GL++
Sbjct  61   SMKDIMARYHMHSSNIGKLNHPSLELQLENSKHLSLSREIADKSRQLRQMRGEDLHGLTI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E+LQ LE  LE GL+RVL+TKG+R++ EI+ L+RKGA+L+ ENK LKQK+A +   K  V
Sbjct  121  EQLQHLETMLEQGLSRVLQTKGDRIMNEISALERKGAKLLEENKNLKQKVASLCKGKRVV  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            + D +   I EEG SSES+  NVCSC+SGP PEDD SDTSLKLGLP
Sbjct  181  LVDSDIA-IQEEGMSSESV--NVCSCSSGPPPEDDSSDTSLKLGLP  223



>gb|ABQ51097.1| MPF2-like [Witheringia coccoloboides]
Length=267

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 197/226 (87%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MK+ILGKYKL S+ L++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSL
Sbjct  61   SMKNILGKYKLQSACLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+L+ G  RVLE KG R++ EI  L+RKGAELM ENKQLK KM  +   K P+
Sbjct  121  EELQQIEKRLDAGFNRVLEIKGTRIMDEITNLERKGAELMEENKQLKHKMEMMKEGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D+++ ++ EEG SSESI  T NVCS NSGP PEDDCS+ SLKLG
Sbjct  181  LTDMDS-MVMEEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKLG  225



>emb|CAX51300.1| MPF2-like-B [Withania frutescens]
 emb|CAX51309.1| MPF2-like-B [Withania sp. W009]
Length=235

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 186/216 (86%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GL+LEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLNLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E GL RVLE KG R++ EI  LQRKGAELM E  QLKQKM  +   K P++ D++  ++ 
Sbjct  121  EAGLNRVLEIKGARIMDEITKLQRKGAELMEEKTQLKQKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGP PEDD S+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDSSNASLKLG  215



>emb|CAX51278.1| MPF2-like-B [Withania riebeckii]
Length=235

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 185/216 (86%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVA+IIFSATGKLFE+ASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVAIIIFSATGKLFEYASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLS EELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSFEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RVLE KG R++ EI  LQRKGAELM E KQL QKM  +   K P++ D++  ++ 
Sbjct  121  EAGFNRVLEIKGARIMDEITKLQRKGAELMEEKKQLNQKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGP PEDDCS+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKLG  215



>emb|CAX51279.1| MPF2-like-B [Withania somnifera]
Length=235

 Score =   278 bits (710),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 187/219 (85%), Gaps = 3/219 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVA+IIFSATGKLFE+ASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVAIIIFSATGKLFEYASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL+MRLSK+VAD+T ELRQM+GEEL+GLSLEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNMRLSKQVADETRELRQMRGEELEGLSLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RVLE KG R++ EI  LQRKGAELM E KQL QKM  +   K P++ D++  ++ 
Sbjct  121  EAGFNRVLEIKGARIMDEITKLQRKGAELMEEKKQLNQKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
            EEG SSESI  T NVCS NSGP PEDDCS+ SLKLG  I
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKLGCNI  218



>emb|CAX84147.1| MPF2-like [Iochroma australe]
Length=248

 Score =   278 bits (710),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 195/226 (86%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S++ ++V+QPSL+LQLENSL+MRLSK+VADKT EL+QM+GE+L+GLSL
Sbjct  61   SMKDILGKYKLQSASFEKVDQPSLDLQLENSLNMRLSKQVADKTRELKQMRGEDLEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EI  LQRKGAELM ENKQLK KM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGARIMDEITNLQRKGAELMEENKQLKHKMEMMKEGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  ++ EEG SSESI  T NVCS NSGP PEDD S+ SLKLG
Sbjct  181  VTDMDC-MVMEEGQSSESIITTNNVCSSNSGPPPEDDSSNASLKLG  225



>emb|CAX51295.1| MPF2-like-A [Withania somnifera]
Length=235

 Score =   277 bits (709),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 186/216 (86%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAE+L+VLCDADVA+IIFSATGKLFE+ASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEKLSVLCDADVAIIIFSATGKLFEYASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSLEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RVLE KG R++ EI  LQRKGAELM E KQL QKM  +   K P++ D++  ++ 
Sbjct  121  EAGFNRVLEIKGARIMDEITKLQRKGAELMEEKKQLNQKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGP PEDDCS+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKLG  215



>gb|ABQ51131.1| MPF2-like [Physalis pubescens]
Length=249

 Score =   278 bits (710),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 197/226 (87%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF+F+SS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S+NLD+V+QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSL
Sbjct  61   SMKDILGKYKLQSANLDKVDQPSLDLQLENSLNVRLRKQVADKTRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EIA LQRKGAELM ENK+LK KM  +   KFP+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGTRIMDEIANLQRKGAELMEENKKLKHKMEMMKLGKFPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  ++ EEG SS+SI  T NVCS NSGP PEDD S+ SLKLG
Sbjct  181  LTDMDC-MVMEEGQSSDSIITTNNVCSSNSGPPPEDDSSNASLKLG  225



>gb|AIA58526.1| SVP-like MADS-box protein [Carya cathayensis]
Length=227

 Score =   277 bits (708),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 196/229 (86%), Gaps = 5/229 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGL KKAEEL+VLCDA+VALIIFSATGKLFEF+SS
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLLKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDIL +Y L S+ + Q++QPSLELQLEN+ H+RLSKEVADKTH+LRQ +GE+L+GL+L
Sbjct  61   SMKDILERYNLQSNGIKQMDQPSLELQLENNNHIRLSKEVADKTHQLRQTRGEDLEGLNL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ+LEK LE GL+RVLETK ER++TEI TL+RKGA+L+ EN+QLKQKM   +  K PV
Sbjct  121  EELQQLEKMLEAGLSRVLETKEERLLTEITTLERKGAQLLEENRQLKQKMVMSSKGKRPV  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLP--EDDCSDTSLKLGLPI  898
            + + +  L+ EEG SSES+ TNVCS + GP P  EDD SDTSLKLGL +
Sbjct  181  LVESDV-LVQEEGMSSESV-TNVCSSSGGP-PSLEDDSSDTSLKLGLSL  226



>gb|AFA37965.1| SVP3 [Actinidia deliciosa]
Length=230

 Score =   277 bits (708),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 197/231 (85%), Gaps = 5/231 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDA+VALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDAEVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M DI+GKY LH++N++Q++QPSL LQLE+S  ++L K+V++KT +LRQM+GE+LQGL++
Sbjct  61   SMSDIIGKYSLHTNNIEQIDQPSLALQLEDSNLVKLGKDVSEKTTQLRQMRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
             ELQ LEK LE GL+RVLETKGER++ EIATLQRKGAEL+ EN++LKQKM  I+  K+ V
Sbjct  121  NELQHLEKMLEAGLSRVLETKGERIMNEIATLQRKGAELVEENQRLKQKMNAISEGKWAV  180

Query  758  IADVEAGL----IPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
               V A L      E+G SSES+ TNVCSCNS P PEDDCSDTSLKLGLP 
Sbjct  181  TGVVGAELDNVVAEEQGQSSESV-TNVCSCNSAPPPEDDCSDTSLKLGLPF  230



>emb|CAX51297.1| MPF2-like-A [Withania frutescens]
Length=232

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 184/216 (85%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDN+TARQVTFSKRRRG+FKKAEEL+VLCDADVALIIFSATGKLFEFASS+M+DILGKYK
Sbjct  1    IDNVTARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEFASSSMEDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL+MRLSK+VADKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNMRLSKQVADKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E KG R++ EIA LQRKGAELM ENKQLK+KM      K P + D    ++ 
Sbjct  121  EAGFNRVVEIKGRRIMDEIANLQRKGAELMEENKQLKEKMEMAKVGKLPFLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T NVCS NSG LPEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNVCSSNSGGLPEDDCSNVSLKLG  212



>gb|ABQ51132.1| MPF2-like [Physalis pruinosa]
Length=249

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 196/226 (87%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF+F+SS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S+NLD+V+QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSL
Sbjct  61   SMKDILGKYKLQSANLDKVDQPSLDLQLENSLNVRLRKQVADKTRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E LQ++EK+LE G  RVLE KG R++ EIA LQRKGAELM ENK+LK KM  +   KFP+
Sbjct  121  ERLQQIEKRLEAGFNRVLEIKGTRIMDEIANLQRKGAELMEENKKLKHKMEMMKLGKFPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  ++ EEG SS+SI  T NVCS NSGP PEDD S+ SLKLG
Sbjct  181  LTDMDC-MVMEEGQSSDSIITTNNVCSSNSGPPPEDDSSNASLKLG  225



>emb|CAX51296.1| MPF2-like-B [Withania somnifera]
Length=235

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 187/216 (87%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVA+IIFSATGKLFE+ASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVAIIIFSATGKLFEYASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QP L+LQLENSL++RLSK+VADKT ELRQM+GEEL+GLSLEELQ++EK+L
Sbjct  61   LQSANLEKVDQPFLDLQLENSLNVRLSKQVADKTRELRQMRGEELEGLSLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RVLE KG R++ EI  LQRKGAEL+ ENKQLKQKM  +   K P++ D++  ++ 
Sbjct  121  EAGFNRVLEIKGARIMDEITKLQRKGAELIEENKQLKQKMEMLKEGKLPLVTDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGPLP DDCS+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSNNSGPLPVDDCSNASLKLG  215



>emb|CAX51287.1| MPF2-like-B [Withania sp. W010]
Length=235

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 186/216 (86%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GL+LEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLNLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E GL RVLE KG R++ EI  LQRKGAELM +  QLKQKM  +   K P++ D++  ++ 
Sbjct  121  EAGLNRVLEIKGARIMDEITKLQRKGAELMEKKTQLKQKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGP PEDD S+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDSSNASLKLG  215



>ref|XP_009627164.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Nicotiana tomentosiformis]
Length=226

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 169/229 (74%), Positives = 200/229 (87%), Gaps = 4/229 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKA EL+VLCDA+VALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAAELSVLCDAEVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M+DILGKYKLHSS+L++ +QPSL+LQLENSL+M+L KE+ADK  ELRQMKGEEL+GLSL
Sbjct  61   SMEDILGKYKLHSSSLEKDDQPSLDLQLENSLNMKLIKELADKNRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E+LQ++EK+LE GLT VLE KG +++ EI  LQRKGAELM ENKQLKQKMA +N  K P+
Sbjct  121  EKLQQIEKRLEAGLTHVLEIKGTKIMDEITKLQRKGAELMEENKQLKQKMAMMNEGKLPL  180

Query  758  IADVEAGLIPEEGHSSE-SITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            + D++  ++ EEG SS+ SITTNV +  SGP PEDDCS+ SLKLGLP N
Sbjct  181  LTDLDC-MVMEEGQSSDQSITTNVST--SGPPPEDDCSNASLKLGLPFN  226



>emb|CAX84149.1| MPF2-like [Margaranthus solanaceus]
Length=249

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 169/226 (75%), Positives = 197/226 (87%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF+F+SS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S+NLD+V+QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSL
Sbjct  61   SMKDILGKYKLQSANLDKVDQPSLDLQLENSLNVRLRKQVADKTRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EIA LQRKGAELM ENK+LKQKM  +   KFP+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGTRIMDEIANLQRKGAELMEENKKLKQKMEMMKLGKFPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D+E  ++ EEG SS+SI  T NV + NSGP PEDD S+ SLKLG
Sbjct  181  LTDMEC-MVMEEGQSSDSIITTNNVSTSNSGPPPEDDSSNASLKLG  225



>ref|XP_002285687.1| PREDICTED: MADS-box protein SVP [Vitis vinifera]
 ref|XP_010664403.1| PREDICTED: MADS-box protein SVP [Vitis vinifera]
 emb|CBI19262.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 197/229 (86%), Gaps = 4/229 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKI+KIDN++ARQVTFSKRRRGLFKKAEEL+VLCDA+VALIIFS+TGKLF+++SS
Sbjct  1    MAREKIKIRKIDNVSARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSSTGKLFDYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILG+Y +HS+NL+++  PSLELQLENS H+RLSKE+ADK+H+LRQM+GE++QGL++
Sbjct  61   SMKDILGRYTMHSNNLEKLEGPSLELQLENSNHVRLSKEIADKSHQLRQMRGEDIQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI-NGEKFP  754
            EEL KLEK LE GL+RVL++K +R++TEIATLQ KGA+LM EN +L+QKM  I  G++  
Sbjct  121  EELLKLEKMLEAGLSRVLKSKSDRIMTEIATLQTKGAQLMEENNKLRQKMEIICKGKRLM  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
             +      +I EEG SSESI TNV SC+SGP  EDD SDTSLKLGLP +
Sbjct  181  TMES--DNMILEEGQSSESI-TNVYSCSSGPPQEDDSSDTSLKLGLPFS  226



>emb|CAX84161.1| MPF2-like [Witheringia solanacea]
Length=249

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 195/226 (86%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRG+FKKA EL+VLCDADVALIIFSATGKLFEFASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGIFKKAGELSVLCDADVALIIFSATGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MK+ILGKYKLHS+NL++ +QPSL+LQLENSL++RLSK+VADKT ELRQMKGEEL+GLSL
Sbjct  61   SMKNILGKYKLHSANLEKDDQPSLDLQLENSLNVRLSKQVADKTRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EKKLE G  RVLE KG R + EIA L+RKGAELM ENKQLKQKM  +   K P+
Sbjct  121  EELQQIEKKLEEGFNRVLEIKGTRFMDEIANLKRKGAELMEENKQLKQKMGMMKVGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  +  EEG SS+SI  T N CS NSGP PEDDCS+ SLKLG
Sbjct  181  LTDMDC-MAMEEGQSSDSIITTNNACSSNSGPPPEDDCSNASLKLG  225



>gb|ABQ51096.1| MPF2-like [Witheringia solanacea]
Length=269

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 196/226 (87%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF+FASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MK+ILGKYKLHS+NL++ +QPSL+LQLENSL++RLSK+VADKT ELRQMKGEEL+GLSL
Sbjct  61   SMKNILGKYKLHSANLEKDDQPSLDLQLENSLNVRLSKQVADKTRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EKKLE G  RVLE KG R + EIA L+RKGAELM ENKQLKQKM  +   K P+
Sbjct  121  EELQQIEKKLEEGFNRVLEIKGTRFMDEIANLKRKGAELMEENKQLKQKMGMMKVGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  +  EEG SS+SI  T N CS NSGP PEDDCS+ SLKLG
Sbjct  181  LTDMDC-MAMEEGQSSDSIITTNNACSSNSGPPPEDDCSNASLKLG  225



>emb|CAX84157.1| MPF2-like [Vassobia breviflora]
Length=248

 Score =   275 bits (703),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 171/249 (69%), Positives = 199/249 (80%), Gaps = 22/249 (9%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S++ ++V+QPSL+LQLENSL++RLSK+VADKT EL+QM+GE+L+GLSL
Sbjct  61   SMKDILGKYKLQSASFEKVDQPSLDLQLENSLNVRLSKQVADKTRELKQMRGEDLEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EI  LQRKGAELM ENKQLK KM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGARIMDEITNLQRKGAELMEENKQLKHKMEMMKEGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCS-------------------CNSGPLPEDDCSDT  874
            + D++  ++ EEG SSESI  T NVCS                   CNSGP  EDDCS T
Sbjct  181  VTDMDC-MVVEEGQSSESIITTNNVCSSNSGPPPEDDSSNASLKLCCNSGPAVEDDCSIT  239

Query  875  SLKLGLPIN  901
            SLKLGLP +
Sbjct  240  SLKLGLPFS  248



>emb|CAX51262.1| MPF2-like-B [Withania aristata]
Length=235

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 185/216 (86%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+ PSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSLEELQ++EK+L
Sbjct  61   LQSANLEKVDLPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E GL RVLE KG R++ EI  LQRKGAELM E  QLKQKM  +   K P++ D++  ++ 
Sbjct  121  EAGLNRVLEIKGARIMDEITKLQRKGAELMEEKTQLKQKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGP PEDD S+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDSSNASLKLG  215



>gb|AHI85951.1| AGL24 [Carya cathayensis]
Length=226

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 196/229 (86%), Gaps = 6/229 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGL KKAEEL+VLCDA+VALIIFSATGKLFEF+SS
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLLKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDIL +Y L S+ + Q++QPSLELQLEN+ H+RLSKEVADKTH+LRQ +GE+L+GL+L
Sbjct  61   SMKDILERYNLQSNGIKQMDQPSLELQLENN-HIRLSKEVADKTHQLRQTRGEDLEGLNL  119

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ+LEK LE GL+RVLETK ER++TEI TL+RKGA+L+ EN+QLKQKM   +  K PV
Sbjct  120  EELQQLEKMLEAGLSRVLETKEERLLTEITTLERKGAQLLEENRQLKQKMVMSSKGKRPV  179

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLP--EDDCSDTSLKLGLPI  898
            + + +  L+ EEG SSES+ TNVCS + GP P  EDD SDTSLKLGL +
Sbjct  180  LVESDV-LVQEEGMSSESV-TNVCSSSGGP-PSLEDDSSDTSLKLGLSL  225



>emb|CAX51263.1| MPF2-like-A [Withania aristata]
Length=232

 Score =   274 bits (700),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 183/216 (85%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALIIFSATGKLFEFASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEFASSSMEDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RLSK+VADKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLSKQVADKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E KG R + EIA LQRKGAELM ENKQLK+KM      K P + D    ++ 
Sbjct  121  EAGFNRVVEIKGRRTMDEIANLQRKGAELMEENKQLKEKMEMTKVGKMPFLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T NVCS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNVCSSNSGPPPEDDCSNVSLKLG  212



>gb|ABQ51099.1| MPF2-like [Vassobia breviflora]
Length=267

 Score =   275 bits (703),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 195/226 (86%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S++ ++V+QPSL+LQLENSL++RLSK+VADKT EL+QM+GE+L+GLSL
Sbjct  61   SMKDILGKYKLQSASFEKVDQPSLDLQLENSLNVRLSKQVADKTRELKQMRGEDLEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EI  LQRKGAELM ENKQLK KM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGARIMDEITNLQRKGAELMEENKQLKHKMEMMKEGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  ++ EEG SSESI  T NVCS NSGP PEDD S+ SLKLG
Sbjct  181  VTDMDC-MVVEEGQSSESIITTNNVCSSNSGPPPEDDSSNASLKLG  225



>emb|CAX11666.1| MADS domain MPF2-like transcription factor [Withania somnifera]
 emb|CAX11662.1| MADS domain MPF2-like transcription factor [Withania somnifera]
Length=254

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 193/226 (85%), Gaps = 6/226 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALI+FSATGKLFEFASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIVFSATGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S+NL++V QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSL
Sbjct  61   SMKDILGKYKLQSANLEKVYQPSLDLQLENSLNVRLCKQVADKTRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ+LEK+LE G  RV+E K  R++ EIA LQRKGAELM ENKQLK+KM      K P+
Sbjct  121  EELQQLEKRLEAGFNRVVEIKDRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D    ++ EEG SS+SI  T N+CS NSGP PEDDCS+ SLKLG
Sbjct  181  LTD----MVMEEGQSSDSIITTNNICSSNSGPPPEDDCSNVSLKLG  222



>emb|CAX51299.1| MPF2-like-A [Withania frutescens]
Length=232

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 183/216 (85%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALIIFSATGKLFEFASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEFASSSMEDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL+MRLSK+VADKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNMRLSKQVADKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E KG R++ EIA LQRKGAELM ENKQLK+KM      K P + D    ++ 
Sbjct  121  EAGFNRVVEIKGRRIMDEIANLQRKGAELMEENKQLKEKMEMAKVGKLPFLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T NVCS NSG  PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNVCSSNSGGPPEDDCSNVSLKLG  212



>gb|AAV65502.1| MPP3 [Physalis peruviana]
Length=249

 Score =   273 bits (698),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 196/226 (87%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL++LCDADVALIIFS+TGKLF+F+SS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSILCDADVALIIFSSTGKLFDFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S+NLD+V+QP L+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSL
Sbjct  61   SMKDILGKYKLQSANLDKVDQPFLDLQLENSLNVRLRKQVADKTRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EIA LQRKGAELM ENK+LKQKM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGTRIMDEIANLQRKGAELMEENKKLKQKMEMMKLGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  ++ EEG SS+SI  T NVCS N+GP PEDD S+ SLKLG
Sbjct  181  LTDMDC-MVMEEGQSSDSIITTNNVCSSNTGPPPEDDSSNASLKLG  225



>gb|AAK21250.1|AF335237_1 MADS-box transcription factor FBP13 [Petunia x hybrida]
Length=245

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 169/246 (69%), Positives = 200/246 (81%), Gaps = 19/246 (8%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGL KKA EL+VLCDA+VALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLMKKAAELSVLCDAEVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M+DILGKYK HS++L++ +QPSL+LQLENSL+MRLSKE+ADK  ELRQM+GEEL+GLSL
Sbjct  61   SMEDILGKYKFHSASLEKDDQPSLDLQLENSLNMRLSKEIADKNRELRQMRGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
             ELQK+EKKLE GLTRVL+ KG R++ EI  LQ+KGA+LM ENKQLKQKM  ++  K P+
Sbjct  121  NELQKIEKKLEAGLTRVLQIKGTRIMDEITNLQKKGADLMEENKQLKQKMVIMSEGKLPL  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNS------------------GPLPEDDCSDTSLK  883
             +++E  ++ EEG SSESITT+VCSC+S                  GP  EDDCSDT LK
Sbjct  181  HSELEC-MVMEEGQSSESITTHVCSCSSGPPEDDYSNASLKLGCSNGPTVEDDCSDTFLK  239

Query  884  LGLPIN  901
            LGLP N
Sbjct  240  LGLPFN  245



>emb|CAX51283.1| MPF2-like-B [Withania somnifera]
Length=235

 Score =   272 bits (696),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 184/216 (85%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKAEEL+VLCDADVA+IIFSATGKLFE+ASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAEELSVLCDADVAIIIFSATGKLFEYASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL+MRLSK+ ADK  ELRQM+GEEL+GLSLEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNMRLSKQEADKARELRQMRGEELEGLSLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RVLE KG R++ EI  LQRKGAELM E KQL +KM  +   K P++ D++  ++ 
Sbjct  121  EAGFNRVLEIKGARIMDEITKLQRKGAELMEEKKQLNRKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGP PEDDCS+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKLG  215



>gb|AAV65501.1| MSM2 [Solanum macrocarpon]
 gb|AEV59801.1| msm2 [Solanum macrocarpon]
 gb|AEV89972.1| MSM2 [Solanum macrocarpon]
Length=239

 Score =   272 bits (695),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 171/243 (70%), Positives = 197/243 (81%), Gaps = 19/243 (8%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLF+FAS+
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFDFAST  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S++L++V QPSL+LQLENSL+MRL+KE+ADKT ELRQM+GEEL+GLSL
Sbjct  61   SMKDILGKYKLQSASLEKVEQPSLDLQLENSLNMRLNKEIADKTRELRQMRGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EKKLE G  RVLE K  R++ EI  LQRKGAELM ENKQLKQKM  +   K P+
Sbjct  121  EELQQIEKKLEAGFNRVLEIKSTRIMGEITNLQRKGAELMEENKQLKQKMEIMKKGKLPL  180

Query  758  IADVEAGLIPEEGHSSESITT--NVCSCNSGPLP-------------EDDCSDTSLKLGL  892
            + +    ++ E+G SSESI T  NVCS NSGP P             EDDCS TSLKLGL
Sbjct  181  VTE----MVMEDGQSSESIITSNNVCSSNSGPPPDQDDSSKIGGNAVEDDCSITSLKLGL  236

Query  893  PIN  901
            P +
Sbjct  237  PFS  239



>gb|AFA37969.1| SVP3 [Actinidia chinensis]
Length=232

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 166/233 (71%), Positives = 197/233 (85%), Gaps = 7/233 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDA+VALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDAEVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M DI+GKY LH++N++Q++QPSL LQLE+S  ++L K+V++KT +LRQM+GE+LQGL++
Sbjct  61   SMSDIIGKYSLHTNNIEQIDQPSLALQLEDSNLVKLGKDVSEKTTQLRQMRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQK--MARINGEKF  751
             ELQ LEK LE GL+RVLETKGER++ EIATLQRKGAEL+ EN++LKQK  M  I+  K+
Sbjct  121  NELQHLEKMLEAGLSRVLETKGERIMNEIATLQRKGAELVEENQRLKQKLQMNAISEGKW  180

Query  752  PVIADVEAGL----IPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
             V   V A L      E+G SSES+ TNVCSCNS P PEDDCSDTSLKLGLP 
Sbjct  181  AVTGVVGAELDNVVAEEQGQSSESV-TNVCSCNSAPPPEDDCSDTSLKLGLPF  232



>gb|ABQ51120.1| MPF2-like [Physalis alkekengi]
Length=240

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 186/215 (87%), Gaps = 3/215 (1%)
 Frame = +2

Query  251  DNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYKL  430
            +NITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGK+F+FASS+M DILGKYKL
Sbjct  3    NNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKVFDFASSSMMDILGKYKL  62

Query  431  HSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkle  610
             S+NL++V+QPSL+LQLENSL++RLSK+VADKT ELRQMKGEEL+GLSLEELQ++EK+LE
Sbjct  63   QSANLEKVDQPSLDLQLENSLNVRLSKQVADKTRELRQMKGEELEGLSLEELQQIEKRLE  122

Query  611  NGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIPE  790
             G  RVL+ KG R++ EIA LQRKGAELM ENKQLKQKM  +   K P++ D++  ++ E
Sbjct  123  AGFNRVLDIKGTRIMDEIAKLQRKGAELMEENKQLKQKMEMMKAGKLPLLIDMDC-MVME  181

Query  791  EGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EG SS+SI  T NVCS NSGP PEDDCS+  LKLG
Sbjct  182  EGQSSDSIITTNNVCSSNSGPPPEDDCSNAYLKLG  216



>emb|CAX51276.1| MPF2-like-A [Withania riebeckii]
Length=232

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 183/216 (85%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALI+FSATGKLFEFASS+MKDILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIVFSATGKLFEFASSSMKDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+V DKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVTDKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E KG R++ EIA LQRKGAELM ENKQLK+KM      K P++ D    ++ 
Sbjct  121  EAGFNRVVEIKGRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLPLLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNLCSSNSGPPPEDDCSNVSLKLG  212



>ref|XP_009627161.1| PREDICTED: MADS-box protein AGL24-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009627162.1| PREDICTED: MADS-box protein AGL24-like isoform X1 [Nicotiana 
tomentosiformis]
Length=245

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 202/246 (82%), Gaps = 19/246 (8%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKA EL+VLCDA+VALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAAELSVLCDAEVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M+DILGKYKLHSS+L++ +QPSL+LQLENSL+M+L KE+ADK  ELRQMKGEEL+GLSL
Sbjct  61   SMEDILGKYKLHSSSLEKDDQPSLDLQLENSLNMKLIKELADKNRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E+LQ++EK+LE GLT VLE KG +++ EI  LQRKGAELM ENKQLKQKMA +N  K P+
Sbjct  121  EKLQQIEKRLEAGLTHVLEIKGTKIMDEITKLQRKGAELMEENKQLKQKMAMMNEGKLPL  180

Query  758  IADVEAGLIPEEGHSSE-SITTNV----------CS-------CNSGPLPEDDCSDTSLK  883
            + D++  ++ EEG SS+ SITTNV          CS       CN+G   EDDCSDTSLK
Sbjct  181  LTDLDC-MVMEEGQSSDQSITTNVSTSGPPPEDDCSNASLKLGCNNGTPVEDDCSDTSLK  239

Query  884  LGLPIN  901
            LGLP N
Sbjct  240  LGLPFN  245



>emb|CAX51281.1| MPF2-like-A [Withania somnifera]
Length=232

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 183/216 (85%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALI+FSATGKLFEFASS+MKDILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIVFSATGKLFEFASSSMKDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVADKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E K  R++ EIA LQRKGAELM ENKQLK+KM      K P++ D    ++ 
Sbjct  121  EAGFNRVVEIKDRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLPLLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNICSSNSGPPPEDDCSNVSLKLG  212



>emb|CAX51270.1| MPF2-like-A [Withania frutescens]
 emb|CAX51273.1| MPF2-like-A [Withania riebeckii]
 emb|CAX51274.1| MPF2-like-A [Withania riebeckii]
 emb|CAX51286.1| MPF2-like-A [Withania somnifera]
 emb|CAX51289.1| MPF2-like-A [Withania sp. W010]
 emb|CAX51293.1| MPF2-like-A [Withania sp. W011]
 emb|CAX51294.1| MPF2-like-A [Withania somnifera]
 emb|CAX51298.1| MPF2-like-A [Withania frutescens]
Length=232

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 183/216 (85%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALI+FSATGKLFEFASS+MKDILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIVFSATGKLFEFASSSMKDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVADKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E K  R++ EIA LQRKGAELM ENKQLK+KM      K P++ D    ++ 
Sbjct  121  EAGFNRVVEIKDRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLPLLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNICSSNSGPPPEDDCSNVSLKLG  212



>emb|CAX51267.1| MPF2-like-A [Withania aristata]
Length=233

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 158/217 (73%), Positives = 183/217 (84%), Gaps = 7/217 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALI+FSATGKLFEFASS+MKDILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIVFSATGKLFEFASSSMKDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVADKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E K  R++ EIA LQRKGAELM ENKQLK+KM      K P++ D    ++ 
Sbjct  121  EAGFNRVVEIKDRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLPLLTD----MVM  176

Query  788  EEGHSSESI---TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI   T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTTNNICSSNSGPPPEDDCSNVSLKLG  213



>gb|AAV65503.1| MPP4 [Physalis peruviana]
Length=247

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 195/225 (87%), Gaps = 3/225 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL++LCDADVALIIFS+TGKLF+F+SS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSILCDADVALIIFSSTGKLFDFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S+NLD+V+QP L+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSL
Sbjct  61   SMKDILGKYKLQSANLDKVDQPFLDLQLENSLNVRLRKQVADKTRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EIA LQRKGAELM ENK+LKQKM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGTRIMDEIANLQRKGAELMEENKKLKQKMEMMKLGKLPL  180

Query  758  IADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            I ++E  ++ EEG SS+SI  T NVCS N+GP PEDD S+ SLKL
Sbjct  181  ITEMEC-MVMEEGQSSDSIITTNNVCSSNTGPPPEDDSSNASLKL  224



>emb|CAX51285.1| MPF2-like-A [Withania somnifera]
Length=232

 Score =   270 bits (690),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 183/216 (85%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALI+FSATGKLFEFASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIVFSATGKLFEFASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVADKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E K  R++ EIA LQRKGAELM ENKQLK+KM      K P++ D    ++ 
Sbjct  121  EAGFNRVVEIKDRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLPLLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNICSSNSGPPPEDDCSNVSLKLG  212



>emb|CAX51292.1| MPF2-like-A [Withania sp. W011]
Length=232

 Score =   270 bits (689),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 183/216 (85%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALI+FSATGKLF+FASS+MKDILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIVFSATGKLFDFASSSMKDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVADKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E K  R++ EIA LQRKGAELM ENKQLK+KM      K P++ D    ++ 
Sbjct  121  EAGFNRVVEIKDRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLPLLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNICSSNSGPPPEDDCSNVSLKLG  212



>emb|CAX51275.1| MPF2-like-A [Withania riebeckii]
Length=232

 Score =   269 bits (688),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 182/216 (84%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALI FSATGKLFEFASS+MKDILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIAFSATGKLFEFASSSMKDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+V DKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVTDKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E KG R++ EIA LQRKGAELM ENKQLK+KM      K P++ D    ++ 
Sbjct  121  EAGFNRVVEIKGRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLPLLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNLCSSNSGPPPEDDCSNVSLKLG  212



>emb|CAX51308.1| MPF2-like-B [Withania sp. W009]
Length=235

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 183/216 (85%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQ TFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLFEFASS+M+DILGKYK
Sbjct  1    IDNITARQETFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFEFASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GL+LEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLNLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E GL RVLE KG R++ EI  L RKGAELM E  QLKQKM  +   K P++  ++  ++ 
Sbjct  121  EAGLNRVLEIKGARIMDEITKLHRKGAELMEEKTQLKQKMEMLKEGKLPLVIGMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGP PEDD S+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDSSNASLKLG  215



>emb|CAX51307.1| MPF2-like-B [Withania sp. W009]
Length=235

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 182/216 (84%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRGLFKKA  L+VLCDADVALIIFSATGKLFEFASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKRRRGLFKKAGGLSVLCDADVALIIFSATGKLFEFASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQ ENSL+MRLSK+VADKT ELRQM+GEEL+GL+LEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQPENSLNMRLSKQVADKTRELRQMRGEELEGLNLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E GL RV E KG R++ EI  LQRKGAELM E  QLKQKM  +   K P++ D++  ++ 
Sbjct  121  EAGLNRVFEIKGARIMDEITKLQRKGAELMEEKTQLKQKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SSESI  T NVCS NSGP PEDD S+ SLKLG
Sbjct  180  EEGQSSESIITTNNVCSSNSGPPPEDDSSNASLKLG  215



>ref|XP_009627163.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Nicotiana tomentosiformis]
Length=241

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 197/225 (88%), Gaps = 4/225 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKA EL+VLCDA+VALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAAELSVLCDAEVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M+DILGKYKLHSS+L++ +QPSL+LQLENSL+M+L KE+ADK  ELRQMKGEEL+GLSL
Sbjct  61   SMEDILGKYKLHSSSLEKDDQPSLDLQLENSLNMKLIKELADKNRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E+LQ++EK+LE GLT VLE KG +++ EI  LQRKGAELM ENKQLKQKMA +N  K P+
Sbjct  121  EKLQQIEKRLEAGLTHVLEIKGTKIMDEITKLQRKGAELMEENKQLKQKMAMMNEGKLPL  180

Query  758  IADVEAGLIPEEGHSSE-SITTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  ++ EEG SS+ SITTNV +  SGP PEDDCS+ SLKLG
Sbjct  181  LTDLDC-MVMEEGQSSDQSITTNVST--SGPPPEDDCSNASLKLG  222



>emb|CAX51272.1| MPF2-like-B [Withania riebeckii]
Length=235

 Score =   267 bits (683),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 182/216 (84%), Gaps = 3/216 (1%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSK RRGLFKKAEEL+VLC ADVA+IIFSATGKLF +ASS+M+DILGKYK
Sbjct  1    IDNITARQVTFSKWRRGLFKKAEELSVLCGADVAIIIFSATGKLFGYASSSMRDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V+QPSL+LQLENSL+MRLSK+VAD+T ELRQM+GEEL+GLSLEELQ++EK+L
Sbjct  61   LQSANLEKVDQPSLDLQLENSLNMRLSKQVADETRELRQMRGEELEGLSLEELQQIEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RVLE KG R V EI  LQRKGAELM E KQL QKM  +   K P++ D++  ++ 
Sbjct  121  EAGFNRVLEIKGARTVDEITKLQRKGAELMEEKKQLNQKMEMLKEGKLPLVIDMDC-MVM  179

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            E+G SSESI  T NVCS NSGP PEDDCS+ SLKLG
Sbjct  180  EDGQSSESIITTNNVCSSNSGPPPEDDCSNASLKLG  215



>emb|CAX51303.1| MPF2-like-A [Withania somnifera]
Length=232

 Score =   266 bits (681),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 181/216 (84%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+ LCDADVAL++FSATGKLFEFA S+MKDILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSALCDADVALVVFSATGKLFEFAGSSMKDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVADKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E K  R++ EIA LQRKGAELM ENKQLK+KM      K P++ D    ++ 
Sbjct  121  EAGFNRVVEIKDRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLPLLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNICSSNSGPPPEDDCSNVSLKLG  212



>ref|XP_009785678.1| PREDICTED: MADS-box protein AGL24-like isoform X2 [Nicotiana 
sylvestris]
Length=245

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 170/246 (69%), Positives = 200/246 (81%), Gaps = 19/246 (8%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKA EL+VLCDADVALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAAELSVLCDADVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M+DILGKYKLH ++L++ +QPSL+LQLENSL+  L KE+ADK  ELRQMKGEEL+GLSL
Sbjct  61   SMEDILGKYKLHLTSLEKDDQPSLDLQLENSLNTNLIKELADKNRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E+LQ++EK+LE GLTRVLE KG +++ EI  LQRKGA LM ENKQLKQKMA +N  + P+
Sbjct  121  EKLQQIEKRLETGLTRVLEIKGTKIMGEITKLQRKGAVLMEENKQLKQKMAMMNEGELPL  180

Query  758  IADVEAGLIPEEGHSSE-SITTNV----------CS-------CNSGPLPEDDCSDTSLK  883
            + D++  ++ EEG SS+ SITTNV          CS       CN+GP  EDDCSDTSLK
Sbjct  181  LTDLDC-MVMEEGQSSDQSITTNVSTSGPPPEDDCSNAFLKLGCNNGPPIEDDCSDTSLK  239

Query  884  LGLPIN  901
            LGLP N
Sbjct  240  LGLPFN  245



>ref|XP_010060099.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Eucalyptus grandis]
 gb|KCW66636.1| hypothetical protein EUGRSUZ_F00420 [Eucalyptus grandis]
Length=225

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 188/227 (83%), Gaps = 2/227 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGLFKKA EL+VLCDA+VA++IFSATGKLFE++SS
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLFKKAGELSVLCDAEVAVVIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKD L +Y LH +NL+ ++QPSLELQLE+S +MRLSKEVA+K+H LRQ++GE+LQGL++
Sbjct  61   SMKDTLERYTLHHNNLENMDQPSLELQLEHSNNMRLSKEVAEKSHRLRQLRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ+LEK LE GL RVL TK ER+ TEI  L+ KGAEL+ ENK LKQ M  +   K  +
Sbjct  121  EELQQLEKMLEAGLNRVLVTKEERIRTEITDLETKGAELIEENKMLKQTMTTLTKGKRHI  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
            + + +  L PEEG SSES  TNVCSCNSGP  EDD SDTSLKLGLP 
Sbjct  181  VTEPDVAL-PEEGVSSES-ATNVCSCNSGPPLEDDGSDTSLKLGLPF  225



>emb|CAX51264.1| MPF2-like-A [Withania aristata]
Length=232

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 181/216 (84%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALI+FSATGKLFEFA S+MKDILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIVFSATGKLFEFAGSSMKDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+VADKT ELRQMKG+EL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVADKTRELRQMKGDELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E K  R++ EIA LQRK AELM ENKQLK+KM      K P++ D    ++ 
Sbjct  121  EAGFNRVVEIKDRRIMDEIANLQRKSAELMEENKQLKEKMEMTKVGKLPLLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNICSSNSGPPPEDDCSNVSLKLG  212



>emb|CAX51282.1| MPF2-like-A [Withania somnifera]
Length=232

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 182/216 (84%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVTFSKRRRG+FKKAEEL+VLCDADVALI+FSATGKLFEFASS+MKDILGKYK
Sbjct  1    IDNITARQVTFSKRRRGIFKKAEELSVLCDADVALIVFSATGKLFEFASSSMKDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVADKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E K  R++ EIA LQRKGAELM ENKQLK+KM      K P++ D    ++ 
Sbjct  121  EAGFNRVVEIKDRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLPLLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            +EG S +SI  T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  KEGQSLDSIITTNNICSSNSGPPPEDDCSNVSLKLG  212



>gb|AGW23339.1| MADS box protein MADS37 [Gossypium hirsutum]
Length=222

 Score =   264 bits (675),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 193/228 (85%), Gaps = 8/228 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGLFKKAEEL+VLCDA+VALIIFSATGKLFEFASS
Sbjct  1    MAREKIKIKKIDNLTARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSATGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKD LG+Y LHS+N+++++QPSL+LQLEN+ ++RL+KE+ DKTH+LRQM+GE+LQGL++
Sbjct  61   SMKDTLGRYNLHSNNINKLDQPSLDLQLENNNNIRLNKEIVDKTHQLRQMRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ+LE  LE+GL  VLETK  R++ EI++L+ KGA L+ ENKQLK+KMA +   K   
Sbjct  121  EELQQLEGMLESGLKCVLETKSNRIMNEISSLENKGARLLEENKQLKEKMATLYKRK---  177

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLP-EDDCSDTSLKLGLPI  898
                ++ ++ EEG SSES+ TNVCSC+S   P EDD SDTSL+LGLP 
Sbjct  178  ---RDSDVVGEEGVSSESV-TNVCSCSSSCPPLEDDSSDTSLRLGLPF  221



>emb|CAX51302.1| MPF2-like-A [Withania somnifera]
Length=232

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 181/216 (84%), Gaps = 6/216 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITARQVT SKRRRG+FKKAEE +VLCDADVALI+FSATGKLFEFASS+MKDILGKYK
Sbjct  1    IDNITARQVTSSKRRRGIFKKAEEPSVLCDADVALIVFSATGKLFEFASSSMKDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+VADKT ELRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVADKTRELRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E K  R++ EIA LQRKGAELM ENKQLK+KM      K P++ D    ++ 
Sbjct  121  EAGFNRVVEIKDRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLPLLTD----MVM  176

Query  788  EEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI  T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTNNICSSNSGPPPEDDCSNVSLKLG  212



>ref|XP_010254525.1| PREDICTED: MADS-box protein SVP isoform X2 [Nelumbo nucifera]
Length=224

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 195/227 (86%), Gaps = 3/227 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL++LCDA+VALIIFSATGKLFE++SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSILCDAEVALIIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MK+IL ++ LHS NL +++QPSLELQLENS + RLSKEVA+K+H+LR+M+GE+LQGL++
Sbjct  61   SMKEILERHNLHSKNLQKLDQPSLELQLENSNYARLSKEVAEKSHQLRRMRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E+LQ+LEK LE GL+RVLETKGER++ EI+ L+RKG EL+ EN++LKQ+M  ++  +  V
Sbjct  121  EDLQQLEKSLETGLSRVLETKGERIMKEISNLERKGMELLEENERLKQQMMEMSKGQKHV  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
             AD E  ++ EEG SS+S+ TNVCS +SGP  + D SDTSLKLGLP 
Sbjct  181  GADSE-NIVYEEGQSSDSV-TNVCS-SSGPPQDYDSSDTSLKLGLPF  224



>ref|XP_010277489.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Nelumbo 
nucifera]
Length=227

 Score =   262 bits (669),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 193/226 (85%), Gaps = 2/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL++LCDA+VALIIFS+TGKLFE++SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSILCDAEVALIIFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MK+IL ++ LHS NL +++QPSLELQLENS + RLSKEVA+K+H+LRQM+GE LQGL++
Sbjct  61   SMKEILERHNLHSKNLHKLDQPSLELQLENSNYARLSKEVAEKSHQLRQMRGENLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ+LEK LE GL+RVLETKGER++ EI+TLQRKG EL+ EN++LKQ++  ++  +  +
Sbjct  121  EELQQLEKSLETGLSRVLETKGERIMKEISTLQRKGVELLEENERLKQQIVEMSKGQRHI  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            I+     L+ E+G SS+S+ TNVCS + GP  + D SDTSLKLGLP
Sbjct  181  ISAESENLVYEDGQSSDSV-TNVCS-SIGPPQDYDSSDTSLKLGLP  224



>ref|XP_004237993.1| PREDICTED: MADS-box protein SVP isoform X1 [Solanum lycopersicum]
Length=235

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 166/239 (69%), Positives = 192/239 (80%), Gaps = 15/239 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLF+FAS+
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFDFAST  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S++L++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSL
Sbjct  61   SMKDILGKYKLQSASLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG+R++ EI  LQRKGAELM ENKQLK KM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGKRIMDEITNLQRKGAELMEENKQLKHKMEIMKKGKLPL  180

Query  758  IADVEAGLIPEEGHSSES-ITTN----------VCSCNSGPLPEDDCSDTSLKLGLPIN  901
            + D    ++ EEG SSES ITTN                    EDDCS TSLKLGLP +
Sbjct  181  VTD----MVMEEGQSSESIITTNNPDQDDSSNASLKLGGTTAVEDDCSITSLKLGLPFS  235



>ref|XP_010277487.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Nelumbo nucifera]
 ref|XP_010277488.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Nelumbo nucifera]
Length=229

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 152/229 (66%), Positives = 195/229 (85%), Gaps = 6/229 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL++LCDA+VALIIFS+TGKLFE++SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSILCDAEVALIIFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MK+IL ++ LHS NL +++QPSLELQLENS + RLSKEVA+K+H+LRQM+GE LQGL++
Sbjct  61   SMKEILERHNLHSKNLHKLDQPSLELQLENSNYARLSKEVAEKSHQLRQMRGENLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI---NGEK  748
            EELQ+LEK LE GL+RVLETKGER++ EI+TLQRKG EL+ EN++LKQ++  +    G++
Sbjct  121  EELQQLEKSLETGLSRVLETKGERIMKEISTLQRKGVELLEENERLKQQLQIVEMSKGQR  180

Query  749  FPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
              + A+ E  L+ E+G SS+S+ TNVCS + GP  + D SDTSLKLGLP
Sbjct  181  HIISAESE-NLVYEDGQSSDSV-TNVCS-SIGPPQDYDSSDTSLKLGLP  226



>ref|XP_006338063.1| PREDICTED: MADS-box protein SVP isoform X1 [Solanum tuberosum]
Length=235

 Score =   259 bits (662),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 166/239 (69%), Positives = 191/239 (80%), Gaps = 15/239 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLF+FAS+
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFDFAST  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S++L++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSL
Sbjct  61   SMKDILGKYKLQSASLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EI  LQRKGAELM ENKQLK KM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGTRIMDEITNLQRKGAELMEENKQLKYKMEIMKKGKLPL  180

Query  758  IADVEAGLIPEEGHSSES-ITTN----------VCSCNSGPLPEDDCSDTSLKLGLPIN  901
            + D    ++ EEG SSES ITTN                    EDDCS TSLKLGLP +
Sbjct  181  LTD----MMMEEGQSSESIITTNNPDQDDSSNASLKLGGTTAVEDDCSITSLKLGLPFS  235



>ref|XP_010060098.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Eucalyptus grandis]
Length=232

 Score =   259 bits (662),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 157/234 (67%), Positives = 188/234 (80%), Gaps = 9/234 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGLFKKA EL+VLCDA+VA++IFSATGKLFE++SS
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLFKKAGELSVLCDAEVAVVIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQ-------LENSLHMRLSKEVADKTHELRQMkge  556
            +MKD L +Y LH +NL+ ++QPSLELQ       LE+S +MRLSKEVA+K+H LRQ++GE
Sbjct  61   SMKDTLERYTLHHNNLENMDQPSLELQVLSLRSELEHSNNMRLSKEVAEKSHRLRQLRGE  120

Query  557  elqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI  736
            +LQGL++EELQ+LEK LE GL RVL TK ER+ TEI  L+ KGAEL+ ENK LKQ M  +
Sbjct  121  DLQGLNIEELQQLEKMLEAGLNRVLVTKEERIRTEITDLETKGAELIEENKMLKQTMTTL  180

Query  737  NGEKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
               K  ++ + +  L PEEG SSES  TNVCSCNSGP  EDD SDTSLKLGLP 
Sbjct  181  TKGKRHIVTEPDVAL-PEEGVSSES-ATNVCSCNSGPPLEDDGSDTSLKLGLPF  232



>gb|AGW23356.1| MADS box protein MADS54 [Gossypium hirsutum]
Length=219

 Score =   258 bits (660),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 188/224 (84%), Gaps = 5/224 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGLFKKAEEL+VLCDA+ ALIIFSATGKLFEFA+S
Sbjct  1    MAREKIKIKKIDNLTARQVTFSKRRRGLFKKAEELSVLCDAEFALIIFSATGKLFEFATS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILG+Y LHS+ LD   QP+LEL+LEN+  + LSKEVADKTH++RQM+GE+LQGL++
Sbjct  61   SMKDILGRYNLHSNKLD---QPTLELRLENTNEISLSKEVADKTHQMRQMRGEDLQGLNI  117

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            +ELQ+LEK LE+GLTRVLETKGER++ EI++L+ +GA+L  ENK LK+K+  +   K  V
Sbjct  118  DELQQLEKLLESGLTRVLETKGERIMNEISSLEIEGAQLQEENKLLKEKLVSLCKGKRLV  177

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D E     EEG SS+S+  +V SC+SGP  EDD SDTSLKLG
Sbjct  178  LVDSEVA-TQEEGMSSQSV-DDVYSCSSGPSLEDDSSDTSLKLG  219



>ref|NP_001275284.1| MADS16 protein [Solanum tuberosum]
 gb|AAV65504.1| MADS16 [Solanum tuberosum]
 gb|AAV65507.1| MADS16 [Solanum tuberosum]
Length=235

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 192/239 (80%), Gaps = 15/239 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLF+FAS+
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFDFAST  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S++L++V++PSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSL
Sbjct  61   SMKDILGKYKLQSASLEKVDEPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EI  LQRKGAELM ENKQLK KM  +   KFP+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGTRIMDEITNLQRKGAELMEENKQLKHKMEIMKKGKFPL  180

Query  758  IADVEAGLIPEEGHSSES-ITTN----------VCSCNSGPLPEDDCSDTSLKLGLPIN  901
            + D    ++ EEG SSES ITTN                    ED+CS TSLKLGLP +
Sbjct  181  LTD----MVMEEGQSSESIITTNNPDQDDSSNASLKLGGTTAVEDECSITSLKLGLPFS  235



>emb|CAX51306.1| MPF2-like-A [Withania sp. W009]
Length=233

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 179/217 (82%), Gaps = 7/217 (3%)
 Frame = +2

Query  248  IDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYK  427
            IDNITA QVTFSKRRRG+FKKAEEL+VLCDA VALI+FSATGKLFEFASS+MKDILGKYK
Sbjct  1    IDNITAGQVTFSKRRRGIFKKAEELSVLCDAGVALIVFSATGKLFEFASSSMKDILGKYK  60

Query  428  LHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkl  607
            L S+NL++V QPSL+LQLENSL++RL K+VADKT  LRQMKGEEL+GLSLEELQ+LEK+L
Sbjct  61   LQSANLEKVYQPSLDLQLENSLNVRLCKQVADKTRGLRQMKGEELEGLSLEELQQLEKRL  120

Query  608  eNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIP  787
            E G  RV+E K  R++ EIA LQRKGAELM ENKQLK+KM      K  ++ D    ++ 
Sbjct  121  EAGFNRVVEIKDRRIMDEIANLQRKGAELMEENKQLKEKMEMTKVGKLSLLTD----MVM  176

Query  788  EEGHSSESI---TTNVCSCNSGPLPEDDCSDTSLKLG  889
            EEG SS+SI   T N+CS NSGP PEDDCS+ SLKLG
Sbjct  177  EEGQSSDSIITTTNNICSSNSGPPPEDDCSNVSLKLG  213



>ref|XP_010254524.1| PREDICTED: MADS-box protein SVP isoform X1 [Nelumbo nucifera]
Length=226

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 196/230 (85%), Gaps = 7/230 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL++LCDA+VALIIFSATGKLFE++SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSILCDAEVALIIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MK+IL ++ LHS NL +++QPSLELQLENS + RLSKEVA+K+H+LR+M+GE+LQGL++
Sbjct  61   SMKEILERHNLHSKNLQKLDQPSLELQLENSNYARLSKEVAEKSHQLRRMRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI---NGEK  748
            E+LQ+LEK LE GL+RVLETKGER++ EI+ L+RKG EL+ EN++LKQ++  +    G+K
Sbjct  121  EDLQQLEKSLETGLSRVLETKGERIMKEISNLERKGMELLEENERLKQQLQMMEMSKGQK  180

Query  749  FPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
              V AD E  ++ EEG SS+S+ TNVCS +SGP  + D SDTSLKLGLP 
Sbjct  181  H-VGADSE-NIVYEEGQSSDSV-TNVCS-SSGPPQDYDSSDTSLKLGLPF  226



>gb|AAB94005.1| MADS transcriptional factor [Solanum tuberosum]
Length=234

 Score =   256 bits (655),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 165/239 (69%), Positives = 192/239 (80%), Gaps = 16/239 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF+FAS+
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDFAST  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S++L++V++PSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSL
Sbjct  61   SMKDILGKYKLQSASLEKVDEPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EI  LQRKGAELM ENKQLK KM  + G K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGTRIMDEITNLQRKGAELMEENKQLKHKMEIMKG-KLPL  179

Query  758  IADVEAGLIPEEGHSSES-ITTN----------VCSCNSGPLPEDDCSDTSLKLGLPIN  901
            + D    ++ EEG SSES ITTN                    EDDCS TSLKLGLP +
Sbjct  180  LTD----MVMEEGQSSESIITTNNPDQDDSSNASLKLGGTTAVEDDCSITSLKLGLPFS  234



>ref|XP_010320206.1| PREDICTED: MADS-box protein SVP isoform X2 [Solanum lycopersicum]
Length=231

 Score =   256 bits (655),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 164/235 (70%), Positives = 189/235 (80%), Gaps = 15/235 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLF+FAS+
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFDFAST  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S++L++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSL
Sbjct  61   SMKDILGKYKLQSASLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG+R++ EI  LQRKGAELM ENKQLK KM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGKRIMDEITNLQRKGAELMEENKQLKHKMEIMKKGKLPL  180

Query  758  IADVEAGLIPEEGHSSES-ITTN----------VCSCNSGPLPEDDCSDTSLKLG  889
            + D    ++ EEG SSES ITTN                    EDDCS TSLKLG
Sbjct  181  VTD----MVMEEGQSSESIITTNNPDQDDSSNASLKLGGTTAVEDDCSITSLKLG  231



>gb|AFA37968.1| SVP2 [Actinidia chinensis]
Length=229

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 157/229 (69%), Positives = 188/229 (82%), Gaps = 3/229 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDA+VALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDAEVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M DI+G+Y LH+ N++Q++QPSL LQLE+S   +L K+V++KT +L QM+GE+LQGL++
Sbjct  61   SMSDIIGRYSLHTDNIEQMDQPSLPLQLEDSNLAKLGKDVSEKTTQLWQMRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
             ELQ LEK LE GL+RVLETKGER++ EIATLQRK  +L+ EN +LKQKM  I+  K  V
Sbjct  121  NELQHLEKMLEAGLSRVLETKGERIMNEIATLQRKDEKLVEENHRLKQKMKAISEGKLGV  180

Query  758  IADVEAG--LIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
                E+   +  E+G SSES  TNVCSCNS P PEDDC+DTSLKLGL  
Sbjct  181  TGGAESDNMVAEEQGQSSES-GTNVCSCNSAPPPEDDCADTSLKLGLSF  228



>ref|XP_009785671.1| PREDICTED: MADS-box protein AGL24-like isoform X1 [Nicotiana 
sylvestris]
Length=277

 Score =   257 bits (657),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 193/225 (86%), Gaps = 4/225 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKA EL+VLCDADVALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAAELSVLCDADVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M+DILGKYKLH ++L++ +QPSL+LQLENSL+  L KE+ADK  ELRQMKGEEL+GLSL
Sbjct  61   SMEDILGKYKLHLTSLEKDDQPSLDLQLENSLNTNLIKELADKNRELRQMKGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E+LQ++EK+LE GLTRVLE KG +++ EI  LQRKGA LM ENKQLKQKMA +N  + P+
Sbjct  121  EKLQQIEKRLETGLTRVLEIKGTKIMGEITKLQRKGAVLMEENKQLKQKMAMMNEGELPL  180

Query  758  IADVEAGLIPEEGHSSE-SITTNVCSCNSGPLPEDDCSDTSLKLG  889
            + D++  ++ EEG SS+ SITTNV +  SGP PEDDCS+  LKLG
Sbjct  181  LTDLDC-MVMEEGQSSDQSITTNVST--SGPPPEDDCSNAFLKLG  222



>ref|XP_010027953.1| PREDICTED: MADS-box protein JOINTLESS [Eucalyptus grandis]
 gb|KCW54607.1| hypothetical protein EUGRSUZ_I00556 [Eucalyptus grandis]
Length=227

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 188/229 (82%), Gaps = 4/229 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKI N TARQVTFSKRRRGLFKKAEEL+VLCDADVALI+FS++GKLFE+ SS
Sbjct  1    MAREKIQIKKITNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSSGKLFEYCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++  HS NL +++QPSLELQL EN  + RLSKEVA+K H+LRQM+GEELQGL+
Sbjct  61   SMKEILERHHSHSENLGKLDQPSLELQLVENGDYSRLSKEVAEKGHQLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            ++ELQ+LEK LE GL RV+E KGE++V EI  LQ+KGA+LM ENK+LKQ++  I+G K  
Sbjct  121  IDELQQLEKSLEAGLNRVIEKKGEKIVKEITDLQQKGAKLMEENKRLKQQVTEISGRK-T  179

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
               D E  +I EEG SSES+ TNVCS +SGP  EDD SD SLKLGLP N
Sbjct  180  TATDSET-IINEEGLSSESV-TNVCSSSSGPPQEDDSSDFSLKLGLPYN  226



>ref|XP_006338064.1| PREDICTED: MADS-box protein SVP isoform X2 [Solanum tuberosum]
Length=231

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 164/235 (70%), Positives = 188/235 (80%), Gaps = 15/235 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGKLF+FAS+
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKLFDFAST  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILGKYKL S++L++V+QPSL+LQLENSL+MRLSK+VADKT ELRQM+GEEL+GLSL
Sbjct  61   SMKDILGKYKLQSASLEKVDQPSLDLQLENSLNMRLSKQVADKTRELRQMRGEELEGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ++EK+LE G  RVLE KG R++ EI  LQRKGAELM ENKQLK KM  +   K P+
Sbjct  121  EELQQIEKRLEAGFNRVLEIKGTRIMDEITNLQRKGAELMEENKQLKYKMEIMKKGKLPL  180

Query  758  IADVEAGLIPEEGHSSES-ITTN----------VCSCNSGPLPEDDCSDTSLKLG  889
            + D    ++ EEG SSES ITTN                    EDDCS TSLKLG
Sbjct  181  LTD----MMMEEGQSSESIITTNNPDQDDSSNASLKLGGTTAVEDDCSITSLKLG  231



>gb|AAP40641.1| SVP-like floral repressor [Eucalyptus occidentalis]
Length=227

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 154/229 (67%), Positives = 188/229 (82%), Gaps = 4/229 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKI N TARQVTFSKRRRGLFKKAEEL+VLCDADVALI+FS++GKLFE+ SS
Sbjct  1    MAREKIQIKKITNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSSGKLFEYCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++  HS NL +++QPSL+LQL EN  + RLSKEVA+K H+LRQM+GEELQGL+
Sbjct  61   SMKEILERHHSHSENLGKLDQPSLKLQLVENGDYSRLSKEVAEKGHQLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            ++ELQ+LEK LE GL RV+E KGE+++ EI  LQ+KGA+LM ENK+LKQ++  I+G K  
Sbjct  121  IDELQQLEKSLEAGLNRVIEKKGEKIMKEITDLQQKGAKLMEENKRLKQQVTEISGRK-T  179

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
               D E  +I EEG SSESI TNVCS +SGP  EDD SD SLKLGLP N
Sbjct  180  TATDSET-IINEEGLSSESI-TNVCSSSSGPPQEDDSSDISLKLGLPYN  226



>gb|AFA37964.1| SVP2 [Actinidia deliciosa]
Length=229

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 155/229 (68%), Positives = 188/229 (82%), Gaps = 3/229 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRR+GLFKKA+ELAVLCDA+VALIIFSATGKLFE+ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRQGLFKKAQELAVLCDAEVALIIFSATGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M DI+G+Y LH+ N++Q++QPSL LQLE+S   +L K+V++KT +L QM+GE+LQGL++
Sbjct  61   SMSDIIGRYSLHTDNIEQMDQPSLPLQLEDSNLAKLGKDVSEKTTQLWQMRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
             ELQ LEK LE GL+RVLETKGER++ EIATLQRK  +L+ EN +LKQKM  I+  K  V
Sbjct  121  NELQHLEKMLEAGLSRVLETKGERIMNEIATLQRKDEKLVEENHRLKQKMKAISEGKLGV  180

Query  758  IADVEAG--LIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
                E+   +  E+G SSES  TNVCSCNS P PEDDC+DTSLKLGL  
Sbjct  181  TGGAESDNMVAEEQGQSSES-GTNVCSCNSAPPPEDDCADTSLKLGLSF  228



>gb|KDP41475.1| hypothetical protein JCGZ_15882 [Jatropha curcas]
Length=227

 Score =   251 bits (641),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 196/233 (84%), Gaps = 12/233 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDA+VALI FSATGKLFE+AS+
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVALISFSATGKLFEYAST  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHEL----RQMkgeelq  565
            +MKDI+ +Y  +S+N+ + +QPSLELQLEN+ H+RLSKE+A+KTH+L    RQM GE+LQ
Sbjct  61   SMKDIIARYDRYSNNIKKGDQPSLELQLENNNHIRLSKELAEKTHQLSLHNRQMSGEDLQ  120

Query  566  glsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI-NG  742
            GL++EELQ+LEK LE+GL+RVLETKGER++ EI+  ++K  +L+ ENKQLKQKM  +  G
Sbjct  121  GLNIEELQQLEKMLESGLSRVLETKGERIMNEISAFEKKREQLLEENKQLKQKMMSLCKG  180

Query  743  EKFPVIADVEAGLIP-EEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
            ++      VE+ + P EEG SSES+ TN+CSC+SGP PEDD SDTSLKLGLP 
Sbjct  181  KRL-----VESNIHPQEEGLSSESV-TNICSCSSGPPPEDDSSDTSLKLGLPF  227



>ref|NP_001289637.1| MADS-box protein JOINTLESS [Eucalyptus grandis]
 gb|AAP33087.1| SVP-like floral repressor [Eucalyptus grandis]
Length=227

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 187/229 (82%), Gaps = 4/229 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKI N TARQVTFSKRRRGLFKKAEEL+VLCDADVALI+FS++GKLFE+ SS
Sbjct  1    MAREKIQIKKITNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSSGKLFEYCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++  HS NL +++QPSL+LQL EN  + RLSKEVA+K H+LRQM+GEELQGL+
Sbjct  61   SMKEILERHHSHSENLGKLDQPSLKLQLVENGDYSRLSKEVAEKGHQLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            ++ELQ+LEK LE GL RV+E KGE+++ EI  LQ+KGA+LM E K+LKQ++  I+G K  
Sbjct  121  IDELQQLEKSLEAGLNRVIEKKGEKIMKEITDLQQKGAKLMEETKRLKQQVTEISGRK-T  179

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
               D E  +I EEG SSESI TNVCS +SGP  EDD SD SLKLGLP N
Sbjct  180  TATDSET-IINEEGLSSESI-TNVCSSSSGPPQEDDSSDISLKLGLPYN  226



>emb|CBI38273.3| unnamed protein product [Vitis vinifera]
Length=227

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 151/227 (67%), Positives = 187/227 (82%), Gaps = 4/227 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF+SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL K+ L S NL+++ QPSLELQL EN+ H RLSKEVADK+H+LRQM+GEELQGL+
Sbjct  61   SMKEILEKHSLQSKNLEKLEQPSLELQLVENNNHSRLSKEVADKSHKLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +E+LQ+LEK LE GL+RV++ KGER++ EI  LQ KG +LM EN++L+Q++  I+  +  
Sbjct  121  IEDLQQLEKSLEAGLSRVIQKKGERIMKEITDLQSKGVQLMEENERLRQQVVEISNRRRQ  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  D E  +  EEG SSES+ TNV + N GP  + + SDTSLKLGLP
Sbjct  181  VAGDSE-NMFHEEGQSSESV-TNVSNSN-GPPQDYESSDTSLKLGLP  224



>ref|XP_009783886.1| PREDICTED: MADS-box protein JOINTLESS-like [Nicotiana sylvestris]
Length=235

 Score =   250 bits (639),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 189/233 (81%), Gaps = 8/233 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFE++SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL +  LHS NL++++ PSLELQL ENS + RLSKE+++K+H LRQM+GEELQGLS
Sbjct  61   SMKEILERRDLHSKNLEKLDHPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI--NGEK  748
            +EELQ+LE+ LE GLTRV+E KG+++++EI  LQ+KG +LM EN++LKQ++  I  NG  
Sbjct  121  IEELQQLERSLEAGLTRVIERKGDKIMSEINQLQQKGMQLMEENERLKQQVMEISNNGYN  180

Query  749  FP----VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
             P    V  + E G I EEG SSES+ TN C+    P  +DD SDTSLKLGLP
Sbjct  181  NPAAVLVAVESENGYINEEGQSSESV-TNACNSTGPPPQDDDSSDTSLKLGLP  232



>gb|AHW58026.1| SVP-1 [Coffea arabica]
Length=232

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 187/229 (82%), Gaps = 3/229 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALI+FS+TGKLFE++SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALILFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL+++ QPSLELQL ENS   RLSKEVA+K+H+LRQM+ EELQGL+
Sbjct  61   SMKEILERHNLHSKNLEKMEQPSLELQLVENSNCSRLSKEVAEKSHQLRQMRREELQGLT  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +++LQ+LE+ LE GL RV+E KGE+++ EI  LQRKG +LM EN++LKQ++  ++     
Sbjct  121  VDDLQQLERSLEAGLNRVIEKKGEKIMKEINHLQRKGMQLMEENERLKQQVMEVSNGSGQ  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            + AD    ++ EEG SSES+ TNVCS   GP  + + SDTSLKLGLP +
Sbjct  181  MAADDSENVLYEEGQSSESV-TNVCSSTGGP-QDYESSDTSLKLGLPYS  227



>emb|CDP01559.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 188/229 (82%), Gaps = 3/229 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALI+FS+TGKLFE++SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALILFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL+++ QPSLELQL ENS   RLSKEVA+K+H+LRQM+GEELQGL+
Sbjct  61   SMKEILERHNLHSKNLEKMEQPSLELQLVENSNCSRLSKEVAEKSHQLRQMRGEELQGLT  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +++LQ+LE+ LE GL RV+E KGE+++ EI  LQRKG +LM EN++LKQ++  ++     
Sbjct  121  VDDLQQLERSLEAGLNRVIEKKGEKIMKEINHLQRKGMQLMEENERLKQQVMEVSNGSGQ  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            + AD    ++ EEG SSES+ TNVCS   GP  + + SDTSLKLGLP +
Sbjct  181  MAADDSENVLYEEGQSSESV-TNVCSSTGGP-QDYESSDTSLKLGLPYS  227



>ref|XP_011021843.1| PREDICTED: MADS-box protein SVP [Populus euphratica]
 ref|XP_011021844.1| PREDICTED: MADS-box protein SVP [Populus euphratica]
 ref|XP_011021845.1| PREDICTED: MADS-box protein SVP [Populus euphratica]
Length=227

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 190/229 (83%), Gaps = 4/229 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MARE+I+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF+SS
Sbjct  1    MARERIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL+++ QPSLELQL E+S   RLSKEVA+K+H+LRQM+GE+L+GL+
Sbjct  61   SMKEILERHNLHSKNLEKLEQPSLELQLVEDSTCSRLSKEVAEKSHQLRQMRGEDLRGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            ++EL +LEK LE GL+ V+E KGE+++ EI  LQRKG +LM EN++LKQ++  I+  +  
Sbjct  121  IDELLQLEKSLEAGLSCVIEKKGEKIMNEITDLQRKGMQLMEENERLKQQVVEISNGRKH  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            V AD E  +  EEG SSES+ TNVC+ N GPL + + SDTSLKLGLP +
Sbjct  181  VTADSE-NVGYEEGQSSESV-TNVCNSN-GPLHDYESSDTSLKLGLPFS  226



>ref|XP_002310310.1| SHORT VEGETATIVE PHASE family protein [Populus trichocarpa]
 gb|EEE90760.1| SHORT VEGETATIVE PHASE family protein [Populus trichocarpa]
Length=227

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 189/229 (83%), Gaps = 4/229 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MARE+I+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF+SS
Sbjct  1    MARERIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL+++ QPSLELQL E+S   RLSKEVA+K+H+LRQM+GE+L+GL 
Sbjct  61   SMKEILERHNLHSKNLEKLEQPSLELQLVEDSTCSRLSKEVAEKSHQLRQMRGEDLRGLD  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            ++EL +LEK LE GL+ V+E KGE+++ EI  LQRKG +LM EN++LKQ++  I+  +  
Sbjct  121  IDELLQLEKSLEAGLSCVIEKKGEKIMNEITDLQRKGMQLMEENERLKQQVVEISNGRKH  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            V AD E  +  EEG SSES+ TNVC+ N GPL + + SDTSLKLGLP +
Sbjct  181  VTADSE-NVGYEEGQSSESV-TNVCNSN-GPLHDYESSDTSLKLGLPFS  226



>ref|XP_009623750.1| PREDICTED: MADS-box protein JOINTLESS [Nicotiana tomentosiformis]
Length=238

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 188/236 (80%), Gaps = 11/236 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFE++SS
Sbjct  1    MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
             MK+IL +  LHS NL++++QPSLELQL ENS + +LSKE+++K+H LRQM+GEELQGLS
Sbjct  61   GMKEILERRDLHSKNLEKLDQPSLELQLVENSNYSKLSKEISEKSHRLRQMRGEELQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI--NGEK  748
            +EELQ+LE+ LE GLTRV+E KG++++ EI  LQ+KG +LM EN+ LKQ++  I  NG +
Sbjct  121  IEELQQLERSLEAGLTRVIERKGDKIMREINQLQQKGMQLMEENEILKQQVMEISNNGYQ  180

Query  749  FPVIA-------DVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
             P  A       + E G I EEG SSES+ TN C+    P  +DD SDTSLKLGLP
Sbjct  181  NPAAAAELLIAVESENGFINEEGQSSESV-TNACNSTGPPPQDDDSSDTSLKLGLP  235



>emb|CAN68106.1| hypothetical protein VITISV_009637 [Vitis vinifera]
Length=208

 Score =   246 bits (628),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 147/224 (66%), Positives = 186/224 (83%), Gaps = 16/224 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKI+KIDN++ARQVTFSKRRRGLFKKAEEL+VLCDA+VALIIFS+TGKLF+++SS
Sbjct  1    MAREKIKIRKIDNVSARQVTFSKRRRGLFKKAEELSVLCDAEVALIIFSSTGKLFDYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDILG+Y +HS+NL+++  PSLELQLENS H+RLSKE+ADK+H+LRQM+GE++QGL++
Sbjct  61   SMKDILGRYTMHSNNLEKLEGPSLELQLENSNHVRLSKEIADKSHQLRQMRGEDIQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EEL KLEK LE GL+RVL++K +R++TEIATLQ K  E++ + K+L             +
Sbjct  121  EELLKLEKMLEAGLSRVLKSKSDRIMTEIATLQTK-MEIICKGKRL-----------MTM  168

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
             +D    +I EEG SSESI TNV SC+SGP  EDD SDTSLKLG
Sbjct  169  ESD---NMILEEGQSSESI-TNVYSCSSGPPQEDDSSDTSLKLG  208



>ref|XP_002878622.1| short vegetative phase protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54881.1| short vegetative phase protein [Arabidopsis lyrata subsp. lyrata]
Length=241

 Score =   247 bits (630),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 149/241 (62%), Positives = 189/241 (78%), Gaps = 18/241 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEELQGL 
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLD  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI------  736
            +E LQ+LEK LE GLTRV+ETK ++++ EI+ LQ+KG +LM+ENK+L+Q+  ++      
Sbjct  121  IEGLQQLEKALETGLTRVIETKSDKIMNEISELQKKGMQLMDENKRLRQQGTQLTEENER  180

Query  737  -------NGEKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGL  892
                   N  ++  IA+ E   + EEGHSSESIT    + NS   P D +CSDTSL+LGL
Sbjct  181  LGMQICNNVHEYGGIAESENAAVYEEGHSSESITN---AGNSTGAPVDSECSDTSLRLGL  237

Query  893  P  895
            P
Sbjct  238  P  238



>ref|XP_008440538.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Cucumis melo]
 ref|XP_008440540.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Cucumis melo]
Length=228

 Score =   246 bits (629),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 189/229 (83%), Gaps = 7/229 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MA+EKI+I+KIDN TARQVTFSKRRRGLFKKA+EL+VLCDADVALIIFSATGKLFE++SS
Sbjct  1    MAKEKIQIRKIDNATARQVTFSKRRRGLFKKAKELSVLCDADVALIIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK I+ ++ LHS NL ++ QPSLELQL ENS + RL+KE+A+KTH+LRQM+GEELQ L+
Sbjct  61   SMKGIIERHNLHSKNLQKLEQPSLELQLVENSNYTRLNKEIAEKTHQLRQMRGEELQTLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK-F  751
            +EELQ+LEK LE+GL+RV+E KGER++ EI  LQRK AELM+ENK+LKQ+  ++NG +  
Sbjct  121  IEELQQLEKSLESGLSRVMEKKGERIMKEITDLQRKSAELMDENKRLKQQAEKMNGVRHL  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLP  895
             V  ++   L+ E+G SS S+ T VC  NS   P+D + SDTSLKLGLP
Sbjct  181  GVEPEI---LVVEDGQSSNSV-TEVCVSNSNGPPQDLESSDTSLKLGLP  225



>ref|XP_004143442.1| PREDICTED: MADS-box protein SVP-like [Cucumis sativus]
Length=228

 Score =   246 bits (629),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 189/229 (83%), Gaps = 7/229 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MA+EKI+I+KIDN TARQVTFSKRRRGLFKKA+EL+VLCDADVALIIFSATGKLFE++SS
Sbjct  1    MAKEKIQIRKIDNATARQVTFSKRRRGLFKKAKELSVLCDADVALIIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK I+ ++ LHS NL ++ QPSLELQL ENS + RL+KE+A+KTH+LRQM+GEELQ L+
Sbjct  61   SMKGIIERHNLHSKNLQKLEQPSLELQLVENSNYTRLNKEIAEKTHQLRQMRGEELQTLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK-F  751
            +EELQ+LEK LE+GL+RV+E KGER++ EI  LQRK AELM+ENK+LKQ+  ++NG +  
Sbjct  121  IEELQQLEKSLESGLSRVMEKKGERIMKEITDLQRKSAELMDENKRLKQQAEKMNGVRHL  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLP  895
             V  ++   L+ E+G SS S+ T VC  NS   P+D + SDTSLKLGLP
Sbjct  181  GVEPEI---LVVEDGQSSNSV-TEVCVSNSNGPPQDLESSDTSLKLGLP  225



>gb|ACV74250.1| EXTRAPETALS [Petunia x hybrida]
 gb|ACY82403.1| MADS-box protein 20 [Petunia x hybrida]
Length=233

 Score =   246 bits (628),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 189/233 (81%), Gaps = 10/233 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFE++SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL +  LHS NL++++QPSLELQL ENS + RLS+E+++K+H LRQM+GEELQGLS
Sbjct  61   SMKEILERRDLHSKNLEKLDQPSLELQLVENSNYSRLSREISEKSHRLRQMRGEELQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI--NGEK  748
            +EELQ+LE+ LE GL RV+E KG++++ EI  LQ+KG ELM EN++L+Q++  I  NG K
Sbjct  121  IEELQQLERTLEAGLGRVIERKGDKIMREINQLQQKGLELMEENEKLRQQVMEISNNGYK  180

Query  749  FPVIADVEAGL---IPEEGHSSESITTNVCSCNS-GPLPEDDCSDTSLKLGLP  895
             P  A V   L     EEG SSES+T    +CNS GP  +DD SDTSLKLGLP
Sbjct  181  NPAAAVVAVELENAANEEGQSSESVTN---ACNSTGPPQDDDSSDTSLKLGLP  230



>ref|XP_011099987.1| PREDICTED: MADS-box protein SVP-like [Sesamum indicum]
Length=229

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 189/229 (83%), Gaps = 6/229 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRGLFKKAEEL+VLCDADV LIIFS+TGKLFEFASS
Sbjct  1    MAREKIQIKKIDNVTARQVTFSKRRRGLFKKAEELSVLCDADVGLIIFSSTGKLFEFASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NLD++ QPSLELQL E++ H RL KEVA+++H+LR+M+GEELQGLS
Sbjct  61   SMKEILERHNLHSKNLDKLEQPSLELQLVEDNDHSRLIKEVAERSHQLRRMRGEELQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI--NGEK  748
            +EELQ LE+ LE GL+RV++ KGE+++ EI  LQ KG +LM EN++L+Q++  I  +G K
Sbjct  121  IEELQHLERSLEAGLSRVIDKKGEKIMKEINQLQEKGMQLMEENERLRQQVLDISNSGRK  180

Query  749  FPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                ADVE  ++ EEG SSES+T   CS ++GP  + D SDTSLKLGLP
Sbjct  181  MGT-ADVE-NIVYEEGQSSESVTNANCS-SAGPPQDYDSSDTSLKLGLP  226



>gb|AFI49342.1| jointless [Capsicum annuum]
Length=234

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 187/234 (80%), Gaps = 11/234 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+ GKLF+++SS
Sbjct  1    MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSNGKLFDYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK IL +  LHS NL++++QPSLELQL ENS + RLSKE+++K+H LRQM+GEE+QGL+
Sbjct  61   SMKQILERRDLHSKNLEKLDQPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEEIQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI------  736
            +EELQ+LEK LE GL+RV+E KG++++ EI  LQ KG +LM EN++L+Q++  I      
Sbjct  121  IEELQQLEKSLETGLSRVIEKKGDKIMREINQLQHKGMQLMEENEKLRQQVMEISSNKNN  180

Query  737  NGEKFPVIADVEAGLIPEEGHSSESITTNVCSCNS-GPLPEDDCSDTSLKLGLP  895
            NG K P++ + E     EEG SSES+T     CNS GP  +DD SDTSLKLGLP
Sbjct  181  NGYKNPIVFEPEIEFNYEEGQSSESVTN---PCNSTGPPQDDDSSDTSLKLGLP  231



>ref|XP_010417014.1| PREDICTED: MADS-box protein SVP isoform X2 [Camelina sativa]
Length=240

 Score =   244 bits (623),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 188/239 (79%), Gaps = 15/239 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEELQGL+
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQK----------  724
            +E+LQ+LEK LE GLTRV+ETK ++++ EI+ LQRKG +LM+ENK+L+Q+          
Sbjct  121  IEDLQQLEKALEAGLTRVIETKSDKIMNEISELQRKGVQLMDENKRLRQQGTQLTEENER  180

Query  725  --MARINGEKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
              M   N      + ++E   + EEGHSSESI TN  + N  P+ + + SDTSL+LGLP
Sbjct  181  LGMQMYNNVHESGVDEMENAAVYEEGHSSESI-TNAGNSNGAPV-DSESSDTSLRLGLP  237



>emb|CAG27846.1| incomposita protein [Antirrhinum majus]
Length=229

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 185/229 (81%), Gaps = 6/229 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEELAVLCDADVALIIFS+TGKLFE+ASS
Sbjct  1    MAREKIQIKKIDNTTARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSSTGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL ++ QPSLELQL E+S   RLS EVA+++ +LR+M+GEELQGL+
Sbjct  61   SMKEILERHNLHSKNLGKMEQPSLELQLVEDSNCTRLSNEVAERSQQLRRMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI-NGEKF  751
            +EELQ+LE+ LE GL+RVL+ KGE+++ EI  LQ KG +LM EN++LKQ++  I N ++ 
Sbjct  121  MEELQRLERSLEVGLSRVLDKKGEKIMNEINQLQEKGMQLMQENQRLKQQVVDISNYQQI  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLP  895
                D E   + EEG SSES+T    +CNS  LP+D DCSDT LKLGLP
Sbjct  181  TATPDSEIIHVYEEGQSSESVTY---TCNSTGLPQDYDCSDTYLKLGLP  226



>emb|CAL36572.1| incomposita homologue [Misopates orontium]
Length=229

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 186/229 (81%), Gaps = 6/229 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEELAVLCDADVALIIFS+TGKLFE+ASS
Sbjct  1    MAREKIQIKKIDNTTARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSSTGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL ++ QPSLELQL E+S   RLS+EVA+++ +LR+M+GEELQGL+
Sbjct  61   SMKEILERHNLHSKNLGKMEQPSLELQLVEDSNCARLSREVAERSQQLRRMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI-NGEKF  751
            +EELQ+LE+ LE GL+RVL+ KGE+++ EI  LQ KG +LM EN++LKQ++  I N ++ 
Sbjct  121  IEELQRLERSLEVGLSRVLDKKGEKIMNEINQLQEKGQQLMQENQRLKQQVVDISNCQQI  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLP  895
                D E   + EEG SSES+T    +CNS  LP+D DCSDT LKLGLP
Sbjct  181  TATPDSEIIHLYEEGQSSESVTY---TCNSTGLPQDYDCSDTYLKLGLP  226



>ref|XP_010429177.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Camelina sativa]
Length=240

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 189/239 (79%), Gaps = 15/239 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEEL GL+
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELHGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GLTRV+ETK  +++ EI+ LQRKG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALEAGLTRVIETKSGKIMNEISELQRKGMQLMDENKRLRQQGTQLTEENER  180

Query  755  V------------IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            +            + ++E   + EEGHSSESI TNV + N  P+ + + SDTSL+LGLP
Sbjct  181  LGMQIYNNVHESGVDELENAAVYEEGHSSESI-TNVGNSNGAPV-DSESSDTSLRLGLP  237



>ref|XP_010417013.1| PREDICTED: MADS-box protein SVP isoform X1 [Camelina sativa]
Length=242

 Score =   243 bits (620),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 188/241 (78%), Gaps = 17/241 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEELQGL+
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQK----------  724
            +E+LQ+LEK LE GLTRV+ETK ++++ EI+ LQRKG +LM+ENK+L+Q+          
Sbjct  121  IEDLQQLEKALEAGLTRVIETKSDKIMNEISELQRKGVQLMDENKRLRQQVNGTQLTEEN  180

Query  725  ----MARINGEKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGL  892
                M   N      + ++E   + EEGHSSESI TN  + N  P+ + + SDTSL+LGL
Sbjct  181  ERLGMQMYNNVHESGVDEMENAAVYEEGHSSESI-TNAGNSNGAPV-DSESSDTSLRLGL  238

Query  893  P  895
            P
Sbjct  239  P  239



>gb|AFC96914.1| SVP-like MADS-box protein, partial [Vitis vinifera]
Length=240

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 183/225 (81%), Gaps = 4/225 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEELAVLCDADVALIIFS+TGKLFEF+SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSSTGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL K+ L S NL+++ QPSLELQL EN+ H RLSKEVADK+H+LRQM+GEELQGL+
Sbjct  61   SMKEILEKHSLQSKNLEKLEQPSLELQLVENNNHSRLSKEVADKSHKLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +E+LQ+LEK LE GL+RV++ KGER++ EI  LQ KG +LM EN++L+Q++  I+  +  
Sbjct  121  IEDLQQLEKSLEAGLSRVIQKKGERIMKEITDLQSKGVQLMEENERLRQQVVEISNRRRQ  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
            V  D E  +  EEG SSES+ TNV + N GP  + + SDTSL  G
Sbjct  181  VAGDSE-NMFHEEGQSSESV-TNVSNSN-GPPQDYESSDTSLNWG  222



>gb|AIY25020.1| short vegetative phase 1 [Dimocarpus longan]
Length=226

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 188/228 (82%), Gaps = 7/228 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFE++SS
Sbjct  1    MAREKIQIKKIDNVTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL++++QPSLELQL ENS + RLSKE+ADK+H LRQ++GEELQ L+
Sbjct  61   SMKEILERHNLHSKNLEKLDQPSLELQLVENSSYTRLSKEIADKSHRLRQLRGEELQALN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ LEK LE GL+RV+E KG++++ EI+ LQ KG +LM +N++L+Q++  I   +  
Sbjct  121  IEELQVLEKSLEVGLSRVIEKKGQKIMKEISHLQAKGIQLMEDNERLRQQVVEITSGRRH  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNS-GPLPEDDCSDTSLKLGLP  895
            V  D+E  ++ EEG SSES+T     CNS GP  + + SDTSLKLGLP
Sbjct  181  V-GDLE-NVVYEEGQSSESVTN---PCNSTGPPHDYESSDTSLKLGLP  223



>ref|XP_010526675.1| PREDICTED: MADS-box protein SVP-like [Tarenaya hassleriana]
Length=239

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 148/238 (62%), Positives = 186/238 (78%), Gaps = 14/238 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFE+ SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL+++NQPSLELQL ENS H RLSKE+A+K+H LRQM+GEELQGL+
Sbjct  61   SMKEMLERHNLQSKNLEKLNQPSLELQLVENSDHSRLSKELAEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGE---  745
            +E+LQ+LEK LE GL RV+E K E+++ EI  LQRKG ELM ENK+L+Q+  R+  E   
Sbjct  121  IEDLQQLEKALEAGLNRVIEKKSEKIMNEIGDLQRKGMELMEENKRLRQQGMRLMEENER  180

Query  746  -------KFPVIADVEA-GLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                   ++      E+  ++ EEGHSSES+T      ++GP  +D+ SDTSLKLGLP
Sbjct  181  LGQQVSNEYERYGGAESKNVVYEEGHSSESVTN--AGNSAGPPVDDESSDTSLKLGLP  236



>ref|XP_006294892.1| hypothetical protein CARUB_v10023941mg [Capsella rubella]
 gb|EOA27790.1| hypothetical protein CARUB_v10023941mg [Capsella rubella]
Length=240

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 148/239 (62%), Positives = 191/239 (80%), Gaps = 15/239 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEEL GL+
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELHGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE GLTRV+ETK ++++ EI+ LQRKG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALEAGLTRVIETKSDKIMNEISELQRKGMQLMDENKRLRQQGTQLTEENER  180

Query  749  --FPVIADV-EAGL-------IPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                +  +V E+G+       + EEGHSSESI TN  + N  P+ + + SDTSL+LGLP
Sbjct  181  LGMQIYNNVHESGVDESENVAVYEEGHSSESI-TNAGNSNGAPV-DSESSDTSLRLGLP  237



>ref|XP_010429176.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Camelina sativa]
Length=242

 Score =   242 bits (617),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 148/244 (61%), Positives = 189/244 (77%), Gaps = 23/244 (9%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEEL GL+
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELHGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKF-  751
            +EELQ+LEK LE GLTRV+ETK  +++ EI+ LQRKG +LM+ENK+L+Q+   +NG +  
Sbjct  121  IEELQQLEKALEAGLTRVIETKSGKIMNEISELQRKGMQLMDENKRLRQQ---VNGTQLT  177

Query  752  ----------------PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLK  883
                              + ++E   + EEGHSSESI TNV + N  P+ + + SDTSL+
Sbjct  178  EENERLGMQIYNNVHESGVDELENAAVYEEGHSSESI-TNVGNSNGAPV-DSESSDTSLR  235

Query  884  LGLP  895
            LGLP
Sbjct  236  LGLP  239



>ref|XP_009364259.1| PREDICTED: MADS-box protein JOINTLESS-like [Pyrus x bretschneideri]
 ref|XP_009364260.1| PREDICTED: MADS-box protein JOINTLESS-like [Pyrus x bretschneideri]
Length=227

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 185/227 (81%), Gaps = 4/227 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDAD+ALIIFS+TGKLFE+ASS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADIALIIFSSTGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL+++ QPSL+LQL ENS +  LSKE+A K+H+LRQM+GEE+QGL+
Sbjct  61   SMKEILERHNLHSKNLEKLEQPSLQLQLVENSNYTMLSKEIAAKSHQLRQMRGEEIQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE GL RV+E K E+++ EI  LQR G +LM EN++L+Q++A  +  +  
Sbjct  121  LEELQQLEKSLETGLGRVIEKKSEKIMKEIGDLQRNGMQLMEENERLRQEVAEKSDGRRL  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  D E  +  EEG SSES+ TN C+ N+GP  + D SDTSLKLGLP
Sbjct  181  VQVDSE-NMFTEEGQSSESV-TNPCNSNNGP-QDYDSSDTSLKLGLP  224



>ref|XP_010646795.1| PREDICTED: LOW QUALITY PROTEIN: MADS-box protein SVP [Vitis vinifera]
Length=253

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 183/225 (81%), Gaps = 4/225 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF+SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL K+ L S NL+++ QPSLELQL EN+ H RLSKEVADK+H+LRQM+GEELQGL+
Sbjct  61   SMKEILEKHSLQSKNLEKLEQPSLELQLVENNNHSRLSKEVADKSHKLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +E+LQ+LEK LE GL+RV++ KGER++ EI  LQ KG +LM EN++L+Q++  I+  +  
Sbjct  121  IEDLQQLEKSLEAGLSRVIQKKGERIMKEITDLQSKGVQLMEENERLRQQVVEISNRRRQ  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
            V  D E  +  EEG SSES+ TNV + N GP  + + SDTSL  G
Sbjct  181  VAGDSE-NMFHEEGQSSESV-TNVSNSN-GPPQDYESSDTSLNWG  222



>gb|KDP29759.1| hypothetical protein JCGZ_18694 [Jatropha curcas]
Length=227

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 186/227 (82%), Gaps = 4/227 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKI N TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFSATGK+F++ SS
Sbjct  1    MAREKIQIKKIHNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSATGKMFDYCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQ-LENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ LHS NL+++ QPSLELQ +EN+ H RLSKE+ +K+H+LRQM+GEELQGL+
Sbjct  61   SMKELLERHNLHSKNLEKLEQPSLELQVVENTNHSRLSKEITEKSHQLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GL+RV+E KGE+++ EI  LQRKG +LM EN++L+Q++  ++     
Sbjct  121  IEELQRLEKSLEAGLSRVIEKKGEKIMKEIDELQRKGMQLMEENERLRQQVVEMSNGGKQ  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
              AD E  ++ EEG SSES+ TNVC+ N  P  + + SDTSLKLGLP
Sbjct  181  TAADSEI-VVYEEGQSSESV-TNVCNSNGAP-HDYESSDTSLKLGLP  224



>ref|XP_003517407.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Glycine max]
 ref|XP_006573006.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Glycine max]
 gb|KHN14511.1| MADS-box protein SVP [Glycine soja]
Length=227

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 189/231 (82%), Gaps = 8/231 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFE++SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL ++ QPSLELQL ENS   RLSKEVA+K+H+LRQ++GE+LQGL+
Sbjct  61   SMKEILERHHLHSKNLARMEQPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMAR-INGEKF  751
            +EELQ+LE  LE GL R++E KGE++++EIA LQRKG  LM EN++LK+ +A  ING++ 
Sbjct  121  IEELQQLEMSLETGLGRIIEKKGEKIMSEIADLQRKGMLLMEENERLKRHVAGIINGQRH  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLPIN  901
               A+ E   + +EG SSES+T     CNS  LP+D + SDTSLKLGLP +
Sbjct  181  GG-AESE-NFVMDEGQSSESVTY---VCNSTGLPQDYESSDTSLKLGLPYS  226



>ref|XP_006294891.1| hypothetical protein CARUB_v10023941mg [Capsella rubella]
 gb|EOA27789.1| hypothetical protein CARUB_v10023941mg [Capsella rubella]
Length=242

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 186/241 (77%), Gaps = 17/241 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEEL GL+
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELHGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQK----------  724
            +EELQ+LEK LE GLTRV+ETK ++++ EI+ LQRKG +LM+ENK+L+Q+          
Sbjct  121  IEELQQLEKALEAGLTRVIETKSDKIMNEISELQRKGMQLMDENKRLRQQVMGTQLTEEN  180

Query  725  ----MARINGEKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGL  892
                M   N      + + E   + EEGHSSESI TN  + N  P+ + + SDTSL+LGL
Sbjct  181  ERLGMQIYNNVHESGVDESENVAVYEEGHSSESI-TNAGNSNGAPV-DSESSDTSLRLGL  238

Query  893  P  895
            P
Sbjct  239  P  239



>ref|XP_004152597.1| PREDICTED: MADS-box protein SVP-like [Cucumis sativus]
 ref|XP_004163451.1| PREDICTED: MADS-box protein SVP-like [Cucumis sativus]
Length=230

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 184/228 (81%), Gaps = 3/228 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGL KKAEEL+VLCDA+VAL++FSATGK FE+++S
Sbjct  1    MAREKIKIKKIDNLTARQVTFSKRRRGLIKKAEELSVLCDAEVALLVFSATGKFFEYSNS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            ++KD++ +Y LHSSNL ++  PS+ LQ+E+S H++L+KEV D   +LRQM+GE+LQGL+L
Sbjct  61   SIKDVIARYNLHSSNLGKLEYPSIGLQVEDSNHVQLNKEVEDMNQQLRQMRGEDLQGLNL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKF-P  754
            E+L++LE+KLE GLTRVL TK ++++ EI  L+ KGA LM ENK LKQ+M R++ E+   
Sbjct  121  EDLKQLERKLEVGLTRVLHTKEKKIMREIDELELKGARLMEENKMLKQQMLRLSNERLMA  180

Query  755  VIAD-VEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V+ D  +  +  EEG SSES   NV SCNSGP  +DD SDTSLKLG P
Sbjct  181  VLVDSSDVRVAAEEGLSSES-AANVYSCNSGPPADDDSSDTSLKLGPP  227



>ref|XP_008444930.1| PREDICTED: MADS-box protein SVP isoform X1 [Cucumis melo]
 ref|XP_008444931.1| PREDICTED: MADS-box protein SVP isoform X1 [Cucumis melo]
Length=230

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 184/228 (81%), Gaps = 3/228 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGL KKAEEL+VLCDA+VAL++FSATGK FE++SS
Sbjct  1    MAREKIKIKKIDNLTARQVTFSKRRRGLMKKAEELSVLCDAEVALLVFSATGKFFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            ++KD++ +Y LHSSNL ++  PS+ LQ E+S H+RL+KEV + + +LRQM+GE+LQGL+L
Sbjct  61   SIKDVIARYNLHSSNLGKLEYPSIGLQAEDSNHVRLNKEVEEMSQQLRQMRGEDLQGLNL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E+L++LE+KLE GLTRVL TK +++++EI  L+ KGA LM ENK LKQ+M R++ E+   
Sbjct  121  EDLKQLERKLEVGLTRVLHTKEKKIMSEIDALELKGARLMEENKMLKQQMLRLSNERLMA  180

Query  758  I--ADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            +     +  ++ EEG SSES   NV SCNSGP  +DD SDTSLKLG P
Sbjct  181  VLVDSSDVRVVVEEGVSSES-AANVYSCNSGPPADDDSSDTSLKLGPP  227



>gb|AAF22455.1| MADS box protein [Paulownia kawakamii]
Length=227

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 186/230 (81%), Gaps = 6/230 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRG+FKKAEEL+VLCDADV LIIFS+TGKLFE+ASS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVGLIIFSSTGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+ILG++ LHS NLD++ QPSLELQL E+S + RLSKEVA+++H+LR+M+GEELQGLS
Sbjct  61   SMKEILGRHNLHSKNLDKLEQPSLELQLVEDSNYSRLSKEVAERSHQLRRMRGEELQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +E+LQ L+K LE+GL+RV+E KGE+++    +  RKG +LM EN++L+Q++A I+ +   
Sbjct  121  IEKLQHLKKSLESGLSRVIEKKGEKIMKGDQSTSRKGKQLMEENERLRQQVADISNDCKN  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNS-GPLPEDDCSDTSLKLGLPIN  901
              A     ++ +EG SSES+     +CNS GP  + D SDTSLKLGLP +
Sbjct  181  NAASDSENIVYDEGQSSESVN----ACNSVGPPQDYDSSDTSLKLGLPYS  226



>ref|XP_010472243.1| PREDICTED: MADS-box protein SVP-like [Camelina sativa]
Length=238

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 186/239 (78%), Gaps = 17/239 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCNS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEELQGL+
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQK----------  724
            +EELQ+LEK LE GLTRV+ETK ++++ EI+ LQRKG +LM+ENK+L+Q+          
Sbjct  121  IEELQQLEKALEAGLTRVIETKSDKIMNEISELQRKGVQLMDENKRLRQQGTQLTEVNER  180

Query  725  --MARINGEKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
              M   N      + +VE   + EEGHSSESIT    + N  P+ + + SDTSL+LGL 
Sbjct  181  LGMQIYNNVHESGVDEVENAAVYEEGHSSESITN---AGNGAPV-DSESSDTSLRLGLA  235



>ref|XP_008363740.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Malus 
domestica]
Length=227

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 183/229 (80%), Gaps = 4/229 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDAD+ALIIFS+TGKLFE+ASS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADIALIIFSSTGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NLD++ QPSLELQL ENS + RLSKE+A K+H+LRQM+GEE+QGLS
Sbjct  61   SMKEILERHNLHSKNLDKLEQPSLELQLVENSNYSRLSKEIAAKSHQLRQMRGEEIQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE GL  V+E K E+++ EI  LQR   +L  EN++L+Q++   +  +  
Sbjct  121  LEELQQLEKSLEAGLGGVVEKKSEKIMKEINDLQRNAMQLTEENERLRQQVVEKSNGRRL  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            V  D E  LI EEG SSES+ TN+C  NSGP   D+ S TSLKLGLP +
Sbjct  181  VHVDSE-NLITEEGQSSESV-TNLCKSNSGPQDYDN-SVTSLKLGLPFS  226



>gb|AAK27150.1| MADS box transcription factor [Ipomoea batatas]
 dbj|BAC15561.1| IbMADS3 [Ipomoea batatas]
Length=227

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 187/228 (82%), Gaps = 4/228 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF++ASS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK IL +  LHS NL++++QPSLELQL EN+ H RLSKE+AD TH LRQM+GE+LQG+S
Sbjct  61   SMKGILERRNLHSKNLEKMDQPSLELQLVENANHSRLSKEIADMTHRLRQMRGEDLQGMS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQK-MARINGEKF  751
            +EELQ+LE+ LE GL+RV+E KGE+++ EI  LQ+KG  LM E ++L Q+ MA  NG++ 
Sbjct  121  IEELQQLERSLETGLSRVIEKKGEKIMKEINELQQKGMNLMEEKERLTQQVMAISNGQRV  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
              + + +  ++ EEG SSESI TNVC+  S P   DD SDTSLKLGLP
Sbjct  181  TAVINSD-NMLNEEGLSSESI-TNVCNSTSPPQDYDDSSDTSLKLGLP  226



>ref|XP_006353175.1| PREDICTED: MADS-box protein JOINTLESS-like [Solanum tuberosum]
Length=238

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 187/236 (79%), Gaps = 11/236 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF++ +S
Sbjct  1    MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYCNS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK IL +  LHS NL++++QPSLELQL ENS + RLSKE+++K+H LRQM+GEELQGL+
Sbjct  61   SMKQILERRDLHSKNLEKLDQPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI-----N  739
            +E+LQ+LE+ LE GL+RV+E KG++++ EI  LQ+KG +LM EN++L+Q++  I     N
Sbjct  121  IEDLQQLERSLETGLSRVIERKGDKIMREINQLQQKGMQLMEENEKLRQQLMEISNNNNN  180

Query  740  GEKFPVIADVEA--GLIP--EEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            G K PV+   E+  G     EEG SSES+ TN C+    P  +DD SD SLKLGLP
Sbjct  181  GYKEPVVVAFESENGFNSNNEEGQSSESV-TNPCNSTGPPPQDDDSSDISLKLGLP  235



>ref|XP_006404717.1| hypothetical protein EUTSA_v10000308mg [Eutrema salsugineum]
 gb|ESQ46170.1| hypothetical protein EUTSA_v10000308mg [Eutrema salsugineum]
Length=239

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 187/240 (78%), Gaps = 18/240 (8%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK++ LRQM+GEEL GL+
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSNRLRQMRGEELLGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI------  736
            +EELQ+LEK LE GLTRV+ETK E+++TEI  LQRKG +LM+ENK+L+Q+  ++      
Sbjct  121  IEELQQLEKALEAGLTRVIETKSEKIMTEIGELQRKGMQLMDENKRLRQQGTQLTEENER  180

Query  737  -------NGEKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                   N  +  V  + E   + EEGHSSESIT    + N  P+ + + SDTSL+LGLP
Sbjct  181  LGKQICNNVHERNVGIESENTAVYEEGHSSESITN---AGNGAPV-DSESSDTSLRLGLP  236



>ref|NP_001280915.1| MADS-box protein JOINTLESS [Malus domestica]
 ref|XP_008385673.1| PREDICTED: MADS-box protein JOINTLESS [Malus domestica]
 gb|ABD66219.2| JOINTLESS [Malus domestica]
 gb|ADL36738.1| MADS domain class transcription factor [Malus domestica]
Length=224

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 145/225 (64%), Positives = 183/225 (81%), Gaps = 4/225 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGL KKAEEL+VLCDAD+ALIIFS+TGKLFE+ASS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLLKKAEELSVLCDADIALIIFSSTGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL+++ QPSL+LQL ENS + RLSKE+A K+H+LRQM+GEE+QGL+
Sbjct  61   SMKEILERHNLHSKNLEKLEQPSLQLQLVENSNYTRLSKEIAAKSHQLRQMRGEEIQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE GL RV+E K E+++ EI  LQR G +LM EN++L+Q++A  +  +  
Sbjct  121  LEELQQLEKSLETGLGRVIEKKSEKIMKEIGDLQRNGMQLMEENERLRQQVAEKSDGRRL  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
            V  D E  +  EEG SSES+ TN C+ N+GP  + D SDTSLKLG
Sbjct  181  VQVDSE-NMFTEEGQSSESV-TNPCNSNNGP-QDYDSSDTSLKLG  222



>ref|XP_009345716.1| PREDICTED: MADS-box protein JOINTLESS isoform X2 [Pyrus x bretschneideri]
Length=227

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 182/227 (80%), Gaps = 4/227 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDAD+ALIIFS+TGKLFE+AS+
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADIALIIFSSTGKLFEYASA  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NLD++ QPSLELQL ENS + RLSKE+A K+H+LRQM+GEE+QGLS
Sbjct  61   SMKEILERHNLHSKNLDKLEQPSLELQLVENSNYSRLSKEIAAKSHQLRQMRGEEIQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE GL  V+E K E+++ EI  LQR   +L  EN++L+Q++   +  +  
Sbjct  121  LEELQQLEKSLEAGLGGVVEKKSEKIMKEINDLQRNAMQLTEENERLRQQVVEKSNGRRL  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  D E  LI EEG SSES+ TN+C  NSGP  + D S TSLKLGLP
Sbjct  181  VHVDSE-NLITEEGQSSESV-TNLCKSNSGP-QDYDSSVTSLKLGLP  224



>ref|XP_011097479.1| PREDICTED: MADS-box protein JOINTLESS [Sesamum indicum]
Length=227

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 186/229 (81%), Gaps = 8/229 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M REKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFE++SS
Sbjct  1    MDREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++KLH+ NLD++ QPSLELQL E+S   RLSKEVA+++H+LR+M+GEELQGLS
Sbjct  61   SMKEILERHKLHAKNLDKMEQPSLELQLVEDSNCSRLSKEVAERSHQLRRMRGEELQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI-NGEKF  751
            +EELQ+LE  LE+GL+RV+E KGE+++ EI  LQ KG +LM  N +L+Q++  I NG + 
Sbjct  121  IEELQQLESSLESGLSRVIEKKGEKIMKEINQLQEKGTQLMEGNARLRQRVVDISNGRRN  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNS-GPLPEDDCSDTSLKLGLP  895
               AD E  ++ +EG SSES+     +CNS GP  + + SDTSLKLGLP
Sbjct  181  NATADSE-NIVYDEGQSSESVN----ACNSIGPPQDYESSDTSLKLGLP  224



>ref|XP_007047796.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
 gb|EOX91953.1| K-box region and MADS-box transcription factor family protein 
[Theobroma cacao]
Length=224

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 186/227 (82%), Gaps = 7/227 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL++LCDADVAL+IFS+TGKLF++ASS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSILCDADVALVIFSSTGKLFQYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL+++ QPSLELQL EN     LSKEVA+K+H+LRQM+GEELQGLS
Sbjct  61   SMKEILERHNLHSKNLEKLEQPSLELQLVENGNQSMLSKEVAEKSHQLRQMRGEELQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE+GL+RV+E KG++++ EI  LQRKG  LM EN++LK ++   NG K  
Sbjct  121  IEELQQLEKSLESGLSRVIEKKGQKIMREINDLQRKGMHLMEENERLKLQI--FNGRK-Q  177

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            + +D E  +  E+G SSES+ TNVC+ N  P  + + SDTSLKLGLP
Sbjct  178  IASDSEI-VFGEDGQSSESV-TNVCASNGTP-HDYESSDTSLKLGLP  221



>ref|NP_179840.2| MADS-box protein SVP [Arabidopsis thaliana]
 sp|Q9FVC1.1|SVP_ARATH RecName: Full=MADS-box protein SVP; AltName: Full=Protein SHORT 
VEGETATIVE PHASE [Arabidopsis thaliana]
 gb|AAG24508.1|AF211171_1 short vegetative phase protein [Arabidopsis thaliana]
 gb|ABU95408.1| short vegetative phase [Arabidopsis thaliana]
 gb|ACF09414.1| At2g22540 [Arabidopsis thaliana]
 gb|AEC07320.1| MADS-box protein SVP [Arabidopsis thaliana]
 gb|AFU85626.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85627.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85628.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85629.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85630.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85631.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85633.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85634.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85635.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85637.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85638.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85639.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85640.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85641.1| short vegetative phase [Arabidopsis thaliana]
Length=240

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 187/240 (78%), Gaps = 17/240 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEELQGL 
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLD  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GLTRV+ETK +++++EI+ LQ+KG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENER  180

Query  755  V------------IADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLP  895
            +             A+ E   + EEG SSESIT    + NS   P D + SDTSL+LGLP
Sbjct  181  LGMQICNNVHAHGGAESENAAVYEEGQSSESITN---AGNSTGAPVDSESSDTSLRLGLP  237



>ref|XP_010520750.1| PREDICTED: MADS-box protein AGL24-like isoform X2 [Tarenaya hassleriana]
Length=228

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 183/229 (80%), Gaps = 3/229 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+FKKAEEL+VLCDA+VALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
             M+D+L +Y LH+SNL++ N P L++QLENS  +RLSKEV DKT +LRQ++GE+LQGLSL
Sbjct  61   RMRDMLARYNLHASNLNKFNPPPLDIQLENSNLVRLSKEVEDKTKQLRQLRGEDLQGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            ++LQ+LEK +E+GL RVLE KGE ++ EI++L+++GA L  EN +LK+++  +   K   
Sbjct  121  DDLQRLEKLVESGLGRVLEKKGESIMGEISSLEKRGAALAEENSKLKERLMTLERGKTTA  180

Query  758  IADVEAGLIPEEGHSSES-ITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
              + E  +   +G S ES +TTN+ S  SG LP DD SDTSLKL LP +
Sbjct  181  FGEGEI-VATRDGISLESALTTNLSSSASGSLP-DDFSDTSLKLALPFS  227



>gb|AFM77908.1| MADS-box protein SVP [Brassica napus]
Length=241

 Score =   236 bits (601),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 190/241 (79%), Gaps = 18/241 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALI+FS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS + RLSKE+ADK+H+LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDNSRLSKEIADKSHQLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE GLTRV+ETK E++++EI+ LQRKG +LM+ENK+L+Q   ++  E   
Sbjct  121  IEELQQLEKALEAGLTRVIETKSEKIMSEISDLQRKGMKLMDENKRLRQHGTQLTEENER  180

Query  749  -----FPVIADVEAGL------IPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGL  892
                 +  + +   G+      + EEGHSSESIT    + NS   P D + SDTSL+LGL
Sbjct  181  LGKQIYNNMHERYGGVESEKTAVYEEGHSSESITN---AGNSTGAPVDSESSDTSLRLGL  237

Query  893  P  895
            P
Sbjct  238  P  238



>gb|KFK32803.1| mads-box protein svp [Arabis alpina]
Length=241

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 190/240 (79%), Gaps = 16/240 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF +S
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCNS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL EN+ H RLS+E+ADK+H LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENTDHARLSREIADKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQKLEK LE GLTRV+ETK ++++ EI+ LQRKG +LM+ENK+L+Q+ +++  E   
Sbjct  121  VEELQKLEKSLETGLTRVIETKSDKIMKEISELQRKGMQLMDENKRLRQQGSQLTEENER  180

Query  755  V-------------IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            +             +A+    ++ EEG SSESI TNV +    P+ + + SDTSL+LGLP
Sbjct  181  LGMQINNNVQERHGVAESVNVVVCEEGQSSESI-TNVGNSTGAPV-DSESSDTSLRLGLP  238



>gb|AFM77909.1| MADS-box protein SVP [Brassica napus]
Length=241

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 189/240 (79%), Gaps = 16/240 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS H  LSKE+A+K+H LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDHALLSKEIAEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE+GLTRV+ETK E++++EI+ LQRKG +LM+ENK+L+Q   ++  E   
Sbjct  121  IEELQQLEKALESGLTRVIETKSEKIMSEISDLQRKGMKLMDENKRLRQHGTQLTEENER  180

Query  749  -----FPVIADVEAGL------IPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                 +  + +   G+      + EEGHSSESI TN  +    P+ + + SDTSL+LGLP
Sbjct  181  LGKQIYNNMHERYGGVESEKTAVYEEGHSSESI-TNAGNSTGAPV-DSESSDTSLRLGLP  238



>gb|AFU85632.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85636.1| short vegetative phase [Arabidopsis thaliana]
 gb|AFU85642.1| short vegetative phase [Arabidopsis thaliana]
Length=240

 Score =   234 bits (597),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 186/240 (78%), Gaps = 17/240 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKK EEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKVEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEELQGL 
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLD  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GLTRV+ETK +++++EI+ LQ+KG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENER  180

Query  755  V------------IADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLP  895
            +             A+ E   + EEG SSESIT    + NS   P D + SDTSL+LGLP
Sbjct  181  LGMQICNNVHAHGGAESENAAVYEEGQSSESITN---AGNSTGAPVDSESSDTSLRLGLP  237



>ref|XP_004288518.1| PREDICTED: MADS-box protein JOINTLESS-like [Fragaria vesca subsp. 
vesca]
Length=232

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 147/232 (63%), Positives = 185/232 (80%), Gaps = 9/232 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGL KKAEEL+VLCDAD+ALIIFS+TGKLFE+ASS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLLKKAEELSVLCDADIALIIFSSTGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NLD++ QPSLELQL ENS + RLSKE+  K+H+LRQM+GEEL GL+
Sbjct  61   SMKEILERHHLHSKNLDKLEQPSLELQLVENSNYSRLSKEITAKSHQLRQMRGEELHGLN  120

Query  575  leelqklekkleNGLTRVLETK----GERVVTEIATLQRKGAELMNENKQLKQKMA-RIN  739
            LEELQ+LEK LE+G+ RV+E K    GE+++ EI  LQR   +L+ EN++LKQ++  R +
Sbjct  121  LEELQQLEKSLESGMGRVIEKKVILLGEKIMKEITDLQRNAIQLIEENERLKQQVVERTD  180

Query  740  GEKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            G +  V AD +     EEG SSES+ TN+C+ N+ P  + D SDTSLKLGLP
Sbjct  181  GGRRHVHADSD-NRFTEEGQSSESV-TNLCNSNNSP-QDYDSSDTSLKLGLP  229



>ref|XP_008235579.1| PREDICTED: MADS-box protein SVP [Prunus mume]
 ref|XP_008235586.1| PREDICTED: MADS-box protein SVP [Prunus mume]
 ref|XP_008235594.1| PREDICTED: MADS-box protein SVP [Prunus mume]
 ref|XP_008235603.1| PREDICTED: MADS-box protein SVP [Prunus mume]
Length=228

 Score =   233 bits (594),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 183/227 (81%), Gaps = 3/227 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKA+EL+VLCDAD+ALIIFS+TGKLFE+ASS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAQELSVLCDADIALIIFSSTGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            + K+IL ++ LH+ NL ++ QPSLELQL ENS +  LSKE+  ++ +LRQ++GE++QGL+
Sbjct  61   STKEILERHNLHAKNLSKIEQPSLELQLVENSNYSALSKEITAQSQQLRQIRGEDIQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE GL RV+E KGE+++ EI+ L+     L+ EN++L+Q++   +  + P
Sbjct  121  LEELQQLEKSLEAGLGRVIEKKGEKIMKEISDLESNAMRLVEENERLRQQVLEKHNSQRP  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V AD E  ++ EEG SSES+TTN+C+ NS P  + + SDTSLKLGLP
Sbjct  181  VRADSE-NMVMEEGQSSESVTTNLCNSNSAP-QDYESSDTSLKLGLP  225



>dbj|BAE98676.1| short vegegative phase protein [Arabidopsis thaliana]
Length=240

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 186/240 (78%), Gaps = 17/240 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEELQGL 
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLD  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GLTRV+ETK +++++EI+ LQ+KG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENER  180

Query  755  V------------IADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLP  895
            +             A+ E   + EEG SSESIT    + NS   P D + SDTSL+LGL 
Sbjct  181  LGMQICNNVHAHGGAESENAAVYEEGQSSESITN---AGNSTGAPVDSESSDTSLRLGLT  237



>gb|AGR42634.1| MADS1 [Rafflesia cantleyi]
Length=228

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 181/229 (79%), Gaps = 3/229 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDA VA+IIFSATGKLF+++SS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDAHVAVIIFSATGKLFDYSSS  60

Query  398  NMKDILGKY-KLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MKDIL +Y  LH +N ++ +QPSLELQLE S  +RLSKEVADKT +LRQM+GE+L  L+
Sbjct  61   SMKDILSRYDDLHFNNKEKPSQPSLELQLEISNRVRLSKEVADKTRQLRQMRGEDLNELN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LE  LE GL RV + KG+R+  EI+ L+RKGA+LM ENKQLKQKM  +     P
Sbjct  121  VEELQQLENLLEVGLQRVTDAKGKRITNEISELERKGAQLMEENKQLKQKMVMMCSGTRP  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
             I + +     EEG SS+S T  VCSC++GP  EDD SDT LKLGL  +
Sbjct  181  AILESDIT-THEEGMSSDSATV-VCSCSNGPPVEDDISDTYLKLGLSFS  227



>dbj|BAD43004.1| short vegegative phase protein (SVP) [Arabidopsis thaliana]
Length=240

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 186/240 (78%), Gaps = 17/240 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDA VALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDAGVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEELQGL 
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLD  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GLTRV+ETK +++++EI+ LQ+KG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENER  180

Query  755  V------------IADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLP  895
            +             A+ E   + EEG SSESIT    + NS   P D + SDTSL+LGLP
Sbjct  181  LGMQICNNVHAHGGAESENAAVYEEGQSSESITN---AGNSTGAPVDSESSDTSLRLGLP  237



>gb|AFM77910.1| MADS-box protein SVP [Brassica napus]
Length=241

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 188/241 (78%), Gaps = 18/241 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS H  LSKE+A+K+H LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDHALLSKEIAEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE+GLTRV+ETK E++++EI+ LQRKG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALESGLTRVIETKSEKIMSEISYLQRKGMQLMDENKRLRQQGTQLTEENER  180

Query  749  -----FPVIADVEAG------LIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGL  892
                 +  + +   G       + EEGHSSESIT    + NS   P D + SD SL+LGL
Sbjct  181  LGQQIYNNVHERYGGGESENIAVYEEGHSSESITN---AGNSTGAPVDSESSDISLRLGL  237

Query  893  P  895
            P
Sbjct  238  P  238



>gb|AFA37963.1| SVP1 [Actinidia deliciosa]
Length=227

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 185/227 (81%), Gaps = 4/227 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKI+KI+N TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF ++SS
Sbjct  1    MAREKIKIRKINNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFHYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK IL ++ +HS NL+++ QPS ELQL ENS + RLSKEV +K+H+LR+M+GEELQGL+
Sbjct  61   DMKGILERHNVHSKNLEKLEQPSTELQLVENSNYTRLSKEVVEKSHQLRKMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LE+ LE GL RV+E KGE+++ EI  LQ+KG  LM+EN++L+Q++      +  
Sbjct  121  IEELQQLERSLEAGLDRVIEKKGEKIMNEITHLQQKGMHLMDENERLRQQVMEACKARKH  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
               D E  +I E+G SSES+ TN+C+ ++GP+ + + SDTSLKLGLP
Sbjct  181  SATDSE-NVINEQGQSSESV-TNICN-STGPMQDYESSDTSLKLGLP  224



>ref|XP_007158373.1| hypothetical protein PHAVU_002G147600g [Phaseolus vulgaris]
 gb|ESW30367.1| hypothetical protein PHAVU_002G147600g [Phaseolus vulgaris]
Length=227

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 186/228 (82%), Gaps = 6/228 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFE+++S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSNS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL +++QPSLELQL ENS   RLSKEVA+K+H LRQ++GE+LQGL+
Sbjct  61   SMKEILERHHLHSKNLAKMDQPSLELQLVENSNCTRLSKEVAEKSHLLRQLRGEDLQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI-NGEKF  751
            +EELQ+LE+ LE GL+RV+E KGE+++ EI  LQRKG  LM EN++LK  +A I NGE+ 
Sbjct  121  IEELQQLERSLETGLSRVIEKKGEKIMNEITDLQRKGMVLMEENERLKHHVAGIVNGERR  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                +     + +EG SSES+T  VC+ ++GP  + + SDTSLKLGLP
Sbjct  181  GGAEN--ENFVVDEGQSSESVTY-VCN-STGPPQDYESSDTSLKLGLP  224



>ref|XP_009140365.1| PREDICTED: MADS-box protein SVP-like [Brassica rapa]
 gb|ABG24233.1| short vegetative phase protein [Brassica rapa subsp. oleifera]
Length=241

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 187/241 (78%), Gaps = 18/241 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALI+FS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS + RLSKE+ADK+H+LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDNSRLSKEIADKSHQLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GLTRV+ETK E++++EI+ LQRKG +LM+ENK+L+Q   ++  E   
Sbjct  121  IEELQQLEKALEAGLTRVIETKSEKIMSEISDLQRKGMKLMDENKRLRQHGTQLTEENER  180

Query  755  VIADV-------------EAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGL  892
            +   +             E   + EEG SSESIT    + NS   P D + SDTSL+LGL
Sbjct  181  LGKQIYNNMHERYGGVESEKTAVYEEGQSSESITN---AGNSTGAPVDSESSDTSLRLGL  237

Query  893  P  895
            P
Sbjct  238  P  238



>ref|XP_009112514.1| PREDICTED: MADS-box protein SVP [Brassica rapa]
 gb|ABI96182.1| short vegetative phase protein [Brassica rapa subsp. oleifera]
 gb|ABI96183.1| short vegetative phase protein [Brassica rapa subsp. oleifera]
 gb|AFG73588.1| short vegetative phase protein [Brassica juncea]
Length=241

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 187/241 (78%), Gaps = 18/241 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS H  LSKE+A+K+H LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDHALLSKEIAEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE+GLTRV+ETK E+++ EI+ LQRKG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALESGLTRVIETKSEKIMNEISYLQRKGMQLMDENKRLRQQGTQLTEENER  180

Query  749  -----FPVIADVEAG------LIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGL  892
                 +  + +   G       + EEGHSSESIT    + NS   P D + SD SL+LGL
Sbjct  181  LGQQIYNNVHERYGGGESENIAVYEEGHSSESITN---AGNSTGAPVDSESSDISLRLGL  237

Query  893  P  895
            P
Sbjct  238  P  238



>ref|XP_008363737.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Malus 
domestica]
 ref|XP_008363738.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Malus 
domestica]
 ref|XP_008363739.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Malus 
domestica]
Length=231

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 184/233 (79%), Gaps = 8/233 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDAD+ALIIFS+TGKLFE+ASS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADIALIIFSSTGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NLD++ QPSLELQL ENS + RLSKE+A K+H+LRQM+GEE+QGLS
Sbjct  61   SMKEILERHNLHSKNLDKLEQPSLELQLVENSNYSRLSKEIAAKSHQLRQMRGEEIQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQR----KGAELMNENKQLKQKMARING  742
            LEELQ+LEK LE GL  V+E K E+++ EI  LQR    +  +L  EN++L+Q++   + 
Sbjct  121  LEELQQLEKSLEAGLGGVVEKKSEKIMKEINDLQRNMNVQAMQLTEENERLRQQVVEKSN  180

Query  743  EKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
             +  V  D E  LI EEG SSES+ TN+C  NSGP  + D S TSLKLGLP +
Sbjct  181  GRRLVHVDSE-NLITEEGQSSESV-TNLCKSNSGP-QDYDNSVTSLKLGLPFS  230



>ref|NP_001240951.1| MADS-box protein SVP-like [Glycine max]
 ref|XP_006574408.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Glycine max]
 ref|XP_006574409.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Glycine max]
 gb|ABY78023.1| short vegetative phase-like protein [Glycine max]
 gb|KHN00417.1| MADS-box protein SVP [Glycine soja]
Length=227

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 187/231 (81%), Gaps = 8/231 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M REKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+V+CDADVALIIFS+TGKLFE++SS
Sbjct  1    MVREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVMCDADVALIIFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL ++ QPSLELQL ENS   RLSKEVA+K+H+LRQ++GE+LQGL+
Sbjct  61   SMKEILERHHLHSKNLARMEQPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMAR-INGEKF  751
            +EELQ+LE+ LE GL RV+E KGE++++EI  LQRKG  LM EN++LK+ +A  ING++ 
Sbjct  121  IEELQQLERSLETGLGRVIEKKGEKIMSEITDLQRKGMLLMEENERLKRHVAGIINGQRH  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLPIN  901
               A+ E   + +EG SSES+T     CNS   P+D + SDTSLKLGLP +
Sbjct  181  GG-AESE-NFVMDEGQSSESVTY---VCNSTGPPQDFESSDTSLKLGLPYS  226



>emb|CDX89487.1| BnaC04g35060D [Brassica napus]
Length=236

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 186/239 (78%), Gaps = 18/239 (8%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALI+FS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS + RLSKE+ADK+H+LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSENSRLSKEIADKSHQLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GLTRV+ETK E++++EI+ LQRKG +LM+ENK+L+Q   ++  E   
Sbjct  121  IEELQQLEKALEAGLTRVIETKSEKIMSEISDLQRKGMKLMDENKRLRQHGTQLTEENER  180

Query  755  VIADV-------------EAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLG  889
            +   +             E   + EEGHSSESIT    + NS   P D + SDTSL+LG
Sbjct  181  LGKQIYNNMHERYGGVESEKTAVYEEGHSSESITN---AGNSTGAPVDSESSDTSLRLG  236



>gb|AHY82603.1| short vegetative phase protein [Brassica juncea]
Length=241

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 187/241 (78%), Gaps = 18/241 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS H  LSKE+A+K+H LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDHALLSKEIAEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE+GLTRV+ETK E+++ EI+ LQRKG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALESGLTRVIETKSEKIMNEISYLQRKGMQLMDENKRLRQQGTQLTEENER  180

Query  749  -----FPVIADVEAGL------IPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGL  892
                 +  + +   G       + EEGHSSESIT    + NS   P D + SD SL+LGL
Sbjct  181  LGQQIYNNVHERYGGCESENIAVYEEGHSSESITN---AGNSTGAPVDSESSDISLRLGL  237

Query  893  P  895
            P
Sbjct  238  P  238



>ref|XP_006574407.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Glycine max]
Length=234

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 147/231 (64%), Positives = 187/231 (81%), Gaps = 8/231 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M REKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+V+CDADVALIIFS+TGKLFE++SS
Sbjct  8    MVREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVMCDADVALIIFSSTGKLFEYSSS  67

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL ++ QPSLELQL ENS   RLSKEVA+K+H+LRQ++GE+LQGL+
Sbjct  68   SMKEILERHHLHSKNLARMEQPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGLN  127

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMAR-INGEKF  751
            +EELQ+LE+ LE GL RV+E KGE++++EI  LQRKG  LM EN++LK+ +A  ING++ 
Sbjct  128  IEELQQLERSLETGLGRVIEKKGEKIMSEITDLQRKGMLLMEENERLKRHVAGIINGQRH  187

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLPIN  901
               A+ E   + +EG SSES+T     CNS   P+D + SDTSLKLGLP +
Sbjct  188  GG-AESE-NFVMDEGQSSESVTY---VCNSTGPPQDFESSDTSLKLGLPYS  233



>ref|XP_009345714.1| PREDICTED: MADS-box protein JOINTLESS isoform X1 [Pyrus x bretschneideri]
 ref|XP_009345715.1| PREDICTED: MADS-box protein JOINTLESS isoform X1 [Pyrus x bretschneideri]
Length=231

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 183/231 (79%), Gaps = 8/231 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDAD+ALIIFS+TGKLFE+AS+
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADIALIIFSSTGKLFEYASA  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NLD++ QPSLELQL ENS + RLSKE+A K+H+LRQM+GEE+QGLS
Sbjct  61   SMKEILERHNLHSKNLDKLEQPSLELQLVENSNYSRLSKEIAAKSHQLRQMRGEEIQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQR----KGAELMNENKQLKQKMARING  742
            LEELQ+LEK LE GL  V+E K E+++ EI  LQR    +  +L  EN++L+Q++   + 
Sbjct  121  LEELQQLEKSLEAGLGGVVEKKSEKIMKEINDLQRNMNVQAMQLTEENERLRQQVVEKSN  180

Query  743  EKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
             +  V  D E  LI EEG SSES+ TN+C  NSGP  + D S TSLKLGLP
Sbjct  181  GRRLVHVDSE-NLITEEGQSSESV-TNLCKSNSGP-QDYDSSVTSLKLGLP  228



>gb|AFM77907.1| MADS-box protein SVP [Brassica napus]
Length=241

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 187/241 (78%), Gaps = 18/241 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALI+FS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS H  LSKE+A+K+H LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDHALLSKEIAEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE+GLTRV+ETK E+++ EI+ LQRKG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALESGLTRVIETKSEKIMNEISYLQRKGMQLMDENKRLRQQGTQLTEENER  180

Query  749  -----FPVIADVEAG------LIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGL  892
                 +  + +   G       + EEGHSSESIT    + NS   P D + SD SL+LGL
Sbjct  181  LGQQIYNNVHERYGGGESENIAVYEEGHSSESITN---AGNSTGAPVDSESSDISLRLGL  237

Query  893  P  895
            P
Sbjct  238  P  238



>ref|XP_004250145.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Solanum 
lycopersicum]
Length=242

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 186/240 (78%), Gaps = 15/240 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF+++SS
Sbjct  1    MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK IL +  LHS NL++++QPSLELQL ENS + RLSKE+++K+H LRQM+GEELQGL+
Sbjct  61   SMKQILERRDLHSKNLEKLDQPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARING----  742
            +EELQ+LE+ LE GL+RV+E KG++++ EI  LQ+KG  LM EN++L+Q++  I+     
Sbjct  121  IEELQQLERSLETGLSRVIERKGDKIMREINQLQQKGMHLMEENEKLRQQVMEISNNNNN  180

Query  743  ------EKFPVIADVEAGL---IPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                  E   VI + E G      E+G SSES+ TN C+    P  +DD SDTSLKLGLP
Sbjct  181  NNNGYREAGVVIFEPENGFNNNNNEDGQSSESV-TNPCNSIDPPPQDDDSSDTSLKLGLP  239



>gb|AFK36521.1| unknown [Lotus japonicus]
Length=227

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 184/228 (81%), Gaps = 4/228 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MA EKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVAL++FS+TGKLFE+++ 
Sbjct  1    MAGEKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALVVFSSTGKLFEYSNL  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL ++ QPSLELQL ENS   RL+KEVA+K+  LRQ++GE+LQGL+
Sbjct  61   SMKEILERHHLHSKNLAKLEQPSLELQLVENSNCSRLNKEVAEKSRLLRQLRGEDLQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LE+ LE GL RV+E KGE+++ EI  LQ KG +LM EN++LK+ +A +      
Sbjct  121  IEELQQLERSLETGLGRVIEKKGEKIMNEINGLQIKGKQLMEENERLKRHVAGMISTGL-  179

Query  755  VIADVEAG-LIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            +  D E+  L+ EEGHSSES+ TNVC+  +GP  EDD SDTSLKLGLP
Sbjct  180  MHGDTESELLVMEEGHSSESV-TNVCNSTTGPPLEDDSSDTSLKLGLP  226



>gb|AAQ55452.1| short vegetative phase protein [Brassica rapa subsp. oleifera]
Length=241

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 144/240 (60%), Positives = 186/240 (78%), Gaps = 16/240 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS H  LSKE+A+K+H+LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDHALLSKEIAEKSHQLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GLTRV+ETK E++++EI+ LQRKG +LM+ENK+L+Q   ++  E   
Sbjct  121  IEELQQLEKALEAGLTRVIETKSEKIMSEISDLQRKGMKLMDENKRLRQHGTQLTEENER  180

Query  755  VIADV-------------EAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            +   +             E   + EEG SSESI TN  +    P+ + + SDTSL+LGLP
Sbjct  181  LGKQIYNNMHERYGGVESEKTAVYEEGQSSESI-TNAGNSTGAPV-DSESSDTSLRLGLP  238



>gb|AFM77906.1| MADS-box protein SVP [Brassica juncea]
Length=241

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 189/241 (78%), Gaps = 18/241 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALI+FS+TGKLFEF +S
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLFEFCNS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS + RLSKE+ADK+H+LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDNSRLSKEIADKSHQLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE GLTRV+ETK E++++EI+ LQRKG +LM+ENK+L+Q   ++  E   
Sbjct  121  IEELQQLEKALEAGLTRVIETKSEKIMSEISDLQRKGMKLMDENKRLRQHGTQLTEENER  180

Query  749  -----FPVIADVEAGL------IPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGL  892
                 +  + +   G+      + EEG SSESIT    + NS   P D + SDTSL+LGL
Sbjct  181  LGKQIYNNMHERYGGVESEKTAVYEEGQSSESITN---AGNSTGAPVDSESSDTSLRLGL  237

Query  893  P  895
            P
Sbjct  238  P  238



>ref|XP_010520749.1| PREDICTED: MADS-box protein AGL24-like isoform X1 [Tarenaya hassleriana]
Length=229

 Score =   231 bits (588),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 183/230 (80%), Gaps = 4/230 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+FKKAEEL+VLCDA+VALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  398  -NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
              M+D+L +Y LH+SNL++ N P L++QLENS  +RLSKEV DKT +LRQ++GE+LQGLS
Sbjct  61   RRMRDMLARYNLHASNLNKFNPPPLDIQLENSNLVRLSKEVEDKTKQLRQLRGEDLQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            L++LQ+LEK +E+GL RVLE KGE ++ EI++L+++GA L  EN +LK+++  +   K  
Sbjct  121  LDDLQRLEKLVESGLGRVLEKKGESIMGEISSLEKRGAALAEENSKLKERLMTLERGKTT  180

Query  755  VIADVEAGLIPEEGHSSES-ITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
               + E  +   +G S ES +TTN+ S  SG LP DD SDTSLKL LP +
Sbjct  181  AFGEGEI-VATRDGISLESALTTNLSSSASGSLP-DDFSDTSLKLALPFS  228



>ref|XP_007205845.1| hypothetical protein PRUPE_ppa011063mg [Prunus persica]
 gb|EMJ07044.1| hypothetical protein PRUPE_ppa011063mg [Prunus persica]
Length=225

 Score =   230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 182/225 (81%), Gaps = 3/225 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKA+EL+VLCDAD+ALIIFS+TGKLFE+ASS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAQELSVLCDADIALIIFSSTGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LH+ NL ++ QPSLELQL ENS +  LSKE+  ++ +LRQ++GEE+QGL+
Sbjct  61   SMKEILERHNLHAKNLSKIEQPSLELQLVENSNYSALSKEITAQSQQLRQIRGEEIQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE GL RV+E KGE+++ EI+ L+     L+ EN++L+Q++   +  + P
Sbjct  121  LEELQQLEKSLEAGLGRVIEKKGEKIMKEISDLESNAMRLVEENERLRQQVLEKHNSQKP  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
            V AD E  ++ EEG SSES+TTN+C+ NS P  + + SDTSLKLG
Sbjct  181  VRADSE-NIVMEEGQSSESVTTNLCNSNSAP-QDYESSDTSLKLG  223



>ref|XP_002867660.1| hypothetical protein ARALYDRAFT_492389 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43919.1| hypothetical protein ARALYDRAFT_492389 [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 186/227 (82%), Gaps = 11/227 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQV-NQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
             M+DILG+Y LH+SN++++ + PS  LQLEN    RLSKEV DKT +LR+++GE+L GL+
Sbjct  61   RMRDILGRYSLHASNINRLMDPPSTHLQLENCNLSRLSKEVEDKTKQLRKLRGEDLDGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++ENK+L+ K+  +  E+  
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGECVMSQISSLEKRGSELVDENKRLRDKLETL--ERAK  178

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            +I  +EA         +ES+TTNV S +SG   EDD SDTSLKLGLP
Sbjct  179  LITFMEA-------LETESVTTNVSSYDSGAPLEDD-SDTSLKLGLP  217



>gb|EYU30938.1| hypothetical protein MIMGU_mgv1a021820mg [Erythranthe guttata]
Length=235

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/234 (62%), Positives = 185/234 (79%), Gaps = 8/234 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKI+N+TARQVTFSKRRRGLFKKAEEL++LCDADV LIIFS+TGKLFE++S+
Sbjct  1    MAREKIKIKKIENVTARQVTFSKRRRGLFKKAEELSILCDADVGLIIFSSTGKLFEYSST  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MKDI+ ++ LHS NL+++ QPSLELQL E+S    L+KEVA+++ +LR+M+GEEL GL 
Sbjct  61   SMKDIVERHNLHSKNLNRLEQPSLELQLVEDSTISWLNKEVAERSQQLRRMRGEELDGLG  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI--NG-E  745
            +EEL +LEK LE GL RV+E KGE+++ EI  LQ KG +LM EN+ L+Q++A I  NG  
Sbjct  121  IEELHRLEKSLELGLNRVMEKKGEKIMNEINQLQEKGRQLMEENRLLRQQVADIENNGVG  180

Query  746  KFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED--DCSDTSLKLGLPIN  901
            K  V  + E  +  EEG SSES+  NVC+ ++G  P+D  DCSDTSLKLGL  N
Sbjct  181  KKTVTTESEKMVYDEEGQSSESV-ANVCN-SAGEHPQDYYDCSDTSLKLGLVYN  232



>gb|AFA37967.1| SVP1 [Actinidia chinensis]
Length=227

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 185/227 (81%), Gaps = 4/227 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKI+KI+N TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF ++S+
Sbjct  1    MAREKIKIRKINNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFHYSST  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK IL ++ +HS NL+++ QPS ELQL ENS + RLSKEV +K+H+LR+M+GEELQGL+
Sbjct  61   DMKGILERHNVHSKNLEKLEQPSTELQLVENSNYTRLSKEVVEKSHQLRKMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LE+ LE GL RV+E KGE+++ EI  LQ+KG  LM+EN++L+Q++      +  
Sbjct  121  IEELQQLERSLEAGLGRVIEKKGEKIMNEITHLQQKGMHLMDENERLRQQVMEACKARKH  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
               D +  +I E+G SSES+ TN+C+ ++GP+ + + SDTSLKLGLP
Sbjct  181  SATDSD-NVINEQGQSSESV-TNICN-STGPMQDYESSDTSLKLGLP  224



>ref|XP_009631749.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Nicotiana 
tomentosiformis]
Length=233

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 182/231 (79%), Gaps = 6/231 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M ++KI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF+++SS
Sbjct  1    MVKDKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ L S NL ++ QPSLELQL ENS + RL+KE++ K+H+LRQM+GEELQGLS
Sbjct  61   SMKEILERHNLLSKNLQKLEQPSLELQLVENSDYARLTKEISQKSHQLRQMRGEELQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI--NGEK  748
            +E+LQ+LE+ LE GL+RV+E KG++++ EI  LQ KG +LM EN++LKQ++  I  N  K
Sbjct  121  VEQLQQLERSLEAGLSRVIENKGDKIMKEINQLQVKGMQLMEENERLKQQVMEISNNSSK  180

Query  749  FP--VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
             P  V+A     +  EE  SSES+  N C+  S P  ED  SDTSLKLGLP
Sbjct  181  HPAIVVAVGSENIYYEERQSSESV-NNACNSTSPPPLEDHSSDTSLKLGLP  230



>gb|AFG73587.1| short vegetative phase protein [Brassica napus]
Length=241

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 186/240 (78%), Gaps = 16/240 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS H  LSKE+A+K+H LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDHALLSKEIAEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE+GL RV+ETK E+++ EI+ LQRKG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALESGLARVIETKSEKIMNEISYLQRKGMQLMDENKRLRQQGTQLTEENER  180

Query  749  -----FPVIADVEAG------LIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                 +  + +   G       + EEGHSSESI TN  +    P+  ++ SD SL+LGLP
Sbjct  181  LGQQIYNNVHERYGGGESENIAVYEEGHSSESI-TNAGNSTGAPVDSEN-SDISLRLGLP  238



>gb|AAQ55451.1| short vegetative phase protein [Brassica rapa subsp. oleifera]
Length=241

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 185/240 (77%), Gaps = 16/240 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS H  LSKE+A+K+H LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDHALLSKEIAEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE+GLTRV+ETK E++++EI+ LQRKG +LM+ENK+L+Q   ++  E   
Sbjct  121  IEELQQLEKALESGLTRVIETKSEKIMSEISDLQRKGMKLMDENKRLRQHGTQLTEENER  180

Query  755  VIADV-------------EAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            +   +             E   + EEG SSESI TN  +    P+ + + SD SL+LGLP
Sbjct  181  LGKQIYNNMHERYGGVESEKTAVYEEGQSSESI-TNAGNSTGAPV-DSESSDISLRLGLP  238



>ref|NP_194185.1| MADS-box protein AGL24 [Arabidopsis thaliana]
 sp|O82794.1|AGL24_ARATH RecName: Full=MADS-box protein AGL24; AltName: Full=Protein AGAMOUS-LIKE 
24 [Arabidopsis thaliana]
 gb|AAC63139.1| MADS-box Protein [Arabidopsis thaliana]
 gb|AAC63140.1| MADS-box protein [Arabidopsis thaliana]
 emb|CAA23009.1| MADS-box protein AGL24 [Arabidopsis thaliana]
 emb|CAB79364.1| MADS-box protein AGL24 [Arabidopsis thaliana]
 gb|ABE77409.1| At4g24540 [Arabidopsis thaliana]
 dbj|BAH30535.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84922.1| MADS-box protein AGL24 [Arabidopsis thaliana]
Length=220

 Score =   228 bits (580),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 182/227 (80%), Gaps = 11/227 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQV-NQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
             M+DILG+Y LH+SN++++ + PS  L+LEN    RLSKEV DKT +LR+++GE+L GL+
Sbjct  61   RMRDILGRYSLHASNINKLMDPPSTHLRLENCNLSRLSKEVEDKTKQLRKLRGEDLDGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE V+++I +L+++G+EL++ENK+L+ K+  +   K  
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGECVMSQIFSLEKRGSELVDENKRLRDKLETLERAKLT  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
             +         +E   +ES+TTNV S +SG   EDD SDTSLKLGLP
Sbjct  181  TL---------KEALETESVTTNVSSYDSGTPLEDD-SDTSLKLGLP  217



>gb|AFM77897.1| MADS-box protein AGL24 [Brassica napus]
Length=221

 Score =   228 bits (580),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 183/227 (81%), Gaps = 10/227 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQV-NQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
             M+DILG+Y LH+SN+D+V  QPS   Q+E+    RLS+EV DKT +LR+++GE+L+GL+
Sbjct  61   RMRDILGRYNLHASNIDRVMGQPSPYHQVEDCNLSRLSQEVEDKTKQLRKLRGEDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE ++++I++L+++G+EL++ENK+L++++         
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGEFLMSQISSLEKRGSELVDENKRLRERV---------  171

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  ++   +  +E   +ES TTNV S  SG   EDD SDTSLKLGLP
Sbjct  172  VTLEMAKTMALKEAVETESATTNVSSYESGAPLEDDFSDTSLKLGLP  218



>gb|AFM77905.1| MADS-box protein SVP [Brassica juncea]
Length=241

 Score =   228 bits (582),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 185/241 (77%), Gaps = 18/241 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS H  LSKE+A+K+H LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDHALLSKEIAEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE GLTRV+ETK E+++ EI+ LQRKG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALEAGLTRVIETKSEKIMNEISYLQRKGMQLMDENKRLRQQGTQLTEENER  180

Query  749  -----FPVIADVEAG------LIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGL  892
                 +  + +   G       + EEG SSESIT    + NS   P D + SD SL+LGL
Sbjct  181  LGQQIYNNVHERYGGGESENIAVYEEGQSSESITN---AGNSTGAPVDSESSDISLRLGL  237

Query  893  P  895
            P
Sbjct  238  P  238



>ref|XP_006573007.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Glycine max]
Length=203

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 143/230 (62%), Positives = 176/230 (77%), Gaps = 30/230 (13%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFE++SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL ++ QPSLELQL ENS   RLSKEVA+K+H+LRQ++GE+LQGL+
Sbjct  61   SMKEILERHHLHSKNLARMEQPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LE  LE GL R++E KGE++++EIA LQRKG  LM EN++LK+           
Sbjct  121  IEELQQLEMSLETGLGRIIEKKGEKIMSEIADLQRKGMLLMEENERLKR-----------  169

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLPIN  901
                          HSSES+T     CNS  LP+D + SDTSLKLGLP +
Sbjct  170  --------------HSSESVTY---VCNSTGLPQDYESSDTSLKLGLPYS  202



>emb|CDY13746.1| BnaA09g42480D [Brassica napus]
Length=236

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 144/239 (60%), Positives = 185/239 (77%), Gaps = 18/239 (8%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS H  LSKE+A+K+H LRQM+GEELQGL+
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDHALLSKEIAEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE+GLTRV+ETK E+++ EI+ LQRKG +LM+ENK+L+Q+  ++  E   
Sbjct  121  IEELQQLEKALESGLTRVIETKSEKIMNEISYLQRKGMQLMDENKRLRQQGTQLTEENER  180

Query  749  -----FPVIADVEAG------LIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLG  889
                 +  + +   G       + EEGHSSESIT    + NS   P D + SD SL+LG
Sbjct  181  LGQQIYNNVHERYGGGESENIAVYEEGHSSESITN---AGNSTGAPVDSESSDISLRLG  236



>ref|XP_006282462.1| hypothetical protein CARUB_v10005653mg [Capsella rubella]
 gb|EOA15360.1| hypothetical protein CARUB_v10005653mg [Capsella rubella]
Length=220

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 185/227 (81%), Gaps = 11/227 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVAL+IFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALVIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
             M+DILGKY LH+SN+++ ++ PS  LQLEN    RLSKE+ DKT +LR+++GE+L GL+
Sbjct  61   RMRDILGKYNLHASNINKMMDPPSTHLQLENCNLSRLSKEIEDKTKQLRKLRGEDLDGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++ENK+L++K+     E+  
Sbjct  121  LEELQRLEKMLESGLSRVTEKKGECVMSQISSLEKRGSELVDENKRLREKLETF--ERAK  178

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            ++A  EA         +ES TTN+ S +SG  P +D SDTSLKLGLP
Sbjct  179  MMASKEA-------VETESATTNLSSYDSGA-PLEDESDTSLKLGLP  217



>emb|CDX76906.1| BnaC08g34920D [Brassica napus]
Length=236

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 184/239 (77%), Gaps = 18/239 (8%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+++L ++ L S NL++++QPSLELQL ENS H  LSKE+A K+H LRQM+GEELQGLS
Sbjct  61   SMREVLERHNLQSKNLEKLDQPSLELQLVENSDHALLSKEIAGKSHRLRQMRGEELQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE+GLTRV+ETK E+++ EI+ LQRKG +LM+ NK+L+Q+  ++ GE   
Sbjct  121  IEELQQLEKALESGLTRVIETKSEKIMNEISYLQRKGMQLMDVNKRLRQQGTQLTGENER  180

Query  749  -----FPVIADVEAG------LIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLG  889
                 F  + +   G       + E+GHSSESIT    + NS   P D + SD SL+LG
Sbjct  181  LGQQIFNNVHERYGGGESENTAVYEQGHSSESITN---AGNSTGAPVDSESSDISLRLG  236



>ref|XP_006413417.1| hypothetical protein EUTSA_v10026757mg [Eutrema salsugineum]
 gb|ESQ54870.1| hypothetical protein EUTSA_v10026757mg [Eutrema salsugineum]
Length=221

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 182/227 (80%), Gaps = 10/227 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDNITARQVTFSKRRRG+FKKA+EL++LCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSILCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQV-NQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
             M+DILG+Y LH+SN+D++ +QPSL  Q EN    RLSK++ DKT +LR+++GE+L+GL+
Sbjct  61   RMRDILGRYNLHASNIDKLMDQPSLNHQPENCNLSRLSKDIEDKTKQLRKLRGEDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++EN++L++K+  +   K  
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREKLVTLERAKMM  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                       +E   +ES TTN+ S +S    EDD SDTSLKLGLP
Sbjct  181  AF---------KEAMETESATTNMSSYDSEAPLEDDFSDTSLKLGLP  218



>ref|XP_010448551.1| PREDICTED: MADS-box protein AGL24-like isoform X2 [Camelina sativa]
Length=220

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 182/227 (80%), Gaps = 11/227 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
             M+DILG+Y LH+SN+++ ++ PS  LQLEN    RLSKE+ DKT +LR+++GE+L GL+
Sbjct  61   RMRDILGRYNLHASNINKLIDPPSTHLQLENCNLSRLSKEIEDKTKQLRKLRGEDLDGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KG+ V+++I++L+++G+EL++ENK+L++K+      K  
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGDCVMSQISSLEKRGSELVDENKRLREKLETFERSKM-  179

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                    L  +E   +ES TTNV S +SG  P +D SDTSLKLGLP
Sbjct  180  --------LAFKEAVETESATTNVSSYDSGA-PIEDESDTSLKLGLP  217



>dbj|BAB70736.1| putative MADS-domain transcription factor MpMADS1 [Magnolia praecocissima]
Length=229

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 188/232 (81%), Gaps = 8/232 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAR KI+IKKIDN+TARQVTFSKRRRGLFKKAEEL++LCDA+VALIIFSATGKLFE++SS
Sbjct  1    MARGKIQIKKIDNVTARQVTFSKRRRGLFKKAEELSILCDAEVALIIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVN-QPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+I+ ++ +HS NL +++ QPSLELQLENS + RLSK+VA+K+H +RQM+GE++QGL+
Sbjct  61   SMKEIIERHTMHSKNLQKLDQQPSLELQLENSNYNRLSKQVAEKSHLIRQMRGEDIQGLT  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQK---MARINGE  745
            +EELQKLEK LE GL+RV+E K E+++ EI+ LQ KG +LM EN +L+Q+   M+R + +
Sbjct  121  VEELQKLEKTLETGLSRVMERKAEQIMKEISGLQIKGVKLMEENMRLRQRIIEMSRGDSK  180

Query  746  KFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
                I + E  ++ E+G SS+S+T    +CNSG   + + SDTSLKLG+P +
Sbjct  181  GDRQIIESEI-VVNEDGQSSDSVTN---ACNSGAPQDYESSDTSLKLGVPFS  228



>sp|Q9FUY6.1|JOIN_SOLLC RecName: Full=MADS-box protein JOINTLESS; AltName: Full=LeMADS 
[Solanum lycopersicum]
 gb|AAG09811.1| MADS-box transcription factor JOINTLESS [Solanum lycopersicum]
Length=265

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 145/239 (61%), Positives = 185/239 (77%), Gaps = 15/239 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF+++SS
Sbjct  1    MAREKIQIKKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK IL +  LHS NL++++QPSLELQL ENS + RLSKE+++K+H LRQM+GEELQGL+
Sbjct  61   SMKQILERRDLHSKNLEKLDQPSLELQLVENSNYSRLSKEISEKSHRLRQMRGEELQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARING----  742
            +EELQ+LE+ LE GL+RV+E KG++++ EI  LQ+KG  LM EN++L+Q++  I+     
Sbjct  121  IEELQQLERSLETGLSRVIERKGDKIMREINQLQQKGMHLMEENEKLRQQVMEISNNNNN  180

Query  743  ------EKFPVIADVEAGL---IPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGL  892
                  E   VI + E G      E+G SSES+ TN C+    P  +DD SDTSLKLGL
Sbjct  181  NNNGYREAGVVIFEPENGFNNNNNEDGQSSESV-TNPCNSIDPPPQDDDSSDTSLKLGL  238



>ref|XP_010523348.1| PREDICTED: MADS-box protein AGL24 isoform X2 [Tarenaya hassleriana]
Length=229

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 180/229 (79%), Gaps = 2/229 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+FKKAEEL+VLCDA+VALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
             M+DIL +Y LH+SNL+++N P L LQ ENS   RLSK++ DKT +LRQ++GE+LQGLSL
Sbjct  61   RMRDILARYNLHASNLNKLN-PPLALQPENSNLARLSKDIEDKTRQLRQLRGEDLQGLSL  119

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            ++LQ+LEK +E+GL RV E KGERV+ EI++L+R+GAEL  EN  L+Q++  +   K   
Sbjct  120  DDLQRLEKLVESGLGRVREKKGERVMGEISSLERRGAELEEENNNLRQRLMMLERGKTAA  179

Query  758  IADVEAGLIPEEGHSSES-ITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
              + E     +EG S ES +TTNV S +S    +DD SDTSLKL LP +
Sbjct  180  FREGETVAGVQEGMSLESAVTTNVSSSSSASPLDDDFSDTSLKLALPFS  228



>ref|XP_010439015.1| PREDICTED: MADS-box protein AGL24 isoform X2 [Camelina sativa]
Length=220

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 181/227 (80%), Gaps = 11/227 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
             M+DILG+Y LH+SN+++ ++ PS  LQLEN    RLSKEV DKT +LR+++GE+L GL+
Sbjct  61   RMRDILGRYNLHASNINKLIDPPSTHLQLENCNLSRLSKEVEDKTKQLRKLRGEDLDGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G++L++ENK+L++K+      K  
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGECVMSQISSLEKRGSDLVDENKRLREKLETFERSKMV  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                       +E   +ES TTN+ S +SG  P +D SDTSLKLGLP
Sbjct  181  AF---------KEAVETESATTNMSSYDSGA-PLEDESDTSLKLGLP  217



>ref|XP_009137455.1| PREDICTED: MADS-box protein AGL24-like isoform X2 [Brassica rapa]
Length=221

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 183/227 (81%), Gaps = 10/227 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREK +IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKRRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQV-NQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
             MKDILG+Y LH+SN+++V  QPS   Q+EN    RLS+EV DKT +LR+++GE+L+GL+
Sbjct  61   RMKDILGRYNLHASNINKVMGQPSPYNQVENCNLSRLSQEVEDKTKQLRKLRGEDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE ++++I++L+++G+EL++EN++L++++         
Sbjct  121  LEELQRLEKMLESGLSRVSEKKGEFLMSQISSLEKRGSELVDENRRLRERV---------  171

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  ++   +  +E   +ES TTNV S +SG   EDD SDTSLKLGLP
Sbjct  172  VTMEMAKTMALKEAVETESATTNVSSYDSGAPLEDDFSDTSLKLGLP  218



>emb|CDY03445.1| BnaC01g16370D [Brassica napus]
Length=221

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 137/227 (60%), Positives = 182/227 (80%), Gaps = 10/227 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+ KKA EL++LCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+DILG+Y LH+SN+++ +  PS   QLEN    RLSKEV DKT +LRQM+GE+L+GL+
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLENCNLSRLSKEVEDKTKQLRQMRGEDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++EN++L++++         
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL---------  171

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  ++   +  +E   +ES TTNV S +SG   EDD SDTSLKLGLP
Sbjct  172  VTLEMAKTMALKEAVETESATTNVSSYDSGAPIEDDFSDTSLKLGLP  218



>gb|EPS73619.1| hypothetical protein M569_01137 [Genlisea aurea]
Length=223

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 185/230 (80%), Gaps = 13/230 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN+TARQVTFSKRRRGLFKKAEELAVLCDADVALI+FS++GKLFE+ASS
Sbjct  1    MAREKIQIRKIDNVTARQVTFSKRRRGLFKKAEELAVLCDADVALIVFSSSGKLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LH+ NLD+++QPSLELQL E+S +  LSKEVA++T++LR+M+GEEL  LS
Sbjct  61   SMKEILERHDLHAKNLDKMDQPSLELQLVEDSNYSMLSKEVAERTNQLRRMRGEELNELS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            ++ELQ+LEK +E+GL+RV+E KGER++ EI  LQ KG +LM EN +LK+++  + G +  
Sbjct  121  IQELQQLEKSIESGLSRVMEKKGERIMEEIKRLQEKGKQLMEENVRLKKRVVDM-GRRSM  179

Query  755  VIADVEAG----LIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLG  889
            ++ D        L  +EG SSES+     + +SGP P+D + SDTSLKLG
Sbjct  180  MMNDATMADSLNLAYDEGQSSESV-----NASSGP-PQDCESSDTSLKLG  223



>gb|AAF66690.1|AF144623_1 MADS-box transcription factor [Canavalia lineata]
Length=222

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 174/227 (77%), Gaps = 7/227 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAR+KIKIKKIDN+TARQVTFSKRRRG+FKKAEEL+VLCDA+V LIIFSATGKLFE+ SS
Sbjct  1    MARQKIKIKKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVGLIIFSATGKLFEYPSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKDI+ KY  HS + +Q+ +P   LQ+E  +   LSKEVA++  +LRQMKGE+ QGL+L
Sbjct  61   SMKDIITKYNQHSHDNNQLGRPQ-NLQVEQCVD--LSKEVAERNQQLRQMKGEDFQGLNL  117

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            ++LQ+LEK LE GL RV ETK +R++ EI  L +KG +L  ENK LKQKMA +   K   
Sbjct  118  DDLQQLEKTLETGLERVNETKEKRIMDEIVALHKKGLKLEEENKHLKQKMAMLCMGKSSF  177

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
            + D +  L  +E  SSES+  NVCSCNSGP  EDD SDTSLKLGLP 
Sbjct  178  LVDSDITL--QEVVSSESM--NVCSCNSGPSLEDDSSDTSLKLGLPF  220



>gb|AFM77900.1| MADS-box protein AGL24 [Brassica napus]
Length=221

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 181/227 (80%), Gaps = 10/227 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+ KKA EL++LCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+DILG+Y LH+SN+++ +  PS   QLEN    RLSKEV DKT +LRQM+G +L+GL+
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLENCNLSRLSKEVEDKTKQLRQMRGGDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++EN++L++++         
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL---------  171

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  ++   +  +E   +ES TTNV S +SG   EDD SDTSLKLGLP
Sbjct  172  VTLEMAKTMALKEAVETESATTNVSSYDSGAPIEDDFSDTSLKLGLP  218



>gb|AGW23342.1| MADS box protein MADS40 [Gossypium hirsutum]
Length=225

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 182/227 (80%), Gaps = 6/227 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTF+KRRRGLFKKAEELA+LCDADVALIIFS+TGKLF++ASS
Sbjct  1    MAREKIQIKKIDNSTARQVTFAKRRRGLFKKAEELAILCDADVALIIFSSTGKLFDYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ L S NL+++ QP L L+L E+S    L+ E+A+K+H+LRQM+GEEL GL+
Sbjct  61   SMKEILERHHLRSKNLEKLEQPCLGLKLVEHSNQSMLTMEIAEKSHQLRQMRGEELHGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GL+RV+E KG+R++ EI  LQRKG +LM EN++LKQ++  ING +  
Sbjct  121  IEELQQLEKSLEIGLSRVMEKKGQRIMREIKDLQRKGMQLMEENERLKQQI--INGPR-Q  177

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  D +  +  EEG SSES+ TNVC+ N  P  + + S TSLKLGLP
Sbjct  178  VTGDSDNIIFGEEGQSSESV-TNVCTSNGNP-HDYESSVTSLKLGLP  222



>gb|AFM77902.1| MADS-box protein AGL24 [Brassica juncea]
Length=221

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 182/227 (80%), Gaps = 10/227 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+FKKA+EL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQV-NQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
             M+DILG+Y L +SN+D+V  QPS   Q+E+    RLS+EV DKT +LR+++GE+L+GL+
Sbjct  61   RMRDILGRYNLQASNIDRVMGQPSPYHQVEDCNLSRLSQEVEDKTKQLRKLRGEDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE ++++I++L+++G+EL++ENK+L++++         
Sbjct  121  LEELQRLEKLLESGLSRVSEKKGEFLMSQISSLEKRGSELVDENKRLRERV---------  171

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  ++   +  +E   +ES TTNV S  SG   EDD SDTSLKLGLP
Sbjct  172  VTLEMAKTMALKEAVETESATTNVSSYESGAPLEDDFSDTSLKLGLP  218



>ref|XP_010523346.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Tarenaya hassleriana]
 ref|XP_010523347.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Tarenaya hassleriana]
Length=230

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 178/229 (78%), Gaps = 1/229 (0%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+FKKAEEL+VLCDA+VALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
             M+DIL +Y LH+SNL+++N P    Q ENS   RLSK++ DKT +LRQ++GE+LQGLSL
Sbjct  61   RMRDILARYNLHASNLNKLNPPLALQQPENSNLARLSKDIEDKTRQLRQLRGEDLQGLSL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            ++LQ+LEK +E+GL RV E KGERV+ EI++L+R+GAEL  EN  L+Q++  +   K   
Sbjct  121  DDLQRLEKLVESGLGRVREKKGERVMGEISSLERRGAELEEENNNLRQRLMMLERGKTAA  180

Query  758  IADVEAGLIPEEGHSSES-ITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
              + E     +EG S ES +TTNV S +S    +DD SDTSLKL LP +
Sbjct  181  FREGETVAGVQEGMSLESAVTTNVSSSSSASPLDDDFSDTSLKLALPFS  229



>ref|XP_009137453.1| PREDICTED: MADS-box protein AGL24-like isoform X1 [Brassica rapa]
 ref|XP_009137454.1| PREDICTED: MADS-box protein AGL24-like isoform X1 [Brassica rapa]
Length=222

 Score =   223 bits (568),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 137/228 (60%), Positives = 183/228 (80%), Gaps = 11/228 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREK +IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKRRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQV-NQPS-LELQLENSLHMRLSKEVADKTHELRQMkgeelqgl  571
             MKDILG+Y LH+SN+++V  QPS    Q+EN    RLS+EV DKT +LR+++GE+L+GL
Sbjct  61   RMKDILGRYNLHASNINKVMGQPSPYNQQVENCNLSRLSQEVEDKTKQLRKLRGEDLEGL  120

Query  572  sleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKF  751
            +LEELQ+LEK LE+GL+RV E KGE ++++I++L+++G+EL++EN++L++++        
Sbjct  121  NLEELQRLEKMLESGLSRVSEKKGEFLMSQISSLEKRGSELVDENRRLRERV--------  172

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
             V  ++   +  +E   +ES TTNV S +SG   EDD SDTSLKLGLP
Sbjct  173  -VTMEMAKTMALKEAVETESATTNVSSYDSGAPLEDDFSDTSLKLGLP  219



>gb|AFM77901.1| MADS-box protein AGL24 [Brassica napus]
Length=221

 Score =   223 bits (567),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 181/227 (80%), Gaps = 10/227 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+ KKA EL++LCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+DILG+Y LH+SN+++ +  PS   QL+N    RLSKEV DKT +LRQM+G +L+GL+
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLDNCNLSRLSKEVEDKTKQLRQMRGGDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++EN++L++++         
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL---------  171

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  ++   +  +E   +ES TTNV S +SG   EDD SDTSLKLGLP
Sbjct  172  VTLEMAKTMALKEAVETESATTNVSSYDSGAPIEDDFSDTSLKLGLP  218



>ref|NP_001154528.1| MADS-box protein SVP [Arabidopsis thaliana]
 gb|ABU95407.1| short vegetative phase [Arabidopsis thaliana]
 gb|AEC07321.1| MADS-box protein SVP [Arabidopsis thaliana]
Length=235

 Score =   223 bits (568),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 183/240 (76%), Gaps = 22/240 (9%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF     
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLF-----  55

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEELQGL 
Sbjct  56   DMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLD  115

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GLTRV+ETK +++++EI+ LQ+KG +LM+ENK+L+Q+  ++  E   
Sbjct  116  IEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQGTQLTEENER  175

Query  755  V------------IADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLP  895
            +             A+ E   + EEG SSESIT    + NS   P D + SDTSL+LGLP
Sbjct  176  LGMQICNNVHAHGGAESENAAVYEEGQSSESITN---AGNSTGAPVDSESSDTSLRLGLP  232



>ref|XP_010926365.1| PREDICTED: MADS-box protein JOINTLESS-like [Elaeis guineensis]
 ref|XP_010926366.1| PREDICTED: MADS-box protein JOINTLESS-like [Elaeis guineensis]
Length=228

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 179/228 (79%), Gaps = 3/228 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEELA+LCDADVALIIFS+TGKLFEF+SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELAILCDADVALIIFSSTGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MK+IL K+ LHS NL +V  PSL+L LENS + RL K+VA+ + +LRQM+GEELQGL++
Sbjct  61   SMKEILEKHSLHSKNLQKVEPPSLDLNLENSNYTRLDKQVAEASLQLRQMRGEELQGLTM  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            +ELQ+LEK LE GL+ VLE KG++++ +I  LQ+KG  LM EN++L++++  +      V
Sbjct  121  QELQQLEKNLETGLSCVLERKGQQIMEQINHLQQKGMHLMEENERLRKQVVEMARAGRRV  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            + D E  ++ E+G SSES+T    S    P   DD SDTSLKLGLP++
Sbjct  181  LTDSE-NVMYEDGQSSESVTN--ASQLVVPPNYDDSSDTSLKLGLPVH  225



>ref|XP_003613086.1| MADS-box transcription factor [Medicago truncatula]
 gb|AES96044.1| MADS-box transcription factor [Medicago truncatula]
Length=227

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 186/229 (81%), Gaps = 8/229 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKI+N TARQVTFSKRRRGL KKAEEL+VLCDADVALIIFS+TGKLFE+++ 
Sbjct  1    MAREKIQIKKIENSTARQVTFSKRRRGLIKKAEELSVLCDADVALIIFSSTGKLFEYSNL  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M++IL ++ LHS NL ++ +PSLELQL ENS   RLSKEVA K+H+LRQM+GE+LQGLS
Sbjct  61   SMREILERHHLHSKNLAKLEEPSLELQLVENSNCSRLSKEVAQKSHQLRQMRGEDLQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI-NGEKF  751
            LEELQ+LEK LE GL RV+ETKGE+++ EI  LQ KG +LM EN +LK+ ++ + NG+ F
Sbjct  121  LEELQQLEKSLEIGLGRVIETKGEKIMMEINELQTKGRQLMEENNRLKRHVSGMFNGKMF  180

Query  752  PVIADVEA-GLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                 VE+  ++ EEG SSES+ TNV + ++GP  + + SDTSLKLGLP
Sbjct  181  ---GGVESENMVTEEGQSSESV-TNVYN-STGPPQDYESSDTSLKLGLP  224



>gb|AFM77899.1| MADS-box protein AGL24 [Brassica napus]
Length=221

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 181/227 (80%), Gaps = 10/227 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+ KKA EL++LCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+DILG+Y LH+SN+++ +  PS   QLEN    RLSKEV DKT +LRQM+GE+L+GL+
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLENCNLSRLSKEVEDKTKQLRQMRGEDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++EN++L++++         
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL---------  171

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  ++   +  +E   +ES TTNV S +S    EDD SDTSLKLGLP
Sbjct  172  VTLEMAKTMALKEAVETESATTNVSSYDSAAPIEDDFSDTSLKLGLP  218



>ref|XP_010448550.1| PREDICTED: MADS-box protein AGL24-like isoform X1 [Camelina sativa]
Length=221

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 139/228 (61%), Positives = 182/228 (80%), Gaps = 12/228 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLEL-QLENSLHMRLSKEVADKTHELRQMkgeelqgl  571
             M+DILG+Y LH+SN+++ ++ PS  L QLEN    RLSKE+ DKT +LR+++GE+L GL
Sbjct  61   RMRDILGRYNLHASNINKLIDPPSTHLQQLENCNLSRLSKEIEDKTKQLRKLRGEDLDGL  120

Query  572  sleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKF  751
            +LEELQ+LEK LE+GL+RV E KG+ V+++I++L+++G+EL++ENK+L++K+      K 
Sbjct  121  NLEELQRLEKLLESGLSRVSEKKGDCVMSQISSLEKRGSELVDENKRLREKLETFERSKM  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                     L  +E   +ES TTNV S +SG  P +D SDTSLKLGLP
Sbjct  181  ---------LAFKEAVETESATTNVSSYDSGA-PIEDESDTSLKLGLP  218



>ref|XP_010675143.1| PREDICTED: MADS-box protein JOINTLESS [Beta vulgaris subsp. vulgaris]
Length=225

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 175/227 (77%), Gaps = 7/227 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKI+KIDNITARQVTFSKRRRG+FKKAEEL+VLCDAD+ALIIFSATGKLF+F++ 
Sbjct  1    MAREKIKIRKIDNITARQVTFSKRRRGIFKKAEELSVLCDADIALIIFSATGKLFDFSNC  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
             MKDIL +Y   +    Q  +P LELQLENS   +LSKEVADK+ ELR++KGE+LQG+ L
Sbjct  61   RMKDILSRYTRQTKEEKQ-EEPFLELQLENSNLAKLSKEVADKSQELRKLKGEDLQGVDL  119

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARIN-GEKFP  754
            EEL KLE+ + + L+RV++TKG+R+  EI TLQ++G  LM EN++L++KM  ++ G K  
Sbjct  120  EELLKLERLIGDSLSRVIDTKGKRIKHEIETLQKQGDILMEENQKLRRKMIALSQGRKPA  179

Query  755  VIAD-VEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGL  892
            ++ D  +   I E+G SSESIT N       PL EDD SDTSLKLGL
Sbjct  180  ILLDHSDTSTIHEQGQSSESITNN----GGPPLAEDDSSDTSLKLGL  222



>gb|AGW23370.1| MADS box protein MADS68 [Gossypium hirsutum]
Length=220

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 180/225 (80%), Gaps = 6/225 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTF+KRRRGLFKKAEELA+LCDADVALIIFS+TGKLF++ASS
Sbjct  1    MAREKIQIKKIDNSTARQVTFAKRRRGLFKKAEELAILCDADVALIIFSSTGKLFDYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQ-LENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ L S NL+++ QP L LQ LE+S    L+ E+A+K+H+LRQM+GEEL GL+
Sbjct  61   SMKEILERHHLRSKNLEKLEQPCLGLQLLEHSNQSMLTMEIAEKSHQLRQMRGEELHGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE GL+RV+E KG+R++ EI  LQRKG +LM EN++LKQ++  ING +  
Sbjct  121  IEELQQLEKSLEIGLSRVMEKKGQRIMREIKDLQRKGMQLMEENERLKQQI--INGPR-Q  177

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
            V  D +  +  EEG SSES+ TNVC+ N  P  + + S TSLKLG
Sbjct  178  VTGDSDNIIFGEEGQSSESV-TNVCTSNGNP-HDYESSVTSLKLG  220



>gb|ABQ51117.1| MPF2-like copy 1 [Nolana humifusa]
Length=192

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 156/181 (86%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFSATGKLFEFASS+M DILGKYKLHS++L++V QPSL+LQLENS + RLSKEVADKT 
Sbjct  1    IIFSATGKLFEFASSSMNDILGKYKLHSASLEKVEQPSLDLQLENSFNTRLSKEVADKTK  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQM+GEEL+GLSLEELQ++EK+LE GL RVLE KG R++ EI  LQRKGAELM ENKQ
Sbjct  61   ELRQMRGEELEGLSLEELQEIEKRLETGLNRVLEIKGTRIMDEITDLQRKGAELMEENKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LK+KMA +N  K P+++D++  ++ EEG SSESI  T NVCS NSGPLPEDDCS+TSLKL
Sbjct  121  LKEKMAIMNEGKLPLLSDMDC-MVMEEGQSSESIITTNNVCSSNSGPLPEDDCSNTSLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>ref|XP_010439014.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Camelina sativa]
Length=221

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 138/228 (61%), Positives = 181/228 (79%), Gaps = 12/228 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLEL-QLENSLHMRLSKEVADKTHELRQMkgeelqgl  571
             M+DILG+Y LH+SN+++ ++ PS  L QLEN    RLSKEV DKT +LR+++GE+L GL
Sbjct  61   RMRDILGRYNLHASNINKLIDPPSTHLQQLENCNLSRLSKEVEDKTKQLRKLRGEDLDGL  120

Query  572  sleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKF  751
            +LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G++L++ENK+L++K+      K 
Sbjct  121  NLEELQRLEKLLESGLSRVSEKKGECVMSQISSLEKRGSDLVDENKRLREKLETFERSKM  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                        +E   +ES TTN+ S +SG  P +D SDTSLKLGLP
Sbjct  181  VAF---------KEAVETESATTNMSSYDSGA-PLEDESDTSLKLGLP  218



>emb|CDY11019.1| BnaA03g46780D [Brassica napus]
Length=216

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 181/225 (80%), Gaps = 10/225 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREK +IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKRRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQV-NQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
             MKDILG+Y LH+SN+++V  QPS   Q+EN    RLS+EV DKT +LR+++GE+L+GL+
Sbjct  61   RMKDILGRYNLHASNINKVMGQPSPYNQVENCNLSRLSQEVEDKTKQLRKLRGEDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE ++++I++L+++G+EL++EN++L++++         
Sbjct  121  LEELQRLEKMLESGLSRVSEKKGEFLMSQISSLEKRGSELVDENRRLRERV---------  171

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
            V  ++   +  +E   +ES TTNV S +SG   EDD SDTSLKLG
Sbjct  172  VTMEMAKTMALKEAVETESATTNVSSYDSGAPLEDDFSDTSLKLG  216



>ref|XP_009138200.1| PREDICTED: MADS-box protein AGL24 isoform X4 [Brassica rapa]
 ref|XP_009138207.1| PREDICTED: MADS-box protein AGL24 isoform X4 [Brassica rapa]
 gb|AFM77898.1| MADS-box protein AGL24 [Brassica napus]
 gb|AFM77903.1| MADS-box protein AGL24 [Brassica juncea]
Length=221

 Score =   221 bits (562),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 180/227 (79%), Gaps = 10/227 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+ KKA EL++LCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+DILG+Y LH+SN+++ +  PS   QL+N    RLSKEV DKT +LRQM+G +L+GL+
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLDNCNLSRLSKEVEDKTKQLRQMRGGDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++EN++L++++         
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL---------  171

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            V  ++   +  +E   +ES TTNV S +S    EDD SDTSLKLGLP
Sbjct  172  VTLEMAKTMALKEAVETESATTNVSSYDSAAPIEDDFSDTSLKLGLP  218



>ref|XP_009138187.1| PREDICTED: MADS-box protein AGL24 isoform X2 [Brassica rapa]
Length=223

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 179/227 (79%), Gaps = 8/227 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+ KKA EL++LCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M+DILG+Y LH+SN+++ +  PS   QL+N    RLSKEV DKT +LRQM+G +L+GL+
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQLDNCNLSRLSKEVEDKTKQLRQMRGGDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++EN++L+++   +  E   
Sbjct  121  LEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQYQLVTLEMAK  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
             +A        +E   +ES TTNV S +S    EDD SDTSLKLGLP
Sbjct  181  TMA-------LKEAVETESATTNVSSYDSAAPIEDDFSDTSLKLGLP  220



>gb|ACJ61500.1| MADS-box short vegitative phase [Glycine max]
Length=203

 Score =   219 bits (558),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 174/230 (76%), Gaps = 30/230 (13%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M REKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+V+CDADVALIIFS+TGKLFE++SS
Sbjct  1    MVREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVMCDADVALIIFSSTGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL ++ QPSLELQL ENS   RLSKEVA+K+H+LRQ++GE+LQGL+
Sbjct  61   SMKEILERHHLHSKNLARMEQPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LE+ LE GL RV+E KGE++++EI  LQRKG  LM EN++LK+           
Sbjct  121  IEELQQLERSLETGLGRVIEKKGEKIMSEITDLQRKGMLLMEENERLKR-----------  169

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLPIN  901
                          HSSES+T     CNS   P+D + SDTSLKLGLP +
Sbjct  170  --------------HSSESVTY---VCNSTGPPQDFESSDTSLKLGLPYS  202



>ref|XP_008440541.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Cucumis melo]
Length=214

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 179/229 (78%), Gaps = 21/229 (9%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MA+EKI+I+KIDN TARQVTFSKRRRGLFKKA+EL+VLCDADVALIIFSATGKLFE++SS
Sbjct  1    MAKEKIQIRKIDNATARQVTFSKRRRGLFKKAKELSVLCDADVALIIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK I+ ++ LHS NL ++ QPSLELQL ENS + RL+KE+A+KTH+LRQM+GEELQ L+
Sbjct  61   SMKGIIERHNLHSKNLQKLEQPSLELQLVENSNYTRLNKEIAEKTHQLRQMRGEELQTLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK-F  751
            +EELQ+LEK LE+GL+RV+E              +K AELM+ENK+LKQ+  ++NG +  
Sbjct  121  IEELQQLEKSLESGLSRVME--------------KKSAELMDENKRLKQQAEKMNGVRHL  166

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLP  895
             V  ++   L+ E+G SS S+ T VC  NS   P+D + SDTSLKLGLP
Sbjct  167  GVEPEI---LVVEDGQSSNSV-TEVCVSNSNGPPQDLESSDTSLKLGLP  211



>ref|XP_006574410.1| PREDICTED: MADS-box protein SVP-like isoform X4 [Glycine max]
Length=210

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 174/230 (76%), Gaps = 30/230 (13%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M REKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+V+CDADVALIIFS+TGKLFE++SS
Sbjct  8    MVREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVMCDADVALIIFSSTGKLFEYSSS  67

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL ++ QPSLELQL ENS   RLSKEVA+K+H+LRQ++GE+LQGL+
Sbjct  68   SMKEILERHHLHSKNLARMEQPSLELQLVENSNCSRLSKEVAEKSHQLRQLRGEDLQGLN  127

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LE+ LE GL RV+E KGE++++EI  LQRKG  LM EN++LK+           
Sbjct  128  IEELQQLERSLETGLGRVIEKKGEKIMSEITDLQRKGMLLMEENERLKR-----------  176

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPED-DCSDTSLKLGLPIN  901
                          HSSES+T     CNS   P+D + SDTSLKLGLP +
Sbjct  177  --------------HSSESVTY---VCNSTGPPQDFESSDTSLKLGLPYS  209



>ref|XP_009138194.1| PREDICTED: MADS-box protein AGL24 isoform X3 [Brassica rapa]
 gb|AFM77904.1| MADS-box protein AGL24 [Brassica juncea]
Length=222

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 179/228 (79%), Gaps = 11/228 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+ KKA EL++LCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQP--SLELQLENSLHMRLSKEVADKTHELRQMkgeelqgl  571
            +M+DILG+Y LH+SN++++  P      QL+N    RLSKEV DKT +LRQM+G +L+GL
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQQLDNCNLSRLSKEVEDKTKQLRQMRGGDLEGL  120

Query  572  sleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKF  751
            +LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++EN++L++++        
Sbjct  121  NLEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQL--------  172

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
             V  ++   +  +E   +ES TTNV S +S    EDD SDTSLKLGLP
Sbjct  173  -VTLEMAKTMALKEAVETESATTNVSSYDSAAPIEDDFSDTSLKLGLP  219



>ref|XP_004515126.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Cicer arietinum]
 ref|XP_004515127.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Cicer arietinum]
 ref|XP_004515128.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Cicer arietinum]
Length=227

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 179/228 (79%), Gaps = 6/228 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MA EKIKIKKIDN TARQVTFSKRRRGLFKK EEL+VLCDADVALIIFS+TGKLFE+++ 
Sbjct  1    MASEKIKIKKIDNATARQVTFSKRRRGLFKKGEELSVLCDADVALIIFSSTGKLFEYSNL  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M++IL ++ LHS NL ++ +PSLELQL EN     LSKE+A+K+H+LRQM+GE+L GL+
Sbjct  61   SMREILERHHLHSKNLAELEEPSLELQLVENINCSTLSKEIAEKSHQLRQMRGEDLHGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EEL +LE+ LE GL RVLETK E+++ EI  LQRKG +LM EN +L +  A +N  K  
Sbjct  121  VEELHQLERSLEIGLGRVLETKEEKIMMEIKHLQRKGMQLMEENDRLMRLEANMNNGK--  178

Query  755  VIADVEA-GLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            +   VE+  ++ EEG SSES+ TNVC+ ++GP  +   SDTSLKLGLP
Sbjct  179  MFGGVESENVVNEEGQSSESV-TNVCN-STGPPQDYVSSDTSLKLGLP  224



>ref|XP_009138166.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Brassica rapa]
 ref|XP_009138171.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Brassica rapa]
 ref|XP_009138179.1| PREDICTED: MADS-box protein AGL24 isoform X1 [Brassica rapa]
Length=224

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 134/228 (59%), Positives = 178/228 (78%), Gaps = 9/228 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+ KKA EL++LCDADVALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNLTARQVTFSKRRRGIIKKANELSILCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQP--SLELQLENSLHMRLSKEVADKTHELRQMkgeelqgl  571
            +M+DILG+Y LH+SN++++  P      QL+N    RLSKEV DKT +LRQM+G +L+GL
Sbjct  61   SMRDILGRYNLHASNINKMMGPPSPYHQQLDNCNLSRLSKEVEDKTKQLRQMRGGDLEGL  120

Query  572  sleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKF  751
            +LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++EN++L+++   +  E  
Sbjct  121  NLEELQRLEKSLESGLSRVSEKKGECVMSQISSLEKRGSELVDENRRLREQYQLVTLEMA  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
              +A        +E   +ES TTNV S +S    EDD SDTSLKLGLP
Sbjct  181  KTMA-------LKEAVETESATTNVSSYDSAAPIEDDFSDTSLKLGLP  221



>gb|AES98247.2| MADS-box transcription factor [Medicago truncatula]
Length=225

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 174/227 (77%), Gaps = 4/227 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAR+KIKIKKIDN TARQVTFSKRRRG+FKKAEEL++LCDA+V L+IFS TGKL+E+ASS
Sbjct  1    MARQKIKIKKIDNATARQVTFSKRRRGIFKKAEELSILCDAEVGLVIFSTTGKLYEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            NMKDI+ +Y   S ++ ++++P L++Q+E ++   L+KEVAD+T +LR MK E+ +GL+L
Sbjct  61   NMKDIITRYGQQSHHITKLDKP-LQVQVEKNMPAELNKEVADRTQQLRGMKSEDFEGLNL  119

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E LQ+LEK LE+GL RV+E K ++++ EI  L+ K   L  ENK LKQKMA ++  K P+
Sbjct  120  EGLQQLEKSLESGLKRVIEMKEKKILNEIKALRMKEIMLEEENKHLKQKMAMLSMGKSPI  179

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
              D  + +  +E  S+ES+  NV SCNSGP  EDD SDTSLKLGLP 
Sbjct  180  FGD--SDITMQENVSAESM-NNVSSCNSGPSLEDDSSDTSLKLGLPF  223



>gb|ABQ51124.1| MPF2-like [Schizanthus grahamii]
Length=178

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 154/179 (86%), Gaps = 1/179 (1%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFSATGKLFEFASS+M DILGKYKLH+++L+++  PSLELQLENSL MRL+KEV DKT 
Sbjct  1    IIFSATGKLFEFASSSMNDILGKYKLHTTSLEKIEPPSLELQLENSLQMRLNKEVTDKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQMKGEELQGLS+EELQ+LEK+LE GLTRVL  KGER++TEIA LQ+KGAELM ENK 
Sbjct  61   ELRQMKGEELQGLSIEELQQLEKRLEAGLTRVLNIKGERIMTEIANLQKKGAELMEENKL  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
            L+++MA +   K  ++  ++  ++ EEG SSESITTNVCSC+SGP PEDDCSDTSLKLG
Sbjct  121  LEERMAMMGEGKSALVTGLDC-MVMEEGQSSESITTNVCSCSSGPPPEDDCSDTSLKLG  178



>gb|ACJ84016.1| unknown [Medicago truncatula]
 gb|AFK49431.1| unknown [Medicago truncatula]
Length=225

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 174/227 (77%), Gaps = 4/227 (2%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAR+KIKIKKIDN TARQVTFSKRRRG+FKKAEEL++LCDA+V L+IFS TGKL+E+ASS
Sbjct  1    MARQKIKIKKIDNATARQVTFSKRRRGIFKKAEELSILCDAEVGLVIFSTTGKLYEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            NMKDI+ +Y   S ++ ++++P L++Q+E ++   L+KEVAD+T +LR MK E+ +GL+L
Sbjct  61   NMKDIITRYGQQSHHITKLDKP-LQVQVEKNMPAELNKEVADRTQQLRGMKSEDFEGLNL  119

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E LQ+LEK LE+GL RV+E K ++++ EI  L+ K   L  EN+ LKQKMA ++  K P+
Sbjct  120  EGLQQLEKSLESGLKRVIEMKEKKILNEIKALRMKEIMLEEENRHLKQKMAMLSMGKSPI  179

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
              D  + +  +E  S+ES+  NV SCNSGP  EDD SDTSLKLGLP 
Sbjct  180  FGD--SDITMQENVSAESM-NNVSSCNSGPSLEDDSSDTSLKLGLPF  223



>ref|XP_006282463.1| hypothetical protein CARUB_v10005653mg [Capsella rubella]
 gb|EOA15361.1| hypothetical protein CARUB_v10005653mg [Capsella rubella]
Length=231

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 180/226 (80%), Gaps = 12/226 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDNITARQVTFSKRRRG+FKKA+EL+VLCDADVAL+IFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNITARQVTFSKRRRGIFKKADELSVLCDADVALVIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQ-VNQPSLEL-QLENSLHMRLSKEVADKTHELRQMkgeelqgl  571
             M+DILGKY LH+SN+++ ++ PS  L QLEN    RLSKE+ DKT +LR+++GE+L GL
Sbjct  61   RMRDILGKYNLHASNINKMMDPPSTHLQQLENCNLSRLSKEIEDKTKQLRKLRGEDLDGL  120

Query  572  sleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKF  751
            +LEELQ+LEK LE+GL+RV E KGE V+++I++L+++G+EL++ENK+L++K+      K 
Sbjct  121  NLEELQRLEKMLESGLSRVTEKKGECVMSQISSLEKRGSELVDENKRLREKLETFERAKM  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
                     +  +E   +ES TTN+ S +SG  P +D SDTSLKLG
Sbjct  181  ---------MASKEAVETESATTNLSSYDSGA-PLEDESDTSLKLG  216



>ref|XP_010680338.1| PREDICTED: MADS-box protein JOINTLESS [Beta vulgaris subsp. vulgaris]
Length=227

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 177/230 (77%), Gaps = 6/230 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVAL+IFSATGKLFE++SS
Sbjct  1    MAREKIQIKKIDNTTARQVTFSKRRRGLFKKAEELSVLCDADVALVIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK IL K+KLHS NLD++ QPSL+LQL ENS +  L++E+A K+ +LR M+GEELQGL 
Sbjct  61   SMKTILEKHKLHSKNLDKLEQPSLKLQLVENSNYTELNEEIARKSQQLRHMRGEELQGLG  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARIN-GEKF  751
            +EELQ+LEK LE GL  V++ KGE++  EI  L++KGA+LM EN+ L+Q++   + G + 
Sbjct  121  IEELQQLEKSLEFGLKHVMDKKGEKITNEIDLLEQKGAKLMEENEWLRQQVLEASKGTQQ  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
               +D    ++ EEG SSESI+    S  +     D+ SDT LKLGLP +
Sbjct  181  AADSDY---VVYEEGQSSESISNGYSSGGTSQ-DCDEGSDTYLKLGLPYS  226



>gb|ABQ51150.1| MPF2-like copy 1 [Tubocapsicum anomalum]
Length=193

 Score =   216 bits (550),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 155/181 (86%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFSATGKLFEFASS+M+DILGKYKL S+NL++V+QPSL+LQLENSL++RLSK+VADKT 
Sbjct  1    IIFSATGKLFEFASSSMRDILGKYKLQSANLEKVDQPSLDLQLENSLNVRLSKQVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQM+GEEL+GLSLEELQ++EK+LE G  RVLE KG R++ EIA LQRKGAEL+ ENKQ
Sbjct  61   ELRQMRGEELEGLSLEELQQIEKRLEAGFNRVLEIKGARIMDEIAKLQRKGAELIEENKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM  +   K P++ D++  ++ EEG SSESI  T NVCS NSGPLPEDDCS+ SLKL
Sbjct  121  LKQKMEMLKEGKLPLVTDMDC-MVMEEGQSSESIITTNNVCSNNSGPLPEDDCSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>gb|AAW66885.1| MADS box transcription factor [Elaeis guineensis]
Length=225

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 176/225 (78%), Gaps = 3/225 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEELA+LCDADVALIIFS+TGKLFEF+SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELAILCDADVALIIFSSTGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MK+IL K+ LHS NL +V  PSL+L LENS + RL K+VA+ + +LRQM+GEELQGL++
Sbjct  61   SMKEILEKHSLHSKNLQKVEPPSLDLNLENSNYTRLDKQVAEASLQLRQMRGEELQGLTM  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            +ELQ+LEK LE GL+ VLE KG++++ +I  LQ+KG  LM EN++L++++  +      V
Sbjct  121  QELQQLEKNLETGLSCVLERKGQQIMEQINHLQQKGMHLMEENERLRKQVVEMARAGRRV  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGL  892
            + D E  ++ E+G SSES+T    S    P   DD SDTSLKLG+
Sbjct  181  LTDSE-NVMYEDGQSSESVTN--ASQLVVPPNYDDSSDTSLKLGV  222



>gb|ABQ51118.1| MPF2-like copy 2 [Nolana humifusa]
Length=192

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 155/181 (86%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFSATGKLFEFASS+M DILGKYKLHS++L++V QPSL+LQLENS + RLSKEVA+KT 
Sbjct  1    IIFSATGKLFEFASSSMNDILGKYKLHSASLEKVEQPSLDLQLENSFNTRLSKEVAEKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQM+GEEL+GLSLEELQ++EK+LE GL RVLE KG R++ EI  LQRKGAELM ENKQ
Sbjct  61   ELRQMRGEELEGLSLEELQEIEKRLETGLNRVLEIKGTRIMDEITNLQRKGAELMEENKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LK+KMA +N  K P+++D++  ++ EEG SSESI  T NVCS NSGP PEDDCS+TSLKL
Sbjct  121  LKEKMAIMNEGKLPLLSDMDC-MVMEEGQSSESIITTNNVCSSNSGPPPEDDCSNTSLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>ref|XP_006466301.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466302.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Citrus 
sinensis]
 ref|XP_006466303.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X3 [Citrus 
sinensis]
Length=217

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 141/227 (62%), Positives = 179/227 (79%), Gaps = 14/227 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRG+FKKAEEL+VLCDADVALIIFSATGKLFE++SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQ-LENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL K+++HS NL++V+QPS+ELQ LEN+ +  L KE A+K+H LRQM+GEE+ GLS
Sbjct  61   SMKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQKLE+ LE GL RV+E K E++  EI  LQR+G  LM EN++L+Q++A +      
Sbjct  121  LEELQKLERSLEVGLGRVIEKKEEKITKEINELQRRGKLLMEENERLRQQVAEV------  174

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                  +    EEG SSES+  N+C+ ++ P PE + SDTSLKLGLP
Sbjct  175  ------SNAYGEEGQSSESV-NNICNSSNAPPPESESSDTSLKLGLP  214



>ref|XP_006426275.1| hypothetical protein CICLE_v10026457mg [Citrus clementina]
 ref|XP_006426276.1| hypothetical protein CICLE_v10026457mg [Citrus clementina]
 gb|ESR39515.1| hypothetical protein CICLE_v10026457mg [Citrus clementina]
 gb|ESR39516.1| hypothetical protein CICLE_v10026457mg [Citrus clementina]
Length=217

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 179/227 (79%), Gaps = 14/227 (6%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRG+FKKAEEL+VLCDADVALIIFSATGKLFE++SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQ-LENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL K+++HS NL++V+QPS+ELQ LEN+ +  L KE A+K+H LRQM+GEE+ GLS
Sbjct  61   SMKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            LEELQ+LE+ LE GL RV+E K E++  EI  LQR+G  LM EN++L+Q++A +      
Sbjct  121  LEELQRLERSLEVGLGRVIEKKEEKITKEINELQRRGKLLMEENERLRQQVAEV------  174

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                  +    EEG SSES+  N+C+ ++ P PE + SDTSLKLGLP
Sbjct  175  ------SNAYGEEGQSSESV-NNICNSSNAPPPESESSDTSLKLGLP  214



>emb|CDX92641.1| BnaC07g38990D [Brassica napus]
Length=229

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 180/231 (78%), Gaps = 9/231 (4%)
 Frame = +2

Query  200  RTIHSQMAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKL  379
            R++  +MAREK +IKKIDNITARQVTFSKRRRG+FKKA EL+VLCDADVALIIFSATGKL
Sbjct  7    RSVVKKMAREKRRIKKIDNITARQVTFSKRRRGIFKKAGELSVLCDADVALIIFSATGKL  66

Query  380  FEFASSNMKDILGKYKLHSSNLDQV-NQPSLELQLENSLHMRLSKEVADKTHELRQMkge  556
            FEF+SS M+DILG+Y LH+SN+++V   PS   QLE+    RLS+EV DKT +LR+++GE
Sbjct  67   FEFSSSRMRDILGRYNLHASNINKVMGLPSPYHQLEDCNLSRLSQEVEDKTKQLRKLRGE  126

Query  557  elqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI  736
            +L+GL+LEELQ+LEK LE+GL+RV E KGE ++++I++L+++G+EL +EN++L+      
Sbjct  127  DLEGLNLEELQRLEKMLESGLSRVSEKKGEFLMSQISSLEKRGSELADENRRLR------  180

Query  737  NGEKFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
              E+     ++   +  +E   +ES TTNV S +SG   EDD SDTSLKLG
Sbjct  181  --ERVVTTMEMAKTMALKEAVETESATTNVSSYDSGAPLEDDFSDTSLKLG  229



>gb|ADZ72841.1| AGAMOUS-like 24-like protein 2 [Aquilegia formosa]
Length=211

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 172/213 (81%), Gaps = 2/213 (1%)
 Frame = +2

Query  260  TARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYKLHSS  439
            T+RQVTFSKRRRGL KKA EL++LCDA+VALIIFSATGKLFE++SS+M +IL +  LHS 
Sbjct  1    TSRQVTFSKRRRGLLKKAHELSILCDAEVALIIFSATGKLFEYSSSSMGEILERQSLHSK  60

Query  440  NLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkleNGL  619
            NL +++QPSLELQLEN+ + RLSKE+A+K+H+LRQM+GEEL+ L++EELQ+LEK LE GL
Sbjct  61   NLQKLDQPSLELQLENNNYARLSKEIAEKSHQLRQMRGEELRELNIEELQQLEKSLETGL  120

Query  620  TRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIPEEGH  799
            +RVLETK ++++ EI+TL  KG  LM EN++L++++  ++ E+  V  D++  ++ EEG 
Sbjct  121  SRVLETKSDKIMKEISTLHTKGMLLMEENERLRKQVVDMSSEQGNVPGDLKNNVVFEEGQ  180

Query  800  SSESITTNVCSCNSGPLPEDDCSDTSLKLGLPI  898
            SSES+T    S   GP P++D SDTSL+LGL +
Sbjct  181  SSESVTN--ISNPGGPPPDNDSSDTSLRLGLSL  211



>ref|XP_003613054.1| MADS-box protein SVP [Medicago truncatula]
 gb|AES96012.1| MADS-box transcription factor [Medicago truncatula]
Length=228

 Score =   215 bits (548),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 175/227 (77%), Gaps = 3/227 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKI+N TARQVTFSKRRRGL KKAEEL+VLCDADVALIIFS+TGKLFE+++ 
Sbjct  1    MAREKIQIKKIENSTARQVTFSKRRRGLIKKAEELSVLCDADVALIIFSSTGKLFEYSNL  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M++IL ++ LHS NL ++ +PSLELQL ENS   RLS EV+ K+H+LRQM+GE+L+GL+
Sbjct  61   SMREILERHHLHSKNLAKLEEPSLELQLVENSNCSRLSMEVSKKSHQLRQMRGEDLEGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LE+ LE GL RV+E KGE+++ EI  LQRKG +LM EN +LK  +A I  ++  
Sbjct  121  VEELQQLERSLEIGLGRVIENKGEKIMMEINDLQRKGRQLMEENDRLKHHVAGIINDRMV  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
               + E   +  EG SSES+T    S   GP  + + SDTSLKLGLP
Sbjct  181  GGDESENENVVNEGQSSESVTNVYNSI--GPPQDYESSDTSLKLGLP  225



>ref|XP_004490446.1| PREDICTED: MADS-box protein SVP-like isoform X1 [Cicer arietinum]
 ref|XP_004490447.1| PREDICTED: MADS-box protein SVP-like isoform X2 [Cicer arietinum]
 ref|XP_004490448.1| PREDICTED: MADS-box protein SVP-like isoform X3 [Cicer arietinum]
Length=219

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 167/226 (74%), Gaps = 9/226 (4%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAR+KIKIKKIDN TARQVTFSKRRRG+FKKAEEL+VLCDA+V LIIFSATGKL+E+ SS
Sbjct  1    MARQKIKIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDAEVGLIIFSATGKLYEYGSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            NMKDI+ +Y  H  ++ + N+P  E Q EN L   L KEVADKT +LR MKGE+ +G++L
Sbjct  61   NMKDIITRYNQHFQHMSKSNKPLQEFQGEN-LSAELQKEVADKTQQLRGMKGEDFEGINL  119

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            + LQ+LEK LE GL RV+E K +R+V EI+TLQ KG +L  +NK LKQKMA +   K  +
Sbjct  120  KGLQELEKTLETGLKRVMEMKEKRIVNEISTLQIKGIKLEEQNKHLKQKMAMLCNRKNLI  179

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            + D  + +  +E  SSES+       NSG   EDD SDTSLKLGLP
Sbjct  180  LGD--SDITMQEIVSSESMN------NSGLSLEDDSSDTSLKLGLP  217



>gb|ABQ51151.1| MPF2-like copy 1 [Withania coagulans]
Length=216

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 154/188 (82%), Gaps = 7/188 (4%)
 Frame = +2

Query  335  DADVALIIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKE  514
            DADVALI+FSATGKLFEFASS+MKDILGKYKL S+NL++V QPSL+LQLENSL++RL K+
Sbjct  1    DADVALIVFSATGKLFEFASSSMKDILGKYKLQSANLEKVYQPSLDLQLENSLNVRLCKQ  60

Query  515  VADKTHELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAEL  694
            VADKT ELRQMKGEEL+GLSLEELQ+LEK+LE G  RV+E K  R++ EIA LQRKGAEL
Sbjct  61   VADKTRELRQMKGEELEGLSLEELQQLEKRLEAGFNRVVEIKDRRIMDEIANLQRKGAEL  120

Query  695  MNENKQLKQKMARINGEKFPVIADVEAGLIPEEGHSSESI---TTNVCSCNSGPLPEDDC  865
            M ENKQLK+KM      K P++ D    ++ EEG SS+SI   T N+CS NSGP PEDDC
Sbjct  121  MEENKQLKEKMEMTKVGKLPLLTD----MVMEEGQSSDSIITTTNNICSSNSGPPPEDDC  176

Query  866  SDTSLKLG  889
            S+ SLKLG
Sbjct  177  SNVSLKLG  184



>gb|AHH28263.1| MADS-box transcription factor, partial [Rhizanthes lowii]
Length=220

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 174/222 (78%), Gaps = 3/222 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDA VALIIFSATGKLFE++SS
Sbjct  1    MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDAHVALIIFSATGKLFEYSSS  60

Query  398  NMKDILGKY-KLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+I+ +Y   H  + ++ +QPSLELQLE S  +RLS EVADKT +LRQM+GE+L+ L+
Sbjct  61   SMKEIISRYDDRHFDSKEKPSQPSLELQLEISNRVRLSNEVADKTRQLRQMRGEDLRELT  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
             E+LQ+LEK LE GL RV + K +R+  EI+ L+RKGA+LM ENKQL++KM  +     P
Sbjct  121  AEDLQQLEKLLEVGLQRVADAKRKRITNEISELERKGAQLMEENKQLRKKMVMMCNGTRP  180

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSL  880
             I + +   I EEG SS+S T  VCSC++GP  EDD SDT L
Sbjct  181  AILESDIT-IHEEGMSSDSATV-VCSCSNGPPVEDDISDTYL  220



>ref|NP_001239872.1| uncharacterized protein LOC100776749 [Glycine max]
 ref|XP_006580976.1| PREDICTED: uncharacterized protein LOC100776749 isoform X1 [Glycine 
max]
 gb|ACU18174.1| unknown [Glycine max]
 gb|KHN09002.1| MADS-box protein SVP [Glycine soja]
Length=234

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 172/234 (74%), Gaps = 7/234 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M R +IKIKKIDNITARQVTFSKRRRGLFKKAEEL+VLCDA+V LI+FS+TGKLF+++SS
Sbjct  1    MTRTRIKIKKIDNITARQVTFSKRRRGLFKKAEELSVLCDAEVGLIVFSSTGKLFDYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +M DI+ KY  HS  ++++++PSLELQLE S   +LSKE+AD+T EL  +KG++LQGL L
Sbjct  61   SMNDIVTKYSTHSHGINKLDKPSLELQLEASNSAKLSKEIADRTQELSWLKGDDLQGLGL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGE----  745
             ELQ+LEK LE GL RV + K  +++++I+ LQ+KG  L  ENK L +K+A    E    
Sbjct  121  NELQQLEKTLEIGLDRVTDIKENQIMSQISELQKKGILLEEENKHLTKKLAEKEKEAMLC  180

Query  746  --KFPVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
              K P + D + G++ EEG S +S T N+ SC S P  ED  SD SL LGLP +
Sbjct  181  KAKIPFMVDSDKGIMQEEGVSLDS-TNNISSCISDPPLEDGSSDISLTLGLPFS  233



>ref|XP_010942683.1| PREDICTED: MADS-box protein SVP-like [Elaeis guineensis]
 ref|XP_010942684.1| PREDICTED: MADS-box protein SVP-like [Elaeis guineensis]
Length=228

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 179/226 (79%), Gaps = 3/226 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M REKI+I+KIDN TARQVTFSKRRRGL KKAEEL++LCDA+VALI+FS+TGKL+E++SS
Sbjct  1    MVREKIQIRKIDNATARQVTFSKRRRGLLKKAEELSILCDAEVALIVFSSTGKLYEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MK+I+ K+ +HS NL + +QP L+L LENS H  LSK+VAD + +LRQM+GEEL+GLS+
Sbjct  61   SMKEIIEKHSMHSKNLQKPDQPPLDLNLENSKHASLSKQVADMSLQLRQMRGEELEGLSI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EELQ+LEK LE GL+RV++ KGE+++ +I  LQ+KG +LM EN +L++++ +++     +
Sbjct  121  EELQQLEKALEAGLSRVIDRKGEQIMEQINGLQQKGLKLMEENTRLREQVLKLSRVGKQM  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            + D E  L  E+G SSES+ TNV +   G    DD SDTSLKLGLP
Sbjct  181  MNDKENAL-NEDGQSSESV-TNVLNP-GGSQDYDDSSDTSLKLGLP  223



>pir||H84613 probable MADS-box protein [imported] - Arabidopsis thaliana
 gb|AAD22365.1| putative MADS-box protein [Arabidopsis thaliana]
 dbj|BAH30395.1| hypothetical protein [Arabidopsis thaliana]
Length=210

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 155/172 (90%), Gaps = 1/172 (1%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+I+KIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLFEF SS
Sbjct  1    MAREKIQIRKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFEFCSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK++L ++ L S NL++++QPSLELQL ENS H R+SKE+ADK+H LRQM+GEELQGL 
Sbjct  61   SMKEVLERHNLQSKNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLD  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMA  730
            +EELQ+LEK LE GLTRV+ETK +++++EI+ LQ+KG +LM+ENK+L+Q++ 
Sbjct  121  IEELQQLEKALETGLTRVIETKSDKIMSEISELQKKGMQLMDENKRLRQQVC  172



>dbj|BAF46766.1| DNA-binding protein [Ipomoea nil]
Length=234

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 175/234 (75%), Gaps = 11/234 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAR+KI+I+KIDN+TARQVTFSKRRRGLFKKAEEL+VLCDADVALI+FS++ KLF +++S
Sbjct  1    MARDKIQIRKIDNVTARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSSAKLFHYSNS  60

Query  398  NMKDILGKYKLHSSNLDQVN-QPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgl  571
            +M++IL K  LHS NL ++  QPS+ELQL ENS H R SKE+A+KT  LRQM+ EELQ L
Sbjct  61   SMREILEKRNLHSKNLQKMGLQPSVELQLVENSNHSRSSKEIAEKTQRLRQMRVEELQEL  120

Query  572  sleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARIN-GEK  748
            S+EELQ+LE+ L+ GL  V+  KGE+++ EI  LQ KG  LM EN +L+Q++   + G++
Sbjct  121  SIEELQQLERSLQIGLDHVINKKGEKIMKEINQLQEKGVHLMEENDRLRQQVVETSKGQR  180

Query  749  FPVIA--DVEAGLIPEEGHSSESITTNVCSCNSGPLPED---DCSDTSLKLGLP  895
               +A  D E  L  E G SSES+T    +C     P+D   DCSDTSLKLGLP
Sbjct  181  SMAVAPRDSENLLNEEGGLSSESVTN---ACKYPGTPQDYYEDCSDTSLKLGLP  231



>ref|XP_004509780.1| PREDICTED: MADS-box protein SVP-like [Cicer arietinum]
Length=227

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 184/228 (81%), Gaps = 6/228 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MA+EKIKIKKI+N TARQVTFSKRRRGLFKKAEEL+VLC+ADVALIIFS+TGKLFE+++ 
Sbjct  1    MAKEKIKIKKINNATARQVTFSKRRRGLFKKAEELSVLCEADVALIIFSSTGKLFEYSNL  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +M++IL ++ LHS NL +  +PSLELQL EN    RLSKE+A+K+H+LRQM+GE+L GL+
Sbjct  61   SMREILERHHLHSKNLAKPEEPSLELQLVENINCSRLSKEIAEKSHQLRQMRGEDLHGLN  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI-NGEKF  751
            +EELQ+LE+ LE GL RV+ETKGE+++ EI  LQRKG +LM EN +LKQ +A + NG  F
Sbjct  121  VEELQQLERSLEIGLERVMETKGEKIMMEINALQRKGMQLMEENDRLKQHLANMNNGNMF  180

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                D    ++ EEG SSES+ TNVC+ ++GP  + + SDTSLKLGLP
Sbjct  181  G--GDESENVVNEEGQSSESV-TNVCN-STGPPQDYESSDTSLKLGLP  224



>ref|XP_010530248.1| PREDICTED: MADS-box protein AGL24-like [Tarenaya hassleriana]
 ref|XP_010530256.1| PREDICTED: MADS-box protein AGL24-like [Tarenaya hassleriana]
Length=223

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 173/229 (76%), Gaps = 8/229 (3%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M R+KI+IKKIDN+TARQVTFSKRRRG+FKK+EEL+VLCDADVALIIFSATGKLFEF+SS
Sbjct  1    MTRKKIRIKKIDNVTARQVTFSKRRRGIFKKSEELSVLCDADVALIIFSATGKLFEFSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
             M+DIL +Y LH+SNL+++N P L+LQLENS  + LS+EV +K  +L  ++GE+LQGL+L
Sbjct  61   RMRDILARYNLHTSNLNKLNPPPLDLQLENSNLVVLSREVEEKNKQLCHLRGEDLQGLNL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E+L +LEK LE+GL RVLE KGER + +I++ +R+GAEL  EN +L++++  +   K   
Sbjct  121  EDLHRLEKLLESGLGRVLEKKGERSMDQISSFERRGAELEKENNKLRERLNMLERGKAKA  180

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLP-EDDCSDTSLKLGLPIN  901
              + E   I EEG      TT   S +   LP  DDCSDTSLKL LP +
Sbjct  181  FGEGEMVGI-EEG------TTTNLSISGSSLPLRDDCSDTSLKLALPFS  222



>gb|ABQ51110.1| MPF2-like [Lycium barbarum]
Length=192

 Score =   211 bits (537),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFSATGKLFEFASS+M DILGKYKLHS+ L++V QPSL+LQLENS + RLSKEVADKT 
Sbjct  1    IIFSATGKLFEFASSSMNDILGKYKLHSAGLEKVEQPSLDLQLENSFNTRLSKEVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            E+RQ++GEEL+GLS EELQ++EK+LE+GL RVLE KG R++ EI+ LQRKGAELM ENKQ
Sbjct  61   EMRQIRGEELEGLSFEELQQIEKRLESGLNRVLEIKGTRIMDEISNLQRKGAELMEENKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LK+KMA +N  K P++ +++  L+ EEG SSESI  T NVCS NSGP PEDDCS+ SLKL
Sbjct  121  LKEKMAIMNEGKLPLLTEMDC-LVMEEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>ref|XP_010555411.1| PREDICTED: MADS-box protein SVP-like [Tarenaya hassleriana]
Length=239

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 178/240 (74%), Gaps = 18/240 (8%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M+REKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+T KLFE++SS
Sbjct  1    MSREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTSKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK ++ ++   S N +++N+PSLELQL ++S H RLSKE+ +K+H LRQM+G+ELQGL 
Sbjct  61   SMKKMIERHSSQSKNSEKLNRPSLELQLVDDSEHSRLSKELVEKSHRLRQMRGDELQGLD  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEK--  748
            +EELQ+LEK LE GL RV+E K E+++ EI  LQRKG +LM +NK+L+Q+  ++  E   
Sbjct  121  MEELQQLEKALEAGLNRVIEKKSEKIMNEINDLQRKGIQLMEQNKRLRQQGVQLMDENER  180

Query  749  --------FPVIADVEA-GLIPEEGHSSESITTNVCSCNSGPLPEDDC--SDTSLKLGLP  895
                    +    D E+   + E G+SSES+ TN  +    P+   DC  SDTSLKLGLP
Sbjct  181  LGQRISNGYERYGDAESENAVEEGGNSSESV-TNAGNSTGAPV---DCESSDTSLKLGLP  236



>gb|AHH28298.1| MADS-box transcription factor, partial [Clutia sp. DAV B80.252/F1980.8371]
Length=207

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 172/212 (81%), Gaps = 6/212 (3%)
 Frame = +2

Query  269  QVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASSNMKDILGKYKLHSSNLD  448
            QVTFSKRRRGL KKAEEL+VLCDADVALIIFS+TGKLFE++SS+MK++L ++KLHS NL+
Sbjct  1    QVTFSKRRRGLLKKAEELSVLCDADVALIIFSSTGKLFEYSSSSMKEVLERHKLHSKNLE  60

Query  449  QVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqglsleelqklekkleNGLTR  625
            ++ QPSLELQL ENS   RLS+EVA K+H+LRQM+GEELQGL++E+LQ+LEK LE+GL+R
Sbjct  61   KLQQPSLELQLVENSNFSRLSEEVAKKSHQLRQMRGEELQGLNIEDLQQLEKSLESGLSR  120

Query  626  VLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPVIADVEAGLIPEEGHSS  805
            ++E KG++++ EI  LQRKG +LM EN+ LKQ+++  NG K     D E  ++ EEG SS
Sbjct  121  IIEKKGDKIMKEITELQRKGTQLMEENELLKQQIS--NGRKQVGGGDSE-NIVYEEGQSS  177

Query  806  ESITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
            ES+  N+C  ++GP  + + SDT LKLGLP +
Sbjct  178  ESV--NLCYSSNGPPNDYESSDTYLKLGLPYS  207



>gb|ABQ51101.1| MPF2-like copy 1 [Atropa belladonna]
Length=192

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFSATGK FEFASS+M DIL KYKLHS++L++V QPSL+LQLENS +MRLSKEVADKT 
Sbjct  1    IIFSATGKFFEFASSSMNDILRKYKLHSASLEKVEQPSLDLQLENSFNMRLSKEVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQM+GEEL+GLSLEELQ++EK+LE GL RVLE KG R V EI  LQRKGAELM ENKQ
Sbjct  61   ELRQMRGEELEGLSLEELQQIEKRLEAGLNRVLEIKGTRFVDEITKLQRKGAELMEENKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM  +N  K P++ +++  ++ EEG SSESI  T NVCS NSGP PEDDCS+ SLKL
Sbjct  121  LKQKMEIMNEGKLPLLTEMDC-MVMEEGQSSESIITTNNVCSSNSGPSPEDDCSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>gb|ABQ51147.1| MPF2-like copy 1 [Withania somnifera]
Length=204

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 152/184 (83%), Gaps = 3/184 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFSATGKLFE+ASS+M+DILGKYKL S+NL++V+QPSL+LQLENSL+MRLSK+VADKT 
Sbjct  1    IIFSATGKLFEYASSSMRDILGKYKLQSANLEKVDQPSLDLQLENSLNMRLSKQVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQM+GEEL+GLSLEELQ++EK+LE G  RVLE KG R++ EI  LQRKGAELM E KQ
Sbjct  61   ELRQMRGEELEGLSLEELQQIEKRLEAGFNRVLEIKGARIMDEITKLQRKGAELMEEKKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            L QKM  +   K P++ D++  ++ EEG SSESI  T NVCS NSGP PEDDCS+ SLKL
Sbjct  121  LNQKMEMLKEGKLPLVIDMDC-MVMEEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKL  179

Query  887  GLPI  898
            G  I
Sbjct  180  GCNI  183



>gb|ABQ51104.1| MPF2-like copy 4 [Atropa belladonna]
Length=192

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFSATGK FEFASS+M DIL KYKLHS++L++V QPSL+LQLENS +MRLSKEVADKT 
Sbjct  1    IIFSATGKFFEFASSSMNDILRKYKLHSASLEKVEQPSLDLQLENSFNMRLSKEVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQM+G+EL+GLSLEELQ++E++LE GL RVLE KG R V EI  LQRKGAELM ENKQ
Sbjct  61   ELRQMRGDELEGLSLEELQQIERRLEAGLNRVLEIKGTRFVDEITKLQRKGAELMEENKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM  +N  K P++ +++  ++ EEG SSESI  T NVCS NSGP PEDDCS+ SLKL
Sbjct  121  LKQKMEIMNEGKLPLLTEMDC-MVTEEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>gb|ABQ51102.1| MPF2-like copy 2 [Atropa belladonna]
Length=192

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 150/181 (83%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFSATGK FEFASS+M DIL KYKLHS++L++V QPSL+LQLENS +MRLSKEVADKT 
Sbjct  1    IIFSATGKFFEFASSSMNDILRKYKLHSASLEKVEQPSLDLQLENSFNMRLSKEVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQM+GEEL+GLSLEELQ++EK+LE GL RVLE KG R V EI  LQRKGAELM ENKQ
Sbjct  61   ELRQMRGEELEGLSLEELQQIEKRLEAGLNRVLEIKGTRFVDEITKLQRKGAELMEENKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM  +N  K P++ +++  ++ EEG SSESI  T NVCS NSGP PEDDCS+ SLKL
Sbjct  121  LKQKMEIMNEGKLPLLTELDC-MVMEEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>gb|AIK35209.1| MADS-box transcription factor protein 1 [Camellia sinensis]
Length=218

 Score =   210 bits (534),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 163/226 (72%), Gaps = 11/226 (5%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M R++I+IKKIDN+TARQVTFSKRRRGLFKKA EL+ LCDA++ALI+FSATG+LFE+ASS
Sbjct  1    MVRQRIQIKKIDNVTARQVTFSKRRRGLFKKAHELSTLCDAEIALIVFSATGRLFEYASS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            + + ++ ++ L   NL Q+NQPSLELQLENS    LSKE  ++T ELRQ++GEEL  L  
Sbjct  61   STRQVIERHNLQPQNLVQLNQPSLELQLENSTRAMLSKEAEERTLELRQLRGEELHELGF  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            EEL+KLEK LE GL+RVL+TK +RV  EIA L+RK A LM EN   KQ++          
Sbjct  121  EELKKLEKSLEGGLSRVLKTKDDRVEKEIAALRRKEARLMEENAWSKQQVQ---------  171

Query  758  IADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            +  V  G   E+G SSESIT N  +    P  + D SDTSLKLGLP
Sbjct  172  MQIVNMGQPQEQGQSSESITNNGSTV--APPQDYDSSDTSLKLGLP  215



>ref|XP_008444932.1| PREDICTED: MADS-box protein JOINTLESS isoform X2 [Cucumis melo]
Length=216

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 173/228 (76%), Gaps = 17/228 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGL KKAEEL+VLCDA+VAL++FSATGK FE++SS
Sbjct  1    MAREKIKIKKIDNLTARQVTFSKRRRGLMKKAEELSVLCDAEVALLVFSATGKFFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            ++KD++ +Y LHSSNL ++  PS+ LQ E+S H+RL+KEV + + +LRQM+GE+LQGL+L
Sbjct  61   SIKDVIARYNLHSSNLGKLEYPSIGLQAEDSNHVRLNKEVEEMSQQLRQMRGEDLQGLNL  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFPV  757
            E+L++LE+KLE GLTRVL TK +++++EI  L+               KM R++ E+   
Sbjct  121  EDLKQLERKLEVGLTRVLHTKEKKIMSEIDALE--------------LKMLRLSNERLMA  166

Query  758  I--ADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
            +     +  ++ EEG SSES   NV SCNSGP  +DD SDTSLKLG P
Sbjct  167  VLVDSSDVRVVVEEGVSSES-AANVYSCNSGPPADDDSSDTSLKLGPP  213



>ref|XP_010107287.1| MADS-box protein JOINTLESS [Morus notabilis]
 gb|EXC14620.1| MADS-box protein JOINTLESS [Morus notabilis]
Length=213

 Score =   209 bits (533),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 170/225 (76%), Gaps = 24/225 (11%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADV LIIFS+TGKLF     
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVGLIIFSSTGKLF-----  55

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ LHS NL+++ QPSL+LQL ENS H RLSKE+A+K+H+LRQ++GEELQGL+
Sbjct  56   DMKEILERHNLHSKNLEKLEQPSLQLQLVENSNHSRLSKEIAEKSHQLRQLRGEELQGLN  115

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            +EELQ+LEK LE+GL+RV+E KGE+++ EI  LQRK  E       L Q+ A ++ +   
Sbjct  116  IEELQRLEKSLESGLSRVIEKKGEKIMKEINDLQRKAME-------LSQRQAGVDSD---  165

Query  755  VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLG  889
                    +I EEG SSESI TN C+ +  P   D  SDTSLKLG
Sbjct  166  -------NVINEEGQSSESI-TNACNSSGPPQDCDSTSDTSLKLG  202



>gb|ABQ51103.1| MPF2-like copy 3 [Atropa belladonna]
Length=192

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFSATGK FEFASS+M DIL KYKLHS++L++V QPSL+LQLENS +MRLSKEVADKT 
Sbjct  1    IIFSATGKFFEFASSSMNDILRKYKLHSASLEKVEQPSLDLQLENSFNMRLSKEVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQM+GEEL+GLSLEELQ++ K+LE GL RVLE KG R V EI  LQRKGAELM ENKQ
Sbjct  61   ELRQMRGEELEGLSLEELQQIGKRLEAGLNRVLEIKGTRFVDEIKKLQRKGAELMEENKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM  +N  K P++ +++  ++ EEG SSESI  T NVCS NSGP PEDDCS+ SLKL
Sbjct  121  LKQKMEIMNEGKLPLLTELDC-MVMEEGQSSESIITTNNVCSSNSGPPPEDDCSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>gb|KCW66637.1| hypothetical protein EUGRSUZ_F00420 [Eucalyptus grandis]
Length=194

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKIKIKKIDN+TARQVTFSKRRRGLFKKA EL+VLCDA+VA++IFSATGKLFE++SS
Sbjct  1    MAREKIKIKKIDNVTARQVTFSKRRRGLFKKAGELSVLCDAEVAVVIFSATGKLFEYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqglsl  577
            +MKD L +Y LH +NL+ ++QPSLELQLE+S +MRLSKEVA+K+H LRQ++GE+LQGL++
Sbjct  61   SMKDTLERYTLHHNNLENMDQPSLELQLEHSNNMRLSKEVAEKSHRLRQLRGEDLQGLNI  120

Query  578  eelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMA  730
            EELQ+LEK LE GL RVL TK ER+ TEI  L+ KGAEL+ ENK LKQ ++
Sbjct  121  EELQQLEKMLEAGLNRVLVTKEERIRTEITDLETKGAELIEENKMLKQTVS  171



>ref|XP_010520751.1| PREDICTED: MADS-box protein AGL24-like isoform X3 [Tarenaya hassleriana]
Length=215

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 172/230 (75%), Gaps = 18/230 (8%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN+TARQVTFSKRRRG+FKKAEEL+VLCDA+VALIIFSATGKLFEF+SS
Sbjct  1    MAREKIRIKKIDNVTARQVTFSKRRRGIFKKAEELSVLCDAEVALIIFSATGKLFEFSSS  60

Query  398  -NMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTHELRQMkgeelqgls  574
              M+D+L +Y LH+SNL++ N P L++QLENS  +RLSKEV DKT +LRQ++GE+LQGLS
Sbjct  61   RRMRDMLARYNLHASNLNKFNPPPLDIQLENSNLVRLSKEVEDKTKQLRQLRGEDLQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKFP  754
            L++LQ+LEK +E+GL RVLE              +KGA L  EN +LK+++  +   K  
Sbjct  121  LDDLQRLEKLVESGLGRVLE--------------KKGAALAEENSKLKERLMTLERGKTT  166

Query  755  VIADVEAGLIPEEGHSSES-ITTNVCSCNSGPLPEDDCSDTSLKLGLPIN  901
               + E  +   +G S ES +TTN+ S  SG LP DD SDTSLKL LP +
Sbjct  167  AFGEGEI-VATRDGISLESALTTNLSSSASGSLP-DDFSDTSLKLALPFS  214



>gb|ACJ09169.1| SVP-like protein [Citrus trifoliata]
 gb|ACJ09170.1| SVP-like protein [Citrus trifoliata]
Length=218

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 178/228 (78%), Gaps = 15/228 (7%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            MAREKI+IKKIDN TARQVTFSKRRRG+FKKAEEL+VLCDADVALIIFSAT KLFE++SS
Sbjct  1    MAREKIQIKKIDNATARQVTFSKRRRGIFKKAEELSVLCDADVALIIFSATAKLFEYSSS  60

Query  398  -NMKDILGKYKLHSSNLDQVNQPSLELQ-LENSLHMRLSKEVADKTHELRQMkgeelqgl  571
             +MK+IL K+++HS NL++V+QPS+ELQ LEN+ +  L KE A+K+H LRQM+GEE+ GL
Sbjct  61   RSMKEILEKHRVHSKNLERVDQPSVELQLLENNNYSMLFKEAAEKSHLLRQMRGEEIHGL  120

Query  572  sleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARINGEKF  751
            SLEELQKLE+ LE GL RV+E K E++  EI  LQR+G  LM EN++L+Q++A +     
Sbjct  121  SLEELQKLERSLEVGLGRVIEKKEEKITKEINELQRRGKLLMEENERLRQQVAEV-----  175

Query  752  PVIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
                   +    EEG SSES+  N+C+ ++ P PE + SDTSLKLGLP
Sbjct  176  -------SNAYGEEGQSSESV-NNICNSSNAPPPESESSDTSLKLGLP  215



>gb|ABQ51140.1| MPF2-like copy 1 [Physalis curassavica]
Length=193

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 151/181 (83%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFS+TGKLF+F+SS+MKDILGKYKL S NLD+V+QPSL+LQLENSL++RL K+VADKT 
Sbjct  1    IIFSSTGKLFDFSSSSMKDILGKYKLQSGNLDKVDQPSLDLQLENSLNVRLRKQVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQMKGEEL+GLSLEELQ++EK+LE G  RVLE KG R++ EIA LQRKGAELM ENKQ
Sbjct  61   ELRQMKGEELEGLSLEELQQIEKRLEAGFNRVLEIKGTRIMDEIANLQRKGAELMEENKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM  +   K P++ D+E  ++ EEG SS+SI  T NVCS NSGP PEDD S+ SLKL
Sbjct  121  LKQKMEMMKLGKLPLVTDMEC-MVMEEGQSSDSIITTNNVCSSNSGPPPEDDSSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>gb|ABQ51145.1| MPF2-like [Physalis nicandroides]
Length=193

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFS+TGKLF+F+SS+MKDILGKYKL S NLD+V+QPSL+LQLENSL++RL K+VADKT 
Sbjct  1    IIFSSTGKLFDFSSSSMKDILGKYKLQSGNLDKVDQPSLDLQLENSLNVRLRKQVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQMKGEEL+GLSLEELQ++EK+LE G  RVLE KG R++ EIA LQRKGAELM ENK+
Sbjct  61   ELRQMKGEELEGLSLEELQQIEKRLEAGFNRVLEIKGTRIMDEIANLQRKGAELMEENKK  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM  +   KFP+I D++  ++ EEG SS+SI  T NVCS NSGP PEDD S+ SLKL
Sbjct  121  LKQKMEMMKLGKFPLITDMDC-MVIEEGQSSDSIITTNNVCSSNSGPPPEDDSSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>gb|ABQ51130.1| MPF2-like [Physalis fuscomaculata]
Length=193

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFS+TGKLF+F+SS+M DILGKY LHS+N+D+V+QPSL+LQLENSL++RL KEVADKT 
Sbjct  1    IIFSSTGKLFDFSSSSMNDILGKYNLHSANIDKVDQPSLDLQLENSLNVRLRKEVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQMKGEEL+GLSLEELQ++EK+LE G  RVLE KG R++ EIA LQRKGAELM ENK+
Sbjct  61   ELRQMKGEELEGLSLEELQQIEKRLEAGFNRVLEIKGTRIMDEIANLQRKGAELMEENKK  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM      KFP++ D++  ++ EEG SS+SI  TTNVCS NSGP PEDD S+ SLKL
Sbjct  121  LKQKMEMTKLGKFPLLTDMDI-MVMEEGQSSDSIITTTNVCSSNSGPPPEDDSSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>gb|ABQ51128.1| MPF2-like copy 1 [Physalis viscosa]
 gb|ABQ51129.1| MPF2-like [Physalis mendocina]
Length=193

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 151/181 (83%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFS+TGKLF+F+SS+M DILGKY LHS+N+D+V+QPSL+LQLENSL++RL KEVADKT 
Sbjct  1    IIFSSTGKLFDFSSSSMNDILGKYNLHSANIDKVDQPSLDLQLENSLNVRLRKEVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQMKGEEL+GLSLEELQ++EK+LE G  RVLE KG R+  EIA LQRKGAELM ENK+
Sbjct  61   ELRQMKGEELEGLSLEELQQIEKRLEAGFNRVLEIKGTRITDEIANLQRKGAELMEENKK  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM      KFP++ D++  ++ EEG SS+SI  TTNVCS NSGP PEDD S+ SLKL
Sbjct  121  LKQKMEMTKLGKFPLLTDMDI-MVMEEGQSSDSIITTTNVCSSNSGPPPEDDSSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>ref|XP_009631750.1| PREDICTED: MADS-box protein JOINTLESS-like isoform X2 [Nicotiana 
tomentosiformis]
Length=219

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 136/231 (59%), Positives = 172/231 (74%), Gaps = 20/231 (9%)
 Frame = +2

Query  218  MAREKIKIKKIDNITARQVTFSKRRRGLFKKAEELAVLCDADVALIIFSATGKLFEFASS  397
            M ++KI+IKKIDN TARQVTFSKRRRGLFKKAEEL+VLCDADVALIIFS+TGKLF+++SS
Sbjct  1    MVKDKIQIKKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYSSS  60

Query  398  NMKDILGKYKLHSSNLDQVNQPSLELQL-ENSLHMRLSKEVADKTHELRQMkgeelqgls  574
            +MK+IL ++ L S NL ++ QPSLELQL ENS + RL+KE++ K+H+LRQM+GEELQGLS
Sbjct  61   SMKEILERHNLLSKNLQKLEQPSLELQLVENSDYARLTKEISQKSHQLRQMRGEELQGLS  120

Query  575  leelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQLKQKMARI--NGEK  748
            +E+LQ+LE+ LE GL+RV+E               KG +LM EN++LKQ++  I  N  K
Sbjct  121  VEQLQQLERSLEAGLSRVIEN--------------KGMQLMEENERLKQQVMEISNNSSK  166

Query  749  FP--VIADVEAGLIPEEGHSSESITTNVCSCNSGPLPEDDCSDTSLKLGLP  895
             P  V+A     +  EE  SSES+  N C+  S P  ED  SDTSLKLGLP
Sbjct  167  HPAIVVAVGSENIYYEERQSSESV-NNACNSTSPPPLEDHSSDTSLKLGLP  216



>gb|ABZ89560.1| MPF2-like protein [Physalis acutifolia]
Length=193

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 151/181 (83%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFSATGKLFEFASS+MK+ILGKYKLHS+NL++ +QPSL+LQLENSL++RLSK+VADKT 
Sbjct  1    IIFSATGKLFEFASSSMKNILGKYKLHSANLEKDDQPSLDLQLENSLNVRLSKQVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQMKGEEL+GLSLEELQ++EKKLE G  RVLE KG R + EIA L+RKGAELM ENKQ
Sbjct  61   ELRQMKGEELEGLSLEELQQIEKKLEEGFNRVLEIKGTRFMDEIANLKRKGAELMEENKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM  +   K P++ D++  +  EEG SS+SI  T N CS NSGP PEDDCS+ SLKL
Sbjct  121  LKQKMGMMKVGKLPLLTDMDC-MAMEEGQSSDSIITTNNACSSNSGPPPEDDCSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>gb|ABZ89558.1| MPF2-like protein [Physalis longifolia var. subglabrata]
Length=193

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 151/181 (83%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFS+TGKLF+F+SS+MKDILGKYKL  +NLD V QPSL+LQLENSL++RLSKEVADKT 
Sbjct  1    IIFSSTGKLFDFSSSSMKDILGKYKLQCANLDTVEQPSLDLQLENSLNVRLSKEVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            E+RQMKGEEL+GLSLEELQ++EK+LE G  RVLE KG R++ EIA LQRKGAELM ENK+
Sbjct  61   EIRQMKGEELEGLSLEELQQIEKRLEAGFNRVLEIKGTRMMDEIANLQRKGAELMEENKK  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM  +   K P+I D+E  ++ EEGHSS+SI  T NVCS N+GP PEDD S+ SLKL
Sbjct  121  LKQKMEMMELGKLPLITDMEC-MVMEEGHSSDSIITTNNVCSSNTGPPPEDDSSNASLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



>gb|ABQ51144.1| MPF2-like [Physalis alkekengi]
Length=193

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 152/181 (84%), Gaps = 3/181 (2%)
 Frame = +2

Query  353  IIFSATGKLFEFASSNMKDILGKYKLHSSNLDQVNQPSLELQLENSLHMRLSKEVADKTH  532
            IIFS+TGK+F+FASS+M DILGKYKL S+NL++V+QPSL+LQLENSL++RLSK+VADKT 
Sbjct  1    IIFSSTGKVFDFASSSMMDILGKYKLQSANLEKVDQPSLDLQLENSLNVRLSKQVADKTR  60

Query  533  ELRQMkgeelqglsleelqklekkleNGLTRVLETKGERVVTEIATLQRKGAELMNENKQ  712
            ELRQMKGEEL+GLSLEELQ++EK+LE G  RVL+ KG R++ EIA LQRKGAELM ENKQ
Sbjct  61   ELRQMKGEELEGLSLEELQQIEKRLEAGFNRVLDIKGTRIMDEIAKLQRKGAELMEENKQ  120

Query  713  LKQKMARINGEKFPVIADVEAGLIPEEGHSSESI--TTNVCSCNSGPLPEDDCSDTSLKL  886
            LKQKM  +   K P++ D++  ++ EEG SS+SI  T NVCS NSGP PEDDCS+  LKL
Sbjct  121  LKQKMEMMKAGKLPLLIDMDC-MVMEEGQSSDSIITTNNVCSSNSGPPPEDDCSNAYLKL  179

Query  887  G  889
            G
Sbjct  180  G  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2785043752688